BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035338
(67 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3CW1|E Chain E, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|W Chain W, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|X Chain X, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|Y Chain Y, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3PGW|E Chain E, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|H Chain H, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|3S6N|E Chain E, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
Gemin2 In Complex With Smd1D2FEG FROM HUMAN
pdb|4F7U|E Chain E, Macromolecular Machine 6
pdb|4F7U|H Chain H, Macromolecular Machine 6
pdb|1VU2|C Chain C, The 8s Snrnp Assembly Intermediate
pdb|1VU2|K Chain K, The 8s Snrnp Assembly Intermediate
pdb|1VU2|S Chain S, The 8s Snrnp Assembly Intermediate
pdb|1VU2|AA Chain a, The 8s Snrnp Assembly Intermediate
pdb|1VU2|II Chain i, The 8s Snrnp Assembly Intermediate
pdb|1VU2|QQ Chain q, The 8s Snrnp Assembly Intermediate
pdb|1VU2|YY Chain y, The 8s Snrnp Assembly Intermediate
pdb|1VU3|C Chain C, The 8s Snrnp Assembly Intermediate
pdb|1VU3|K Chain K, The 8s Snrnp Assembly Intermediate
pdb|1VU3|S Chain S, The 8s Snrnp Assembly Intermediate
pdb|1VU3|AA Chain a, The 8s Snrnp Assembly Intermediate
pdb|1VU3|II Chain i, The 8s Snrnp Assembly Intermediate
pdb|1VU3|QQ Chain q, The 8s Snrnp Assembly Intermediate
pdb|4F77|K Chain K, The 8s Snrnp Assembly Intermediate
pdb|4F77|C Chain C, The 8s Snrnp Assembly Intermediate
pdb|4F77|S Chain S, The 8s Snrnp Assembly Intermediate
pdb|4F77|AA Chain a, The 8s Snrnp Assembly Intermediate
pdb|4F77|II Chain i, The 8s Snrnp Assembly Intermediate
pdb|4F77|QQ Chain q, The 8s Snrnp Assembly Intermediate
pdb|4F77|YY Chain y, The 8s Snrnp Assembly Intermediate
Length = 92
Score = 89.0 bits (219), Expect = 6e-19, Method: Compositional matrix adjust.
Identities = 45/82 (54%), Positives = 54/82 (65%), Gaps = 21/82 (25%)
Query: 5 KVQRIMTQPINLIFRFLQS---------------------GFDEYMNLVLDDAEEVHIKK 43
KVQ++M QPINLIFR+LQ+ GFDEYMNLVLDDAEE+H K
Sbjct: 9 KVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKT 68
Query: 44 NTRKPLGRILLKGDNITLMMNT 65
+RK LGRI+LKGDNITL+ +
Sbjct: 69 KSRKQLGRIMLKGDNITLLQSV 90
>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
Length = 83
Score = 42.7 bits (99), Expect = 5e-05, Method: Compositional matrix adjust.
Identities = 22/45 (48%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLM 62
FR + FD +MNLVL+DAEE+ + TR+ LG +L++GDNI +
Sbjct: 38 FRGVLKSFDLHMNLVLNDAEELEDGEVTRR-LGTVLIRGDNIVYI 81
>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
Length = 87
Score = 42.7 bits (99), Expect = 5e-05, Method: Compositional matrix adjust.
Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNIT 60
FR + FD +MNLVL+DAEE+ + TR+ LG +L++GDNI
Sbjct: 36 FRGVLKSFDLHMNLVLNDAEELEDGEVTRR-LGTVLIRGDNIV 77
>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
Length = 86
Score = 42.7 bits (99), Expect = 5e-05, Method: Compositional matrix adjust.
Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNIT 60
FR + FD +MNLVL+DAEE+ + TR+ LG +L++GDNI
Sbjct: 36 FRGVLKSFDLHMNLVLNDAEELEDGEVTRR-LGTVLIRGDNIV 77
>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit.
pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein
With Two Heptamers In The Asymmetric Unit
Length = 85
Score = 42.4 bits (98), Expect = 6e-05, Method: Compositional matrix adjust.
Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNIT 60
FR + FD +MNLVL+DAEE+ + TR+ LG +L++GDNI
Sbjct: 36 FRGVLKSFDLHMNLVLNDAEELEDGEVTRR-LGTVLIRGDNIV 77
>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
Length = 81
Score = 40.0 bits (92), Expect = 4e-04, Method: Compositional matrix adjust.
Identities = 18/45 (40%), Positives = 30/45 (66%), Gaps = 1/45 (2%)
Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLM 62
R + +D++MNLVL D+EE+ + K LG I+++GDN+ L+
Sbjct: 32 VRGMLRSYDQHMNLVLSDSEEIQ-SDGSGKKLGTIVIRGDNVILI 75
>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
Length = 77
Score = 37.4 bits (85), Expect = 0.002, Method: Compositional matrix adjust.
Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLM 62
FR G+D +MNLVL DAEE+ + RK +G ++++GD + +
Sbjct: 27 FRGTLDGYDIHMNLVLLDAEEIQNGEVVRK-VGSVVIRGDTVVFV 70
>pdb|2FWK|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
Associated Sm-Like Protein Lsm5
pdb|2FWK|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
Associated Sm-Like Protein Lsm5
pdb|3PGG|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6
Snrna-Associated Sm- Like Protein Lsm5
pdb|3PGG|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6
Snrna-Associated Sm- Like Protein Lsm5
Length = 121
Score = 34.7 bits (78), Expect = 0.012, Method: Compositional matrix adjust.
Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 14/63 (22%)
Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTR------KPLGR--------ILLKGDNITLMM 63
F + GFDEY+N+VLDD +E K + K L R ILL G+N+ +++
Sbjct: 51 FSGVLRGFDEYVNMVLDDVQEYGFKADEEDISGGNKKLKRVMVNRLETILLSGNNVAMLV 110
Query: 64 NTG 66
G
Sbjct: 111 PGG 113
>pdb|1LJO|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm2) From
Archaeoglobus Fulgidus At 1.95a Resolution
Length = 77
Score = 34.7 bits (78), Expect = 0.015, Method: Compositional matrix adjust.
Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 1/40 (2%)
Query: 23 SGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLM 62
G D+YMNL L +A E ++ R LG I+L+G+N+ L+
Sbjct: 34 EGVDDYMNLYLTNAMECKGEEKVRS-LGEIVLRGNNVVLI 72
>pdb|2Y9A|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
Length = 95
Score = 31.6 bits (70), Expect = 0.12, Method: Compositional matrix adjust.
Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 9/52 (17%)
Query: 24 GFDEYMNLVLDDAEEV---------HIKKNTRKPLGRILLKGDNITLMMNTG 66
FD++MNL+L D +E ++ ++ LG +LL+G+N+ M G
Sbjct: 33 AFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG 84
>pdb|1M8V|A Chain A, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|B Chain B, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|C Chain C, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|D Chain D, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|E Chain E, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|F Chain F, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|G Chain G, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|H Chain H, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|I Chain I, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|J Chain J, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|K Chain K, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|L Chain L, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|M Chain M, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|N Chain N, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
Length = 77
Score = 31.2 bits (69), Expect = 0.13, Method: Compositional matrix adjust.
Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNT 65
FR G+D ++N+VL DAE + K G+I+++GDN+ + T
Sbjct: 29 FRGRLIGYDIHLNVVLADAEMIQ-DGEVVKRYGKIVIRGDNVLAISPT 75
>pdb|1D3B|B Chain B, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|D Chain D, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|F Chain F, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|H Chain H, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|J Chain J, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|L Chain L, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
Length = 91
Score = 31.2 bits (69), Expect = 0.14, Method: Compositional matrix adjust.
Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 9/52 (17%)
Query: 24 GFDEYMNLVLDDAEEV---------HIKKNTRKPLGRILLKGDNITLMMNTG 66
FD++MNL+L D +E ++ ++ LG +LL+G+N+ M G
Sbjct: 33 AFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG 84
>pdb|1H64|1 Chain 1, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|2 Chain 2, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|A Chain A, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|B Chain B, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|C Chain C, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|D Chain D, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|E Chain E, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|F Chain F, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|G Chain G, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|H Chain H, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|I Chain I, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|J Chain J, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|K Chain K, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|L Chain L, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|M Chain M, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|N Chain N, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|O Chain O, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|P Chain P, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Q Chain Q, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|R Chain R, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|S Chain S, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|T Chain T, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|U Chain U, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|V Chain V, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|W Chain W, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|X Chain X, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Y Chain Y, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Z Chain Z, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
Length = 75
Score = 31.2 bits (69), Expect = 0.14, Method: Compositional matrix adjust.
Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNT 65
FR G+D ++N+VL DAE + K G+I+++GDN+ + T
Sbjct: 27 FRGRLIGYDIHLNVVLADAEMIQ-DGEVVKRYGKIVIRGDNVLAISPT 73
>pdb|3PGW|B Chain B, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|Q Chain Q, Crystal Structure Of Human U1 Snrnp
Length = 231
Score = 31.2 bits (69), Expect = 0.15, Method: Compositional matrix adjust.
Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 9/51 (17%)
Query: 25 FDEYMNLVLDDAEEV---------HIKKNTRKPLGRILLKGDNITLMMNTG 66
FD++MNL+L D +E ++ ++ LG +LL+G+N+ M G
Sbjct: 34 FDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG 84
>pdb|3SWN|A Chain A, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|D Chain D, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|P Chain P, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|S Chain S, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
Length = 82
Score = 31.2 bits (69), Expect = 0.16, Method: Compositional matrix adjust.
Identities = 14/44 (31%), Positives = 24/44 (54%)
Query: 24 GFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNTGK 67
GFD+Y+N+VL D E + +LL G+ + +++ GK
Sbjct: 37 GFDDYVNIVLKDVTEYDTVTGVTEKHSEMLLNGNGMCMLIPGGK 80
>pdb|3CW1|A Chain A, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|H Chain H, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|I Chain I, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|J Chain J, Crystal Structure Of Human Spliceosomal U1 Snrnp
Length = 174
Score = 30.8 bits (68), Expect = 0.17, Method: Compositional matrix adjust.
Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 9/51 (17%)
Query: 25 FDEYMNLVLDDAEEV---------HIKKNTRKPLGRILLKGDNITLMMNTG 66
FD++MNL+L D +E ++ ++ LG +LL+G+N+ M G
Sbjct: 34 FDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG 84
>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
Length = 81
Score = 30.8 bits (68), Expect = 0.22, Method: Compositional matrix adjust.
Identities = 16/41 (39%), Positives = 29/41 (70%), Gaps = 2/41 (4%)
Query: 19 RFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNI 59
R + FD+++NL+L+DAEE+ I N K G ++++G+N+
Sbjct: 35 RGILRSFDQHVNLLLEDAEEI-IDGNVYKR-GTMVVRGENV 73
>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|F Chain F, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|O Chain O, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|R Chain R, Structure Of The Lsm657 Complex: An Assembly
Intermediate Of The Lsm1 7 And Lsm2 8 Rings
Length = 117
Score = 30.0 bits (66), Expect = 0.36, Method: Compositional matrix adjust.
Identities = 12/15 (80%), Positives = 13/15 (86%)
Query: 24 GFDEYMNLVLDDAEE 38
GFD+ MNLVLDD EE
Sbjct: 56 GFDQLMNLVLDDVEE 70
>pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|3 Chain 3, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|4 Chain 4, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|5 Chain 5, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3PGW|G Chain G, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|J Chain J, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|3S6N|G Chain G, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
Gemin2 In Complex With Smd1D2FEG FROM HUMAN
pdb|4F7U|G Chain G, Macromolecular Machine 6
pdb|4F7U|J Chain J, Macromolecular Machine 6
pdb|1VU2|H Chain H, The 8s Snrnp Assembly Intermediate
pdb|1VU2|P Chain P, The 8s Snrnp Assembly Intermediate
pdb|1VU2|X Chain X, The 8s Snrnp Assembly Intermediate
pdb|1VU2|FF Chain f, The 8s Snrnp Assembly Intermediate
pdb|1VU2|NN Chain n, The 8s Snrnp Assembly Intermediate
pdb|1VU2|VV Chain v, The 8s Snrnp Assembly Intermediate
pdb|1VU2|4 Chain 4, The 8s Snrnp Assembly Intermediate
pdb|1VU3|H Chain H, The 8s Snrnp Assembly Intermediate
pdb|1VU3|P Chain P, The 8s Snrnp Assembly Intermediate
pdb|1VU3|X Chain X, The 8s Snrnp Assembly Intermediate
pdb|1VU3|FF Chain f, The 8s Snrnp Assembly Intermediate
pdb|1VU3|NN Chain n, The 8s Snrnp Assembly Intermediate
pdb|1VU3|VV Chain v, The 8s Snrnp Assembly Intermediate
pdb|4F77|P Chain P, The 8s Snrnp Assembly Intermediate
pdb|4F77|H Chain H, The 8s Snrnp Assembly Intermediate
pdb|4F77|X Chain X, The 8s Snrnp Assembly Intermediate
pdb|4F77|FF Chain f, The 8s Snrnp Assembly Intermediate
pdb|4F77|NN Chain n, The 8s Snrnp Assembly Intermediate
pdb|4F77|VV Chain v, The 8s Snrnp Assembly Intermediate
pdb|4F77|4 Chain 4, The 8s Snrnp Assembly Intermediate
Length = 76
Score = 29.3 bits (64), Expect = 0.61, Method: Compositional matrix adjust.
Identities = 12/39 (30%), Positives = 26/39 (66%), Gaps = 1/39 (2%)
Query: 24 GFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLM 62
GFD +MNLV+D+ E+ + +G ++++G++I ++
Sbjct: 33 GFDPFMNLVIDECVEM-ATSGQQNNIGMVVIRGNSIIML 70
>pdb|4EMK|A Chain A, Crystal Structure Of Splsm567
Length = 94
Score = 28.9 bits (63), Expect = 0.85, Method: Compositional matrix adjust.
Identities = 14/44 (31%), Positives = 21/44 (47%)
Query: 24 GFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNTGK 67
GFD+Y+N+VL D E + LL G+ ++ GK
Sbjct: 49 GFDDYVNIVLKDVTEYDTVTGVTEKHSEXLLNGNGXCXLIPGGK 92
>pdb|4EMK|C Chain C, Crystal Structure Of Splsm567
Length = 113
Score = 27.7 bits (60), Expect = 1.7, Method: Compositional matrix adjust.
Identities = 11/15 (73%), Positives = 12/15 (80%)
Query: 24 GFDEYMNLVLDDAEE 38
GFD+ NLVLDD EE
Sbjct: 52 GFDQLXNLVLDDVEE 66
>pdb|4EMG|A Chain A, Crystal Structure Of Splsm3
pdb|4EMG|B Chain B, Crystal Structure Of Splsm3
pdb|4EMG|C Chain C, Crystal Structure Of Splsm3
pdb|4EMG|D Chain D, Crystal Structure Of Splsm3
pdb|4EMG|E Chain E, Crystal Structure Of Splsm3
pdb|4EMG|F Chain F, Crystal Structure Of Splsm3
pdb|4EMG|G Chain G, Crystal Structure Of Splsm3
pdb|4EMG|H Chain H, Crystal Structure Of Splsm3
pdb|4EMG|I Chain I, Crystal Structure Of Splsm3
pdb|4EMG|J Chain J, Crystal Structure Of Splsm3
pdb|4EMG|K Chain K, Crystal Structure Of Splsm3
pdb|4EMG|L Chain L, Crystal Structure Of Splsm3
pdb|4EMG|M Chain M, Crystal Structure Of Splsm3
pdb|4EMG|N Chain N, Crystal Structure Of Splsm3
Length = 93
Score = 26.6 bits (57), Expect = 4.0, Method: Compositional matrix adjust.
Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 12/51 (23%)
Query: 24 GFDEYMNLVLDDAEEV------------HIKKNTRKPLGRILLKGDNITLM 62
+DE++N VL DAEE+ K RK + ++GD++ L+
Sbjct: 38 AYDEHLNXVLGDAEEIVTIFDDEETDKDKALKTIRKHYEXLFVRGDSVILI 88
>pdb|3BW1|A Chain A, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
Novel Octameric Ring Organisation
pdb|3BW1|B Chain B, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
Novel Octameric Ring Organisation
Length = 96
Score = 25.4 bits (54), Expect = 8.1, Method: Compositional matrix adjust.
Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 6/45 (13%)
Query: 24 GFDEYMNLVLDDAEEVHIKKN------TRKPLGRILLKGDNITLM 62
FD + N+VL DA E + N + + + ++GD +TL+
Sbjct: 39 AFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLI 83
>pdb|1PLS|A Chain A, Solution Structure Of A Pleckstrin Homology Domain
Length = 113
Score = 25.4 bits (54), Expect = 8.5, Method: Compositional matrix adjust.
Identities = 12/30 (40%), Positives = 18/30 (60%)
Query: 31 LVLDDAEEVHIKKNTRKPLGRILLKGDNIT 60
++L+D E + KK+ P G I LKG +T
Sbjct: 27 VLLEDGIEFYKKKSDNSPKGMIPLKGSTLT 56
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.138 0.383
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,739,333
Number of Sequences: 62578
Number of extensions: 55027
Number of successful extensions: 156
Number of sequences better than 100.0: 29
Number of HSP's better than 100.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 10
Number of HSP's that attempted gapping in prelim test: 130
Number of HSP's gapped (non-prelim): 29
length of query: 67
length of database: 14,973,337
effective HSP length: 38
effective length of query: 29
effective length of database: 12,595,373
effective search space: 365265817
effective search space used: 365265817
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)