BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035338
         (67 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CW1|E Chain E, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|W Chain W, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|X Chain X, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|Y Chain Y, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|E Chain E, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|H Chain H, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|E Chain E, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|E Chain E, Macromolecular Machine 6
 pdb|4F7U|H Chain H, Macromolecular Machine 6
 pdb|1VU2|C Chain C, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|K Chain K, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|S Chain S, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|AA Chain a, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|II Chain i, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|QQ Chain q, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|YY Chain y, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|C Chain C, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|K Chain K, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|S Chain S, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|AA Chain a, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|II Chain i, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|QQ Chain q, The 8s Snrnp Assembly Intermediate
 pdb|4F77|K Chain K, The 8s Snrnp Assembly Intermediate
 pdb|4F77|C Chain C, The 8s Snrnp Assembly Intermediate
 pdb|4F77|S Chain S, The 8s Snrnp Assembly Intermediate
 pdb|4F77|AA Chain a, The 8s Snrnp Assembly Intermediate
 pdb|4F77|II Chain i, The 8s Snrnp Assembly Intermediate
 pdb|4F77|QQ Chain q, The 8s Snrnp Assembly Intermediate
 pdb|4F77|YY Chain y, The 8s Snrnp Assembly Intermediate
          Length = 92

 Score = 89.0 bits (219), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/82 (54%), Positives = 54/82 (65%), Gaps = 21/82 (25%)

Query: 5  KVQRIMTQPINLIFRFLQS---------------------GFDEYMNLVLDDAEEVHIKK 43
          KVQ++M QPINLIFR+LQ+                     GFDEYMNLVLDDAEE+H K 
Sbjct: 9  KVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKT 68

Query: 44 NTRKPLGRILLKGDNITLMMNT 65
           +RK LGRI+LKGDNITL+ + 
Sbjct: 69 KSRKQLGRIMLKGDNITLLQSV 90


>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
 pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
          Methanobacterium Thermoautotrophicum
          Length = 83

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 32/45 (71%), Gaps = 1/45 (2%)

Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLM 62
          FR +   FD +MNLVL+DAEE+   + TR+ LG +L++GDNI  +
Sbjct: 38 FRGVLKSFDLHMNLVLNDAEELEDGEVTRR-LGTVLIRGDNIVYI 81


>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
 pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
          Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
          Length = 87

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 1/43 (2%)

Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNIT 60
          FR +   FD +MNLVL+DAEE+   + TR+ LG +L++GDNI 
Sbjct: 36 FRGVLKSFDLHMNLVLNDAEELEDGEVTRR-LGTVLIRGDNIV 77


>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
 pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
          Archaeal Protein From Methanobacterium
          Thermautotrophicum
          Length = 86

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 1/43 (2%)

Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNIT 60
          FR +   FD +MNLVL+DAEE+   + TR+ LG +L++GDNI 
Sbjct: 36 FRGVLKSFDLHMNLVLNDAEELEDGEVTRR-LGTVLIRGDNIV 77


>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit.
 pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein
          With Two Heptamers In The Asymmetric Unit
          Length = 85

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 1/43 (2%)

Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNIT 60
          FR +   FD +MNLVL+DAEE+   + TR+ LG +L++GDNI 
Sbjct: 36 FRGVLKSFDLHMNLVLNDAEELEDGEVTRR-LGTVLIRGDNIV 77


>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
 pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
          Sulfolobus Solfataricus
          Length = 81

 Score = 40.0 bits (92), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 30/45 (66%), Gaps = 1/45 (2%)

Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLM 62
           R +   +D++MNLVL D+EE+     + K LG I+++GDN+ L+
Sbjct: 32 VRGMLRSYDQHMNLVLSDSEEIQ-SDGSGKKLGTIVIRGDNVILI 75


>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
 pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
 pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
          Archaeoglobus Fulgidus At 2.5a Resolution
          Length = 77

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLM 62
          FR    G+D +MNLVL DAEE+   +  RK +G ++++GD +  +
Sbjct: 27 FRGTLDGYDIHMNLVLLDAEEIQNGEVVRK-VGSVVIRGDTVVFV 70


>pdb|2FWK|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
           Associated Sm-Like Protein Lsm5
 pdb|2FWK|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
           Associated Sm-Like Protein Lsm5
 pdb|3PGG|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6
           Snrna-Associated Sm- Like Protein Lsm5
 pdb|3PGG|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6
           Snrna-Associated Sm- Like Protein Lsm5
          Length = 121

 Score = 34.7 bits (78), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 14/63 (22%)

Query: 18  FRFLQSGFDEYMNLVLDDAEEVHIKKNTR------KPLGR--------ILLKGDNITLMM 63
           F  +  GFDEY+N+VLDD +E   K +        K L R        ILL G+N+ +++
Sbjct: 51  FSGVLRGFDEYVNMVLDDVQEYGFKADEEDISGGNKKLKRVMVNRLETILLSGNNVAMLV 110

Query: 64  NTG 66
             G
Sbjct: 111 PGG 113


>pdb|1LJO|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm2) From
          Archaeoglobus Fulgidus At 1.95a Resolution
          Length = 77

 Score = 34.7 bits (78), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 23 SGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLM 62
           G D+YMNL L +A E   ++  R  LG I+L+G+N+ L+
Sbjct: 34 EGVDDYMNLYLTNAMECKGEEKVRS-LGEIVLRGNNVVLI 72


>pdb|2Y9A|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
          Length = 95

 Score = 31.6 bits (70), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 9/52 (17%)

Query: 24 GFDEYMNLVLDDAEEV---------HIKKNTRKPLGRILLKGDNITLMMNTG 66
           FD++MNL+L D +E            ++  ++ LG +LL+G+N+  M   G
Sbjct: 33 AFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG 84


>pdb|1M8V|A Chain A, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|B Chain B, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|C Chain C, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|D Chain D, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|E Chain E, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|F Chain F, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|G Chain G, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|H Chain H, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|I Chain I, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|J Chain J, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|K Chain K, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|L Chain L, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|M Chain M, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
 pdb|1M8V|N Chain N, Structure Of Pyrococcus Abyssii Sm Protein In Complex
          With A Uridine Heptamer
          Length = 77

 Score = 31.2 bits (69), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNT 65
          FR    G+D ++N+VL DAE +       K  G+I+++GDN+  +  T
Sbjct: 29 FRGRLIGYDIHLNVVLADAEMIQ-DGEVVKRYGKIVIRGDNVLAISPT 75


>pdb|1D3B|B Chain B, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|D Chain D, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|F Chain F, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|H Chain H, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|J Chain J, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
 pdb|1D3B|L Chain L, Crystal Structure Of The D3b Subcomplex Of The Human
          Core Snrnp Domain At 2.0a Resolution
          Length = 91

 Score = 31.2 bits (69), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 9/52 (17%)

Query: 24 GFDEYMNLVLDDAEEV---------HIKKNTRKPLGRILLKGDNITLMMNTG 66
           FD++MNL+L D +E            ++  ++ LG +LL+G+N+  M   G
Sbjct: 33 AFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG 84


>pdb|1H64|1 Chain 1, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|2 Chain 2, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|A Chain A, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|B Chain B, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|C Chain C, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|D Chain D, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|E Chain E, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|F Chain F, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|G Chain G, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|H Chain H, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|I Chain I, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|J Chain J, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|K Chain K, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|L Chain L, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|M Chain M, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|N Chain N, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|O Chain O, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|P Chain P, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Q Chain Q, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|R Chain R, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|S Chain S, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|T Chain T, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|U Chain U, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|V Chain V, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|W Chain W, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|X Chain X, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Y Chain Y, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
 pdb|1H64|Z Chain Z, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
          The Biological Unit Is A Heptamer
          Length = 75

 Score = 31.2 bits (69), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 18 FRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNT 65
          FR    G+D ++N+VL DAE +       K  G+I+++GDN+  +  T
Sbjct: 27 FRGRLIGYDIHLNVVLADAEMIQ-DGEVVKRYGKIVIRGDNVLAISPT 73


>pdb|3PGW|B Chain B, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|Q Chain Q, Crystal Structure Of Human U1 Snrnp
          Length = 231

 Score = 31.2 bits (69), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 9/51 (17%)

Query: 25 FDEYMNLVLDDAEEV---------HIKKNTRKPLGRILLKGDNITLMMNTG 66
          FD++MNL+L D +E            ++  ++ LG +LL+G+N+  M   G
Sbjct: 34 FDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG 84


>pdb|3SWN|A Chain A, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|D Chain D, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|P Chain P, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|S Chain S, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 82

 Score = 31.2 bits (69), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 24/44 (54%)

Query: 24 GFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNTGK 67
          GFD+Y+N+VL D  E        +    +LL G+ + +++  GK
Sbjct: 37 GFDDYVNIVLKDVTEYDTVTGVTEKHSEMLLNGNGMCMLIPGGK 80


>pdb|3CW1|A Chain A, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|H Chain H, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|I Chain I, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|J Chain J, Crystal Structure Of Human Spliceosomal U1 Snrnp
          Length = 174

 Score = 30.8 bits (68), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 9/51 (17%)

Query: 25 FDEYMNLVLDDAEEV---------HIKKNTRKPLGRILLKGDNITLMMNTG 66
          FD++MNL+L D +E            ++  ++ LG +LL+G+N+  M   G
Sbjct: 34 FDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG 84


>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
          Protein: Implications For The Eukaryotic Snrnp Core
 pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
 pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
          A New Crystal Form (C2221)
          Length = 81

 Score = 30.8 bits (68), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 29/41 (70%), Gaps = 2/41 (4%)

Query: 19 RFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNI 59
          R +   FD+++NL+L+DAEE+ I  N  K  G ++++G+N+
Sbjct: 35 RGILRSFDQHVNLLLEDAEEI-IDGNVYKR-GTMVVRGENV 73


>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|F Chain F, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|O Chain O, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
 pdb|3SWN|R Chain R, Structure Of The Lsm657 Complex: An Assembly
          Intermediate Of The Lsm1 7 And Lsm2 8 Rings
          Length = 117

 Score = 30.0 bits (66), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 13/15 (86%)

Query: 24 GFDEYMNLVLDDAEE 38
          GFD+ MNLVLDD EE
Sbjct: 56 GFDQLMNLVLDDVEE 70


>pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|3 Chain 3, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|4 Chain 4, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3CW1|5 Chain 5, Crystal Structure Of Human Spliceosomal U1 Snrnp
 pdb|3PGW|G Chain G, Crystal Structure Of Human U1 Snrnp
 pdb|3PGW|J Chain J, Crystal Structure Of Human U1 Snrnp
 pdb|2Y9A|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9A|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9B|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9C|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|2Y9D|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
 pdb|3S6N|G Chain G, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
          Gemin2 In Complex With Smd1D2FEG FROM HUMAN
 pdb|4F7U|G Chain G, Macromolecular Machine 6
 pdb|4F7U|J Chain J, Macromolecular Machine 6
 pdb|1VU2|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|1VU2|4 Chain 4, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|1VU3|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|P Chain P, The 8s Snrnp Assembly Intermediate
 pdb|4F77|H Chain H, The 8s Snrnp Assembly Intermediate
 pdb|4F77|X Chain X, The 8s Snrnp Assembly Intermediate
 pdb|4F77|FF Chain f, The 8s Snrnp Assembly Intermediate
 pdb|4F77|NN Chain n, The 8s Snrnp Assembly Intermediate
 pdb|4F77|VV Chain v, The 8s Snrnp Assembly Intermediate
 pdb|4F77|4 Chain 4, The 8s Snrnp Assembly Intermediate
          Length = 76

 Score = 29.3 bits (64), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 24 GFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLM 62
          GFD +MNLV+D+  E+      +  +G ++++G++I ++
Sbjct: 33 GFDPFMNLVIDECVEM-ATSGQQNNIGMVVIRGNSIIML 70


>pdb|4EMK|A Chain A, Crystal Structure Of Splsm567
          Length = 94

 Score = 28.9 bits (63), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 21/44 (47%)

Query: 24 GFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNTGK 67
          GFD+Y+N+VL D  E        +     LL G+    ++  GK
Sbjct: 49 GFDDYVNIVLKDVTEYDTVTGVTEKHSEXLLNGNGXCXLIPGGK 92


>pdb|4EMK|C Chain C, Crystal Structure Of Splsm567
          Length = 113

 Score = 27.7 bits (60), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 12/15 (80%)

Query: 24 GFDEYMNLVLDDAEE 38
          GFD+  NLVLDD EE
Sbjct: 52 GFDQLXNLVLDDVEE 66


>pdb|4EMG|A Chain A, Crystal Structure Of Splsm3
 pdb|4EMG|B Chain B, Crystal Structure Of Splsm3
 pdb|4EMG|C Chain C, Crystal Structure Of Splsm3
 pdb|4EMG|D Chain D, Crystal Structure Of Splsm3
 pdb|4EMG|E Chain E, Crystal Structure Of Splsm3
 pdb|4EMG|F Chain F, Crystal Structure Of Splsm3
 pdb|4EMG|G Chain G, Crystal Structure Of Splsm3
 pdb|4EMG|H Chain H, Crystal Structure Of Splsm3
 pdb|4EMG|I Chain I, Crystal Structure Of Splsm3
 pdb|4EMG|J Chain J, Crystal Structure Of Splsm3
 pdb|4EMG|K Chain K, Crystal Structure Of Splsm3
 pdb|4EMG|L Chain L, Crystal Structure Of Splsm3
 pdb|4EMG|M Chain M, Crystal Structure Of Splsm3
 pdb|4EMG|N Chain N, Crystal Structure Of Splsm3
          Length = 93

 Score = 26.6 bits (57), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 12/51 (23%)

Query: 24 GFDEYMNLVLDDAEEV------------HIKKNTRKPLGRILLKGDNITLM 62
           +DE++N VL DAEE+               K  RK    + ++GD++ L+
Sbjct: 38 AYDEHLNXVLGDAEEIVTIFDDEETDKDKALKTIRKHYEXLFVRGDSVILI 88


>pdb|3BW1|A Chain A, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
          Novel Octameric Ring Organisation
 pdb|3BW1|B Chain B, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
          Novel Octameric Ring Organisation
          Length = 96

 Score = 25.4 bits (54), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query: 24 GFDEYMNLVLDDAEEVHIKKN------TRKPLGRILLKGDNITLM 62
           FD + N+VL DA E   + N      + +    + ++GD +TL+
Sbjct: 39 AFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLI 83


>pdb|1PLS|A Chain A, Solution Structure Of A Pleckstrin Homology Domain
          Length = 113

 Score = 25.4 bits (54), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 31 LVLDDAEEVHIKKNTRKPLGRILLKGDNIT 60
          ++L+D  E + KK+   P G I LKG  +T
Sbjct: 27 VLLEDGIEFYKKKSDNSPKGMIPLKGSTLT 56


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.138    0.383 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,739,333
Number of Sequences: 62578
Number of extensions: 55027
Number of successful extensions: 156
Number of sequences better than 100.0: 29
Number of HSP's better than 100.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 10
Number of HSP's that attempted gapping in prelim test: 130
Number of HSP's gapped (non-prelim): 29
length of query: 67
length of database: 14,973,337
effective HSP length: 38
effective length of query: 29
effective length of database: 12,595,373
effective search space: 365265817
effective search space used: 365265817
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)