Citrus Sinensis ID: 035338


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-------
MASTKVQRIMTQPINLIFRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNTGK
cccccEEEEEEccHHHHHHHHHHHHHHHcEEEEEcEEEEECccccccccCEEEECccCEEEEEEccc
******QRIMTQPINLIFRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNT**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTKVQRIMTQPINLIFRFLQSGFDEYMNLVLDDAEEVHIKKNTRKPLGRILLKGDNITLMMNTGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Small nuclear ribonucleoprotein E Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5.probableP62305
Small nuclear ribonucleoprotein E Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5.probableP62304
Probable small nuclear ribonucleoprotein E Associated with snRNP U1, U2, U4/U6 and U5.probableQ9VLV5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1TH7, chain A
Confidence level:very confident
Coverage over the Query: 5-65
View the alignment between query and template
View the model in PyMOL