Query         035343
Match_columns 67
No_of_seqs    27 out of 29
Neff          2.3 
Searched_HMMs 46136
Date          Fri Mar 29 11:06:22 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035343.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035343hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd04895 ACT_ACR_1 ACT domain-c  96.9 0.00071 1.5E-08   41.7   2.1   26    1-27     45-70  (72)
  2 cd04897 ACT_ACR_3 ACT domain-c  94.9   0.036 7.8E-07   34.4   3.2   26    1-27     45-70  (75)
  3 cd04925 ACT_ACR_2 ACT domain-c  94.6   0.053 1.2E-06   31.8   3.3   29    1-29     44-72  (74)
  4 cd04896 ACT_ACR-like_3 ACT dom  93.7   0.083 1.8E-06   32.8   2.9   28    1-30     46-73  (75)
  5 PF11523 DUF3223:  Protein of u  93.4   0.067 1.5E-06   33.0   2.1   33    7-44      9-41  (76)
  6 PF11333 DUF3135:  Protein of u  90.0    0.34 7.3E-06   30.9   2.6   26   13-38     15-40  (83)
  7 cd04900 ACT_UUR-like_1 ACT dom  84.0     1.4 3.1E-05   25.3   2.7   26    1-27     46-71  (73)
  8 PRK05007 PII uridylyl-transfer  80.3     1.8 3.9E-05   36.3   3.0   27    1-29    852-878 (884)
  9 cd04927 ACT_ACR-like_2 Second   80.1     2.8 6.1E-05   24.8   3.1   27    1-29     45-71  (76)
 10 PRK05092 PII uridylyl-transfer  79.7     1.9 4.1E-05   36.1   3.0   35    1-36    887-921 (931)
 11 PRK01759 glnD PII uridylyl-tra  77.0     2.3   5E-05   35.6   2.7   27    1-29    827-853 (854)
 12 PRK14004 hisH imidazole glycer  74.7    0.84 1.8E-05   32.0  -0.3    9   30-38    188-196 (210)
 13 PF14483 Cut8_M:  Cut8 dimerisa  74.2     3.2   7E-05   23.1   2.0   21   24-44     17-37  (38)
 14 cd04926 ACT_ACR_4 C-terminal    73.6       4 8.6E-05   23.6   2.4   23    1-25     45-67  (72)
 15 PRK13146 hisH imidazole glycer  73.0    0.99 2.1E-05   31.1  -0.3    9   30-38    186-194 (209)
 16 COG0512 PabA Anthranilate/para  70.5     1.3 2.8E-05   32.3  -0.2    7   30-36    168-174 (191)
 17 CHL00188 hisH imidazole glycer  70.1     1.3 2.8E-05   31.1  -0.3    9   30-38    188-196 (210)
 18 cd01748 GATase1_IGP_Synthase T  69.4     1.3 2.9E-05   29.5  -0.3    9   30-38    179-187 (198)
 19 cd07858 STKc_TEY_MAPK_plant Ca  68.6     4.4 9.5E-05   27.9   2.1   17   18-34    321-337 (337)
 20 PRK08857 para-aminobenzoate sy  67.8     1.5 3.3E-05   29.5  -0.3    8   30-37    170-177 (193)
 21 CHL00101 trpG anthranilate syn  67.8     1.4 3.1E-05   29.6  -0.4    8   30-37    166-173 (190)
 22 PF00117 GATase:  Glutamine ami  67.5     1.6 3.4E-05   28.4  -0.2   11   30-40    169-179 (192)
 23 cd04899 ACT_ACR-UUR-like_2 C-t  67.2     8.8 0.00019   20.9   2.8   25    1-27     44-68  (70)
 24 PRK07649 para-aminobenzoate/an  67.1     1.5 3.3E-05   30.1  -0.4    8   30-37    165-172 (195)
 25 PRK13170 hisH imidazole glycer  66.9     1.6 3.5E-05   29.7  -0.2    9   30-38    175-183 (196)
 26 PRK13152 hisH imidazole glycer  65.0     1.8 3.9E-05   29.3  -0.3    9   30-38    180-188 (201)
 27 PRK00275 glnD PII uridylyl-tra  64.2       8 0.00017   32.7   3.2   29    1-30    858-886 (895)
 28 PRK05637 anthranilate synthase  64.0       2 4.3E-05   30.0  -0.3    8   30-37    182-189 (208)
 29 PF09330 Lact-deh-memb:  D-lact  64.0       4 8.7E-05   31.8   1.4   28   13-41      7-34  (291)
 30 TIGR00566 trpG_papA glutamine   63.9       2 4.2E-05   29.0  -0.3    8   30-37    166-173 (188)
 31 TIGR01855 IMP_synth_hisH imida  63.3     2.1 4.5E-05   29.0  -0.3    9   30-38    175-183 (196)
 32 PRK13141 hisH imidazole glycer  63.3     2.1 4.6E-05   28.8  -0.2    9   30-38    180-188 (205)
 33 PRK08007 para-aminobenzoate sy  62.6     2.2 4.7E-05   28.9  -0.3    8   30-37    165-172 (187)
 34 TIGR01693 UTase_glnD [Protein-  61.8     9.4  0.0002   31.6   3.2   30    1-31    713-742 (850)
 35 cd01742 GATase1_GMP_Synthase T  60.4     2.5 5.5E-05   27.3  -0.2    9   30-38    161-169 (181)
 36 PF00380 Ribosomal_S9:  Ribosom  60.4      12 0.00025   25.1   2.9   29   15-43     64-92  (121)
 37 PRK13181 hisH imidazole glycer  59.9     2.6 5.6E-05   28.3  -0.3    8   30-37    178-185 (199)
 38 PRK05670 anthranilate synthase  58.8     2.7 5.9E-05   28.0  -0.3    8   30-37    165-172 (189)
 39 PRK06774 para-aminobenzoate sy  58.3     2.8 6.1E-05   28.0  -0.3    8   30-37    169-176 (191)
 40 CHL00079 rps9 ribosomal protei  57.7      12 0.00025   25.6   2.6   29   14-42     72-100 (130)
 41 PRK00758 GMP synthase subunit   56.9     3.1 6.8E-05   27.4  -0.3    8   30-37    158-165 (184)
 42 cd01744 GATase1_CPSase Small c  56.6     3.3 7.1E-05   27.4  -0.2   10   29-38    156-165 (178)
 43 PF13174 TPR_6:  Tetratricopept  56.4      11 0.00024   17.4   1.8   13   24-36     21-33  (33)
 44 PRK07569 bidirectional hydroge  56.4      11 0.00025   26.4   2.5   23   13-35     76-98  (234)
 45 PF02518 HATPase_c:  Histidine   56.2     8.9 0.00019   22.3   1.6   23   14-36      2-24  (111)
 46 TIGR00888 guaA_Nterm GMP synth  55.6     3.3 7.2E-05   27.4  -0.3    9   30-38    161-169 (188)
 47 cd01743 GATase1_Anthranilate_S  55.5     3.2   7E-05   27.3  -0.4   10   29-38    163-172 (184)
 48 PRK00132 rpsI 30S ribosomal pr  55.3      15 0.00032   25.0   2.8   30   14-43     72-101 (130)
 49 cd06930 NR_LBD_F2 Ligand-bindi  54.7      28 0.00061   21.7   3.8   30   11-40    119-152 (165)
 50 PRK07765 para-aminobenzoate sy  54.6     3.6 7.9E-05   28.6  -0.3    8   30-37    169-176 (214)
 51 PRK06895 putative anthranilate  54.3     3.7   8E-05   27.5  -0.3    7   30-36    166-172 (190)
 52 PLN02335 anthranilate synthase  52.5       4 8.7E-05   28.6  -0.3    8   30-37    190-197 (222)
 53 PRK13143 hisH imidazole glycer  51.5     4.4 9.6E-05   27.5  -0.2    9   30-38    176-184 (200)
 54 COG0103 RpsI Ribosomal protein  51.0      18 0.00039   25.3   2.7   30   15-44     73-102 (130)
 55 cd01747 GATase1_Glutamyl_Hydro  50.9       5 0.00011   29.2  -0.1   15   30-45    208-222 (273)
 56 COG0505 CarA Carbamoylphosphat  50.7       5 0.00011   32.1  -0.1    8   30-37    338-345 (368)
 57 PRK04374 PII uridylyl-transfer  50.0      16 0.00035   31.0   2.8   27    1-29    840-866 (869)
 58 PTZ00305 NADH:ubiquinone oxido  49.9      16 0.00035   28.3   2.6   23   13-35    142-164 (297)
 59 cd06950 NR_LBD_Tlx_PNR_like Th  49.4      29 0.00062   23.8   3.5   30   11-40    144-177 (206)
 60 cd06943 NR_LBD_RXR_like The li  49.2      33 0.00071   22.9   3.7   31   10-40    148-182 (207)
 61 PRK06490 glutamine amidotransf  49.0     5.6 0.00012   28.3  -0.0   10   30-39    175-184 (239)
 62 cd01433 Ribosomal_L16_L10e Rib  49.0      19 0.00041   22.9   2.4   37   12-48     19-68  (112)
 63 PF08818 DUF1801:  Domain of un  46.5      12 0.00025   22.2   1.1   28   15-46      3-30  (103)
 64 PLN02771 carbamoyl-phosphate s  46.1       6 0.00013   31.5  -0.3    8   30-37    398-405 (415)
 65 cd06952 NR_LBD_TR2_like The li  45.8      35 0.00075   23.3   3.4   31   10-40    146-180 (222)
 66 PF00226 DnaJ:  DnaJ domain;  I  45.8      21 0.00046   19.6   2.0   24   15-38     11-34  (64)
 67 smart00430 HOLI Ligand binding  45.4      26 0.00057   20.9   2.5   25    9-33    112-138 (163)
 68 cd06940 NR_LBD_REV_ERB The lig  45.3      39 0.00085   22.9   3.6   31   10-40    129-163 (189)
 69 cd01745 GATase1_2 Subgroup of   44.3     6.7 0.00014   26.4  -0.2    9   30-38    167-175 (189)
 70 TIGR01368 CPSaseIIsmall carbam  43.9     6.5 0.00014   30.2  -0.4    9   29-37    331-339 (358)
 71 cd04369 Bromodomain Bromodomai  43.5      34 0.00073   19.0   2.7   29   15-44     61-89  (99)
 72 PRK13142 hisH imidazole glycer  43.1     6.9 0.00015   27.6  -0.3    9   30-38    166-174 (192)
 73 CHL00197 carA carbamoyl-phosph  42.0     7.5 0.00016   30.3  -0.3    8   30-37    350-357 (382)
 74 smart00271 DnaJ DnaJ molecular  41.8      27 0.00058   18.7   2.0   23   16-38     13-35  (60)
 75 TIGR01693 UTase_glnD [Protein-  41.8      23  0.0005   29.3   2.5   27    1-29    823-849 (850)
 76 PRK12564 carbamoyl phosphate s  41.2     7.7 0.00017   29.8  -0.3    9   29-37    335-343 (360)
 77 TIGR03582 EF_0829 PRD domain p  41.1      16 0.00035   24.3   1.2   32    2-33     50-86  (107)
 78 PRK12838 carbamoyl phosphate s  40.7     7.8 0.00017   29.7  -0.4    8   30-37    326-333 (354)
 79 PF06226 DUF1007:  Protein of u  40.7      35 0.00077   23.8   2.9   27    8-34     62-88  (212)
 80 TIGR01973 NuoG NADH-quinone ox  40.6      26 0.00057   27.6   2.5   23   13-35     72-94  (603)
 81 cd06257 DnaJ DnaJ domain or J-  40.4      29 0.00063   18.1   2.0   24   15-38     11-34  (55)
 82 PRK09065 glutamine amidotransf  39.5     9.7 0.00021   26.8  -0.0   11   30-40    182-192 (237)
 83 PTZ00173 60S ribosomal protein  38.5      48   0.001   24.8   3.4   19   13-31     60-78  (213)
 84 PRK09522 bifunctional glutamin  37.8     9.4  0.0002   30.6  -0.3    8   30-37    167-174 (531)
 85 cd07070 NR_LBD_SF-1 The ligand  37.8      55  0.0012   23.1   3.6   31   10-40    160-194 (237)
 86 PF05763 DUF835:  Protein of un  37.6      39 0.00085   22.6   2.7   30    1-31     44-73  (136)
 87 cd07859 STKc_TDY_MAPK_plant Ca  36.8      32  0.0007   23.1   2.2   16   19-34    323-338 (338)
 88 PF12229 PG_binding_4:  Putativ  36.8      19 0.00041   20.9   0.9   27    2-28     83-109 (114)
 89 cd07068 NR_LBD_ER_like The lig  34.8      65  0.0014   22.1   3.4   27   12-38    146-177 (221)
 90 PF00252 Ribosomal_L16:  Riboso  34.7      42 0.00092   22.2   2.5   19   13-31     41-59  (133)
 91 cd01741 GATase1_1 Subgroup of   34.1      12 0.00026   24.4  -0.2    6   30-35    175-180 (188)
 92 COG5002 VicK Signal transducti  33.9      40 0.00087   28.0   2.6   24   14-37    339-362 (459)
 93 KOG0026 Anthranilate synthase,  33.1      12 0.00026   28.3  -0.4    8   30-37    191-198 (223)
 94 PF08469 NPHI_C:  Nucleoside tr  33.0      32  0.0007   24.7   1.8   32    1-32     15-51  (148)
 95 cd06929 NR_LBD_F1 Ligand-bindi  32.8      93   0.002   19.7   3.7   30   11-40    120-153 (174)
 96 PRK13525 glutamine amidotransf  32.6      12 0.00027   25.3  -0.4    9   30-38    167-175 (189)
 97 PLN00210 40S ribosomal protein  32.6      59  0.0013   22.4   2.9   21   14-34     72-92  (141)
 98 COG1701 Uncharacterized protei  32.5      47   0.001   25.7   2.7   29    8-37     47-75  (256)
 99 PRK07053 glutamine amidotransf  32.5      15 0.00032   26.1  -0.0   11   30-40    174-184 (234)
100 cd06932 NR_LBD_PPAR The ligand  32.4      71  0.0015   23.0   3.5   30   10-39    181-214 (259)
101 cd07069 NR_LBD_Lrh-1 The ligan  32.3      80  0.0017   22.5   3.7   30   11-40    163-196 (241)
102 PF03914 CBF:  CBF/Mak21 family  32.2      37 0.00079   22.3   1.8   24   23-46     87-110 (164)
103 PRK08250 glutamine amidotransf  32.2      15 0.00033   25.9  -0.0   11   30-40    176-186 (235)
104 cd01749 GATase1_PB Glutamine A  32.0      13 0.00029   24.8  -0.3   10   30-39    166-175 (183)
105 cd06951 NR_LBD_Dax1_like The l  32.0      72  0.0016   22.3   3.4   29   11-40    152-184 (222)
106 PRK01759 glnD PII uridylyl-tra  31.6      53  0.0012   27.7   3.1   28    1-30    722-749 (854)
107 cd06934 NR_LBD_PXR_like The li  31.4      69  0.0015   22.4   3.2   27   10-36    152-182 (226)
108 cd06944 NR_LBD_Ftz-F1_like The  31.3      79  0.0017   22.1   3.5   28   12-39    162-193 (237)
109 cd06953 NR_LBD_DHR4_like The l  31.1      88  0.0019   21.6   3.6   29   11-39    149-181 (213)
110 cd06937 NR_LBD_RAR The ligand   30.7      83  0.0018   22.1   3.5   30   10-39    155-188 (231)
111 cd06941 NR_LBD_DmE78_like The   30.7      88  0.0019   20.9   3.5   28   11-38    120-151 (195)
112 PRK09203 rplP 50S ribosomal pr  30.6      51  0.0011   22.3   2.4   18   12-29     41-58  (138)
113 PF06628 Catalase-rel:  Catalas  30.5      39 0.00085   19.9   1.6   24   20-43     43-66  (68)
114 PF10523 BEN:  BEN domain;  Int  29.4      98  0.0021   17.4   3.1   22    7-28     32-53  (79)
115 PF06743 FAST_1:  FAST kinase-l  29.4     8.2 0.00018   22.9  -1.5   32   30-61     11-48  (71)
116 cd06948 NR_LBD_COUP-TF Ligand   29.2      91   0.002   21.8   3.5   29   11-39    150-182 (236)
117 KOG1224 Para-aminobenzoate (PA  29.2      15 0.00033   31.9  -0.4    8   30-37    194-201 (767)
118 PRK09129 NADH dehydrogenase su  29.2      53  0.0011   26.7   2.6   23   13-35     74-96  (776)
119 cd06931 NR_LBD_HNF4_like The l  29.2 1.2E+02  0.0026   20.5   4.0   31    9-39    148-182 (222)
120 PLN02889 oxo-acid-lyase/anthra  29.2      16 0.00035   31.9  -0.3    7   30-36    312-318 (918)
121 KOG1474 Transcription initiati  28.8      46   0.001   27.4   2.2   37    9-46    277-313 (640)
122 PF02852 Pyr_redox_dim:  Pyridi  28.6      24 0.00051   21.4   0.4   16   26-41     92-107 (110)
123 PLN02347 GMP synthetase         28.5      17 0.00037   29.4  -0.3    9   30-38    179-187 (536)
124 TIGR01164 rplP_bact ribosomal   28.3      62  0.0014   21.6   2.4   19   12-30     40-58  (126)
125 TIGR03800 PLP_synth_Pdx2 pyrid  27.4      17 0.00038   24.7  -0.3    9   30-38    166-174 (184)
126 PF06348 DUF1059:  Protein of u  27.3      70  0.0015   18.6   2.3   17    9-25     38-54  (57)
127 PRK13527 glutamine amidotransf  27.0      18  0.0004   24.3  -0.3    9   30-38    177-185 (200)
128 PRK05007 PII uridylyl-transfer  26.9      73  0.0016   27.1   3.1   31    1-33    746-776 (884)
129 PRK00275 glnD PII uridylyl-tra  26.8      73  0.0016   27.2   3.1   41    1-43    749-790 (895)
130 COG1222 RPT1 ATP-dependent 26S  26.5      46   0.001   27.2   1.8   32   16-55    158-189 (406)
131 cd05495 Bromo_cbp_like Bromodo  26.4      77  0.0017   20.1   2.5   26   15-40      1-26  (108)
132 PRK05665 amidotransferase; Pro  26.2      23  0.0005   25.3   0.1   11   30-40    182-192 (240)
133 PF02075 RuvC:  Crossover junct  26.0      64  0.0014   21.4   2.2   29    8-36     33-61  (149)
134 PF11842 DUF3362:  Domain of un  26.0      40 0.00088   23.9   1.3   28    8-37     31-59  (150)
135 PRK11366 puuD gamma-glutamyl-g  25.9      20 0.00043   25.6  -0.3    8   30-37    219-226 (254)
136 COG0118 HisH Glutamine amidotr  25.6      26 0.00056   25.9   0.3   11   30-40    181-191 (204)
137 PF10588 NADH-G_4Fe-4S_3:  NADH  25.5      49  0.0011   18.1   1.3   14   22-35      1-14  (41)
138 cd06949 NR_LBD_ER Ligand bindi  25.3 1.1E+02  0.0025   21.5   3.4   21   12-32    157-177 (235)
139 PRK14607 bifunctional glutamin  25.2      21 0.00046   28.3  -0.3    8   30-37    166-173 (534)
140 PRK00474 rps9p 30S ribosomal p  24.7      87  0.0019   21.4   2.7   29   14-42     72-102 (134)
141 TIGR03627 arch_S9P archaeal ri  24.7      88  0.0019   21.3   2.7   29   14-42     68-98  (130)
142 PF08557 Lipid_DES:  Sphingolip  24.6      31 0.00067   19.7   0.4   12   28-39     21-32  (39)
143 PRK00074 guaA GMP synthase; Re  24.6      22 0.00048   28.1  -0.3    9   30-38    166-174 (511)
144 PRK07860 NADH dehydrogenase su  24.4      72  0.0016   26.5   2.6   32    5-36     68-102 (797)
145 PF15237 PTRF_SDPR:  PTRF/SDPR   24.1      50  0.0011   25.3   1.6   16    8-23    206-221 (246)
146 cd06942 NR_LBD_Sex_1_like The   24.0 1.4E+02  0.0031   20.0   3.6   31   10-40    120-154 (191)
147 COG0518 GuaA GMP synthase - Gl  24.0      19 0.00041   25.3  -0.7    9   30-38    171-179 (198)
148 PLN02617 imidazole glycerol ph  23.8      23  0.0005   28.7  -0.3    8   30-37    188-195 (538)
149 PF09409 PUB:  PUB domain;  Int  23.8 1.1E+02  0.0023   18.3   2.7   19   18-38     10-28  (87)
150 TIGR01737 FGAM_synth_I phospho  23.6      23  0.0005   24.7  -0.3    9   30-38    199-207 (227)
151 PTZ00100 DnaJ chaperone protei  23.4      70  0.0015   21.5   2.0   22   15-36     76-97  (116)
152 cd06946 NR_LBD_ERR The ligand   23.3 1.5E+02  0.0032   20.2   3.6   22   11-32    145-166 (221)
153 PF01011 PQQ:  PQQ enzyme repea  23.1      36 0.00079   17.5   0.5   11    2-12     13-23  (38)
154 PRK03381 PII uridylyl-transfer  23.1      61  0.0013   27.1   2.0   23    1-26    751-773 (774)
155 PF09365 DUF2461:  Conserved hy  22.8      70  0.0015   22.7   2.0   17   13-29    116-132 (212)
156 cd01917 ACS_2 Acetyl-CoA synth  22.6      77  0.0017   24.7   2.3   42    3-45     41-82  (287)
157 COG0642 BaeS Signal transducti  22.5 1.1E+02  0.0024   19.2   2.7   21   14-34    225-245 (336)
158 cd07348 NR_LBD_NGFI-B The liga  22.3 1.4E+02   0.003   21.4   3.5   23   10-32    156-178 (238)
159 PF01415 IL7:  Interleukin 7/9   22.1      74  0.0016   22.4   2.0   23   16-39      8-30  (129)
160 PF14098 SSPI:  Small, acid-sol  21.8      48   0.001   20.8   0.9   16   20-35      2-17  (65)
161 cd07349 NR_LBD_SHP The ligand   21.7 1.5E+02  0.0033   20.9   3.5   31   10-40    148-182 (222)
162 KOG3009 Predicted carbohydrate  21.6      28  0.0006   29.8  -0.3   20   27-46     23-42  (614)
163 PF11943 DUF3460:  Protein of u  21.6      56  0.0012   20.2   1.2   21   25-45     10-30  (60)
164 PF07879 PHB_acc_N:  PHB/PHA ac  21.5      58  0.0013   20.4   1.2   19    1-19     35-53  (64)
165 PRK13566 anthranilate synthase  21.1      28 0.00061   29.2  -0.3    8   30-37    692-699 (720)
166 PRK12814 putative NADPH-depend  21.0      96  0.0021   25.0   2.6   24   13-36     76-99  (652)
167 TIGR01815 TrpE-clade3 anthrani  21.0      28  0.0006   29.3  -0.4    8   29-36    681-688 (717)
168 PRK07567 glutamine amidotransf  20.9      31 0.00068   24.4  -0.1   11   30-40    186-196 (242)
169 cd04873 ACT_UUR-ACR-like ACT d  20.8 1.5E+02  0.0032   15.5   2.8   19    7-26     49-67  (70)
170 PRK09130 NADH dehydrogenase su  20.7      94   0.002   25.6   2.6   23   13-35     75-97  (687)
171 smart00830 CM_2 Chorismate mut  20.7   1E+02  0.0023   17.5   2.1   28    6-33     30-57  (79)
172 PHA02749 hypothetical protein;  20.1      43 0.00093   26.5   0.5   15   25-39    132-146 (322)
173 cd07071 NR_LBD_Nurr1 The ligan  20.1 1.7E+02  0.0037   20.9   3.5   24    9-32    155-178 (238)
174 CHL00044 rpl16 ribosomal prote  20.1 1.1E+02  0.0023   20.8   2.3   20   12-31     41-60  (135)

No 1  
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the N-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=96.88  E-value=0.00071  Score=41.70  Aligned_cols=26  Identities=15%  Similarity=0.189  Sum_probs=23.4

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVIN   27 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiN   27 (67)
                      |||+|. .|+||.||+++++||.++..
T Consensus        45 FyV~d~-~g~kl~d~~~~~~l~~~L~~   70 (72)
T cd04895          45 FHVTDQ-LGNKLTDDSLIAYIEKSLGT   70 (72)
T ss_pred             EEEECC-CCCCCCCHHHHHHHHHHhcc
Confidence            799988 89999999999999998753


No 2  
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the third ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=94.91  E-value=0.036  Score=34.43  Aligned_cols=26  Identities=8%  Similarity=0.065  Sum_probs=22.3

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVIN   27 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiN   27 (67)
                      |||++. .|+|+.+++++|+||..+..
T Consensus        45 FyV~d~-~g~kl~~~~~~~~l~~~L~~   70 (75)
T cd04897          45 YYIRHK-DGRTLSTEGERQRVIKCLEA   70 (75)
T ss_pred             EEEEcC-CCCccCCHHHHHHHHHHHHH
Confidence            788776 59999999999999988764


No 3  
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=94.64  E-value=0.053  Score=31.84  Aligned_cols=29  Identities=31%  Similarity=0.367  Sum_probs=25.0

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVINNL   29 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiNNl   29 (67)
                      |+|++.++|.++.++++++.||.+|.+-|
T Consensus        44 f~V~d~~~~~~~~~~~~~~~i~~~L~~~l   72 (74)
T cd04925          44 IYVRDEETGAPIDDPIRLASIEDRLDNVL   72 (74)
T ss_pred             EEEEcCcCCCCCCCHHHHHHHHHHHHHHh
Confidence            68888887888999999999999987654


No 4  
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the third ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=93.71  E-value=0.083  Score=32.81  Aligned_cols=28  Identities=18%  Similarity=0.413  Sum_probs=24.1

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVINNLL   30 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiNNll   30 (67)
                      |||  ...|+|+.+++++++||..+...|.
T Consensus        46 Fyv--~~~g~kl~d~~~~~~L~~~L~~~l~   73 (75)
T cd04896          46 FIV--QSDGKKIMDPKKQAALCARLREEMV   73 (75)
T ss_pred             EEE--eCCCCccCCHHHHHHHHHHHHHHhc
Confidence            678  3668999999999999999988774


No 5  
>PF11523 DUF3223:  Protein of unknown function (DUF3223);  InterPro: IPR021602  This family of proteins has no known function. ; PDB: 2K0M_A.
Probab=93.36  E-value=0.067  Score=33.05  Aligned_cols=33  Identities=27%  Similarity=0.698  Sum_probs=22.2

Q ss_pred             CCCCccCCHHHHHHHHHHHHHHHHhhCccchhhhhccc
Q 035343            7 DTGRKVDDPEVLEAIRLIVINNLLQYHPESSSQLAMGV   44 (67)
Q Consensus         7 ~Tg~KV~~~e~LE~IRlTIiNNll~yHPEsse~la~G~   44 (67)
                      ..|+++.+++     -..++..||+|||+..+.+..|.
T Consensus         9 ~~g~~l~~~d-----~~~~l~~ll~~HP~~~~KiG~Gi   41 (76)
T PF11523_consen    9 PDGERLSEED-----EKSVLEALLKYHPEAEEKIGCGI   41 (76)
T ss_dssp             -TTEE--HHH------HHHHHHHHHTSTTHHHHHTT-E
T ss_pred             CCcCCcCHHH-----HHHHHHHHHHhCCcHHHhhcCCe
Confidence            3455555333     35788999999999999998875


No 6  
>PF11333 DUF3135:  Protein of unknown function (DUF3135);  InterPro: IPR021482  This family of proteins with unkown function appears to be restricted to Proteobacteria. 
Probab=90.01  E-value=0.34  Score=30.85  Aligned_cols=26  Identities=31%  Similarity=0.631  Sum_probs=23.5

Q ss_pred             CCHHHHHHHHHHHHHHHHhhCccchh
Q 035343           13 DDPEVLEAIRLIVINNLLQYHPESSS   38 (67)
Q Consensus        13 ~~~e~LE~IRlTIiNNll~yHPEsse   38 (67)
                      .|||.||++|...|.+++.-.||.-.
T Consensus        15 ~dPe~fe~lr~~~~ee~I~~a~~~~q   40 (83)
T PF11333_consen   15 NDPEAFEQLRQELIEEMIESAPEEMQ   40 (83)
T ss_pred             hCHHHHHHHHHHHHHHHHHhCCHHHH
Confidence            58999999999999999999988653


No 7  
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains. This ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; including those enzymes similar to the GlnD found in enteric Escherichia coli and those found in photosynthetic, nitrogen-fixing bacterium Rhodospirillum rubrum. Also included in this CD is the N-terminal ACT domain of a yet characterized Arabidopsis/Oryza predicted tyrosine kinase. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=83.95  E-value=1.4  Score=25.29  Aligned_cols=26  Identities=19%  Similarity=0.345  Sum_probs=20.5

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVIN   27 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiN   27 (67)
                      |+|++. .|.++.+++++++||..|.+
T Consensus        46 F~v~~~-~~~~~~~~~~~~~l~~~L~~   71 (73)
T cd04900          46 FVVLDP-DGEPIGERERLARIREALED   71 (73)
T ss_pred             EEEECC-CCCCCChHHHHHHHHHHHHh
Confidence            677764 56678899999999988865


No 8  
>PRK05007 PII uridylyl-transferase; Provisional
Probab=80.30  E-value=1.8  Score=36.32  Aligned_cols=27  Identities=19%  Similarity=0.377  Sum_probs=24.4

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVINNL   29 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiNNl   29 (67)
                      |||++. +|+|++ ++++++||..+++-|
T Consensus       852 FyV~~~-~g~~l~-~~~~~~l~~~L~~~l  878 (884)
T PRK05007        852 FILATA-DRRALN-EELQQELRQRLTEAL  878 (884)
T ss_pred             EEEEcC-CCCcCC-HHHHHHHHHHHHHHH
Confidence            799877 889999 899999999999887


No 9  
>cd04927 ACT_ACR-like_2 Second  ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the second  ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana  predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=80.06  E-value=2.8  Score=24.78  Aligned_cols=27  Identities=7%  Similarity=-0.038  Sum_probs=20.3

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVINNL   29 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiNNl   29 (67)
                      |||+|. .|. +.+++++++||..+.+-|
T Consensus        45 F~V~d~-~~~-~~~~~~~~~l~~~L~~~L   71 (76)
T cd04927          45 FFITDA-REL-LHTKKRREETYDYLRAVL   71 (76)
T ss_pred             EEEeCC-CCC-CCCHHHHHHHHHHHHHHH
Confidence            678877 333 678899999999887644


No 10 
>PRK05092 PII uridylyl-transferase; Provisional
Probab=79.72  E-value=1.9  Score=36.10  Aligned_cols=35  Identities=20%  Similarity=0.216  Sum_probs=28.7

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHHHHHhhCccc
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVINNLLQYHPES   36 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiNNll~yHPEs   36 (67)
                      |||++. .|+|+.+|+++++||.++...|..-.+|.
T Consensus       887 F~v~d~-~g~~i~~~~~~~~l~~~L~~~L~~~~~~~  921 (931)
T PRK05092        887 FYVTDL-FGLKITNEARQAAIRRALLAALAEGEAEA  921 (931)
T ss_pred             EEEeCC-CCCcCCCHHHHHHHHHHHHHHhcCccccc
Confidence            688877 58899999999999999999886644443


No 11 
>PRK01759 glnD PII uridylyl-transferase; Provisional
Probab=76.99  E-value=2.3  Score=35.56  Aligned_cols=27  Identities=26%  Similarity=0.524  Sum_probs=23.2

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVINNL   29 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiNNl   29 (67)
                      |||++. +|+|++++++ ++|+..++..|
T Consensus       827 Fyv~~~-~g~~l~~~~~-~~l~~~L~~~l  853 (854)
T PRK01759        827 FILTNQ-QGQALDEEER-KALKSRLLSNL  853 (854)
T ss_pred             EEEECC-CCCcCChHHH-HHHHHHHHHHh
Confidence            799985 6999999988 99999988764


No 12 
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=74.72  E-value=0.84  Score=31.99  Aligned_cols=9  Identities=56%  Similarity=0.955  Sum_probs=8.0

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|||||++.
T Consensus       188 vQFHPE~s~  196 (210)
T PRK14004        188 TQFHPEKSH  196 (210)
T ss_pred             EeCCcccCc
Confidence            699999886


No 13 
>PF14483 Cut8_M:  Cut8 dimerisation domain; PDB: 3Q5W_A 3Q5X_A.
Probab=74.16  E-value=3.2  Score=23.09  Aligned_cols=21  Identities=19%  Similarity=0.330  Sum_probs=16.9

Q ss_pred             HHHHHHHhhCccchhhhhccc
Q 035343           24 IVINNLLQYHPESSSQLAMGV   44 (67)
Q Consensus        24 TIiNNll~yHPEsse~la~G~   44 (67)
                      .+|.+|.+.|||.++.+...+
T Consensus        17 ~lL~~l~~~HPei~~~i~~~~   37 (38)
T PF14483_consen   17 SLLQSLCERHPEIQQEIRSIA   37 (38)
T ss_dssp             HHHHHHHHHSTHHHHHHHTTS
T ss_pred             HHHHHHHHhChhHHHHHHhhC
Confidence            578899999999998876543


No 14 
>cd04926 ACT_ACR_4 C-terminal  ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the C-terminal  ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=73.62  E-value=4  Score=23.59  Aligned_cols=23  Identities=30%  Similarity=0.608  Sum_probs=17.5

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIV   25 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTI   25 (67)
                      |+|++.+ |.++ +++++++||.+|
T Consensus        45 f~v~~~~-~~~~-~~~~~~~l~~~l   67 (72)
T cd04926          45 FYVTDAN-GNPV-DPKTIEAVRQEI   67 (72)
T ss_pred             EEEECCC-CCcC-CHHHHHHHHHHh
Confidence            5677765 5566 789999999876


No 15 
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=73.04  E-value=0.99  Score=31.12  Aligned_cols=9  Identities=56%  Similarity=0.970  Sum_probs=7.7

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|||||++.
T Consensus       186 vQFHPE~s~  194 (209)
T PRK13146        186 TQFHPEKSQ  194 (209)
T ss_pred             EEcCCcccH
Confidence            699999974


No 16 
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism]
Probab=70.53  E-value=1.3  Score=32.26  Aligned_cols=7  Identities=71%  Similarity=1.379  Sum_probs=6.4

Q ss_pred             HhhCccc
Q 035343           30 LQYHPES   36 (67)
Q Consensus        30 l~yHPEs   36 (67)
                      +||||||
T Consensus       168 vQFHPES  174 (191)
T COG0512         168 VQFHPES  174 (191)
T ss_pred             EecCCcc
Confidence            7999998


No 17 
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional
Probab=70.07  E-value=1.3  Score=31.09  Aligned_cols=9  Identities=56%  Similarity=1.128  Sum_probs=7.5

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|||||++.
T Consensus       188 vQFHPE~s~  196 (210)
T CHL00188        188 MQFHPEKSG  196 (210)
T ss_pred             EecCCcccc
Confidence            599999983


No 18 
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS). Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS). IGPS incorporates ammonia derived from glutamine into N1-[(5'-phosphoribulosyl)-formimino]-5-aminoimidazole-4-carboxamide ribonucleotide (PRFAR) to form 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR) and imidazole glycerol phosphate (IGP). The glutamine amidotransferase domain generates the ammonia nucleophile which is channeled from the glutaminase active site to the PRFAR active site. IGPS belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site.
Probab=69.43  E-value=1.3  Score=29.52  Aligned_cols=9  Identities=56%  Similarity=0.977  Sum_probs=7.6

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|+|||++.
T Consensus       179 vQFHPE~~~  187 (198)
T cd01748         179 TQFHPEKSG  187 (198)
T ss_pred             EECCCcccc
Confidence            699999874


No 19 
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=68.63  E-value=4.4  Score=27.91  Aligned_cols=17  Identities=41%  Similarity=0.829  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHhhCc
Q 035343           18 LEAIRLIVINNLLQYHP   34 (67)
Q Consensus        18 LE~IRlTIiNNll~yHP   34 (67)
                      .++|..-|+|-||+|||
T Consensus       321 ~~~~~~~~~~~~~~~~~  337 (337)
T cd07858         321 EEDIKELIYNEMLAYHP  337 (337)
T ss_pred             HHHHHHHHHHHHhhcCC
Confidence            45777889999999998


No 20 
>PRK08857 para-aminobenzoate synthase component II; Provisional
Probab=67.83  E-value=1.5  Score=29.50  Aligned_cols=8  Identities=63%  Similarity=1.132  Sum_probs=7.2

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|||||+.
T Consensus       170 vQfHPE~~  177 (193)
T PRK08857        170 VQFHPESI  177 (193)
T ss_pred             EeeCCCcC
Confidence            69999987


No 21 
>CHL00101 trpG anthranilate synthase component 2
Probab=67.75  E-value=1.4  Score=29.65  Aligned_cols=8  Identities=63%  Similarity=1.161  Sum_probs=7.0

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|+|||++
T Consensus       166 vQfHPE~~  173 (190)
T CHL00101        166 IQFHPESL  173 (190)
T ss_pred             EEeCCccC
Confidence            79999985


No 22 
>PF00117 GATase:  Glutamine amidotransferase class-I;  InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group []. The GATase domain exists either as a separate polypeptidic subunit or as part of a larger polypeptide fused in different ways to a synthase domain. Two classes of GATase domains have been identified [, ]: class-I (also known as trpG-type or triad) and class-II (also known as purF-type or Ntn). Class-I (or type 1) GATase domains have been found in the following enzymes: The second component of anthranilate synthase (AS) []. AS catalyzes the biosynthesis of anthranilate from chorismate and glutamine. AS is generally a dimeric enzyme: the first component can synthesize anthranilate using ammonia rather than glutamine, whereas component II provides the GATase activity []. In some bacteria and in fungi the GATase component of AS is part of a multifunctional protein that also catalyzes other steps of the biosynthesis of tryptophan. The second component of 4-amino-4-deoxychorismate (ADC) synthase, a dimeric prokaryotic enzyme that functions in the pathway that catalyzes the biosynthesis of para-aminobenzoate (PABA) from chorismate and glutamine. The second component (gene pabA) provides the GATase activity []. CTP synthase. CTP synthase catalyzes the final reaction in the biosynthesis of pyrimidine, the ATP-dependent formation of CTP from UTP and glutamine. CTP synthase is a single chain enzyme that contains two distinct domains; the GATase domain is in the C-terminal section []. GMP synthase (glutamine-hydrolyzing). GMP synthase catalyzes the ATP-dependent formation of GMP from xanthosine 5'-phosphate and glutamine. GMP synthase is a single chain enzyme that contains two distinct domains; the GATase domain is in the N-terminal section [, ]. Glutamine-dependent carbamoyl-phosphate synthase (GD-CPSase); an enzyme involved in both arginine and pyrimidine biosynthesis and which catalyzes the ATP-dependent formation of carbamoyl phosphate from glutamine and carbon dioxide. In bacteria GD-CPSase is composed of two subunits: the large chain (gene carB) provides the CPSase activity, while the small chain (gene carA) provides the GATase activity. In yeast the enzyme involved in arginine biosynthesis is also composed of two subunits: CPA1 (GATase), and CPA2 (CPSase). In most eukaryotes, the first three steps of pyrimidine biosynthesis are catalyzed by a large multifunctional enzyme (called URA2 in yeast, rudimentary in Drosophila, and CAD in mammals). The GATase domain is located at the N-terminal extremity of this polyprotein []. Phosphoribosylformylglycinamidine synthase, an enzyme that catalyzes the fourth step in the de novo biosynthesis of purines. In some species of bacteria and rchaea, FGAM synthase II is composed of two subunits: a small chain (gene purQ) which provides the GATase activity and a large chain (gene purL) which provides the aminator activity. In eukaryotes and Gram-negative bacteria a single polypeptide (large type of purL) contains a FGAM synthethase domain and the GATase as the C-terminal domain []. Imidazole glycerol phosphate synthase subunit hisH, an enzyme that catalyzes the fifth step in the biosynthesis of histidine.  A triad of conserved Cys-His-Glu forms the active site, wherein the catalytic cysteine is essential for the amidotransferase activity [, ]. Different structures show that the active site Cys of type 1 GATase is located at the tip of a nucleophile elbow.; PDB: 1I7S_D 1I7Q_D 3UOW_B 1GPM_C 1O1Y_A 2VXO_A 2VPI_B 1OX5_B 1OX6_B 1OX4_B ....
Probab=67.45  E-value=1.6  Score=28.38  Aligned_cols=11  Identities=55%  Similarity=0.797  Sum_probs=8.6

Q ss_pred             HhhCccchhhh
Q 035343           30 LQYHPESSSQL   40 (67)
Q Consensus        30 l~yHPEsse~l   40 (67)
                      +|+|||++...
T Consensus       169 ~QfHPE~~~~~  179 (192)
T PF00117_consen  169 VQFHPEFSSSP  179 (192)
T ss_dssp             ESSBTTSTTST
T ss_pred             EecCCcCCCCC
Confidence            69999987643


No 23 
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains. This ACT domain family, ACT_ACR-UUR-like_2, includes the second of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; including those enzymes similar to the GlnD found in enteric Escherichia coli and those found in photosynthetic, nitrogen-fixing bacterium Rhodospirillum rubrum. Also included in this CD are the second and fourth ACT domains of a novel protein composed almost entirely of ACT domain repeats, the ACR protein. These ACR proteins, found in Arabidopsis and Oryza, are proposed to function as novel regulatory or sensor proteins in plants. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=67.21  E-value=8.8  Score=20.90  Aligned_cols=25  Identities=28%  Similarity=0.279  Sum_probs=17.9

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVIN   27 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiN   27 (67)
                      |+|.+.+.+.  .+.+++++||..|.+
T Consensus        44 f~i~~~~~~~--~~~~~~~~i~~~l~~   68 (70)
T cd04899          44 FYVTDADGQP--LDPERQEALRAALGE   68 (70)
T ss_pred             EEEECCCCCc--CCHHHHHHHHHHHHh
Confidence            4667766554  567899999988754


No 24 
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated
Probab=67.12  E-value=1.5  Score=30.06  Aligned_cols=8  Identities=63%  Similarity=1.132  Sum_probs=6.8

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|||||+.
T Consensus       165 vQFHPE~~  172 (195)
T PRK07649        165 VQFHPESI  172 (195)
T ss_pred             EEECCCCC
Confidence            69999975


No 25 
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=66.90  E-value=1.6  Score=29.67  Aligned_cols=9  Identities=56%  Similarity=1.080  Sum_probs=7.7

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|+|||++.
T Consensus       175 ~QFHPE~~~  183 (196)
T PRK13170        175 VQFHPERSG  183 (196)
T ss_pred             EECCCCCcc
Confidence            699999984


No 26 
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=65.04  E-value=1.8  Score=29.30  Aligned_cols=9  Identities=56%  Similarity=0.970  Sum_probs=7.5

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|+|||++.
T Consensus       180 vQFHPE~~~  188 (201)
T PRK13152        180 TQFHPEKSQ  188 (201)
T ss_pred             EeCCCeecC
Confidence            699999874


No 27 
>PRK00275 glnD PII uridylyl-transferase; Provisional
Probab=64.19  E-value=8  Score=32.72  Aligned_cols=29  Identities=10%  Similarity=0.283  Sum_probs=24.6

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVINNLL   30 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiNNll   30 (67)
                      |||++. .|.++.+++++++|+.++.+-|-
T Consensus       858 F~V~d~-~g~~l~~~~~~~~l~~~L~~~L~  886 (895)
T PRK00275        858 FFITDA-DNQPLSDPQLCSRLQDAICEQLD  886 (895)
T ss_pred             EEEECC-CCCCCCCHHHHHHHHHHHHHHHh
Confidence            688876 67899999999999999987663


No 28 
>PRK05637 anthranilate synthase component II; Provisional
Probab=64.02  E-value=2  Score=30.00  Aligned_cols=8  Identities=75%  Similarity=1.257  Sum_probs=6.7

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +||||||.
T Consensus       182 vQfHPE~~  189 (208)
T PRK05637        182 LQFHPESV  189 (208)
T ss_pred             EEeCCccC
Confidence            69999984


No 29 
>PF09330 Lact-deh-memb:  D-lactate dehydrogenase, membrane binding;  InterPro: IPR015409 Members of this entry are predominantly found in prokaryotic D-lactate dehydrogenase, forming the cap-membrane-binding domain, which consists of a large seven-stranded antiparallel beta-sheet flanked on both sides by alpha-helices. They allow for membrane association []. ; GO: 0050660 flavin adenine dinucleotide binding, 0055085 transmembrane transport; PDB: 1F0X_A.
Probab=64.01  E-value=4  Score=31.80  Aligned_cols=28  Identities=29%  Similarity=0.517  Sum_probs=20.8

Q ss_pred             CCHHHHHHHHHHHHHHHHhhCccchhhhh
Q 035343           13 DDPEVLEAIRLIVINNLLQYHPESSSQLA   41 (67)
Q Consensus        13 ~~~e~LE~IRlTIiNNll~yHPEsse~la   41 (67)
                      .||+.|++||-.|++|+ +-=|.|+|++-
T Consensus         7 Nd~~~L~~lRR~iL~~f-~~LPisgEYmH   34 (291)
T PF09330_consen    7 NDPAVLTDLRRHILSNF-KNLPISGEYMH   34 (291)
T ss_dssp             S-HHHHHHHHHHHHHH--SS--SEEEEEE
T ss_pred             CCHHHHHHHHHHHHhCC-ccCChhhhhhh
Confidence            48999999999999985 56699999864


No 30 
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase. This model describes the glutamine amidotransferase domain or peptide of the tryptophan-biosynthetic pathway enzyme anthranilate synthase or of the folate biosynthetic pathway enzyme para-aminobenzoate synthase. In at least one case, a single polypeptide from Bacillus subtilis was shown to have both functions. This model covers a subset of the sequences described by the pfam model GATase.
Probab=63.90  E-value=2  Score=29.03  Aligned_cols=8  Identities=63%  Similarity=1.132  Sum_probs=6.8

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|||||+.
T Consensus       166 vQfHPE~~  173 (188)
T TIGR00566       166 VQFHPESI  173 (188)
T ss_pred             EEeCCCcc
Confidence            69999984


No 31 
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit. This model represents the glutamine amidotransferase subunit (or domain, in eukaryotic systems) of imidazole glycerol phosphate synthase. This subunit catalyzes step 5 of histidine biosynthesis from PRPP. The other subunit, the cyclase, catalyzes step 6.
Probab=63.31  E-value=2.1  Score=29.01  Aligned_cols=9  Identities=56%  Similarity=0.977  Sum_probs=7.3

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|||||++.
T Consensus       175 vQFHPE~~~  183 (196)
T TIGR01855       175 TQFHPEKSG  183 (196)
T ss_pred             EECCCccCc
Confidence            699999863


No 32 
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=63.26  E-value=2.1  Score=28.80  Aligned_cols=9  Identities=56%  Similarity=0.981  Sum_probs=7.4

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|||||++.
T Consensus       180 vQfHPE~~~  188 (205)
T PRK13141        180 AQFHPEKSG  188 (205)
T ss_pred             EeCCCccch
Confidence            699999863


No 33 
>PRK08007 para-aminobenzoate synthase component II; Provisional
Probab=62.62  E-value=2.2  Score=28.88  Aligned_cols=8  Identities=63%  Similarity=1.132  Sum_probs=6.8

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|||||+-
T Consensus       165 vQfHPE~~  172 (187)
T PRK08007        165 VQFHPESI  172 (187)
T ss_pred             EEeCCccc
Confidence            69999983


No 34 
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase. This model describes GlnD, the uridylyltransferase/uridylyl-removing enzyme for the nitrogen regulatory protein PII. Not all homologs of PII share the property of uridylyltransferase modification on the characteristic Tyr residue (see Prosite pattern PS00496 and document PDOC00439), but the modification site is preserved in the PII homolog of all species with a member of this family.
Probab=61.82  E-value=9.4  Score=31.57  Aligned_cols=30  Identities=10%  Similarity=0.087  Sum_probs=24.8

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHHHHHh
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVINNLLQ   31 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiNNll~   31 (67)
                      |||++. .|+++.++++++.|+.+|.+.|-.
T Consensus       713 F~V~~~-~g~~~~~~~~~~~i~~~L~~~L~~  742 (850)
T TIGR01693       713 FVVQDL-FGSPPAAERVFQELLQGLVDVLAG  742 (850)
T ss_pred             EEEECC-CCCCCCcHHHHHHHHHHHHHHHcC
Confidence            677775 478999999999999999887743


No 35 
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase. Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase. GMP synthetase is a glutamine amidotransferase from the de novo purine biosynthetic pathway. Glutamine amidotransferase (GATase) activity catalyse the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate.  GMP synthetase catalyses the amination of the nucleotide precursor xanthosine 5'-monophospahte to form GMP.  GMP synthetase belongs to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site.
Probab=60.41  E-value=2.5  Score=27.33  Aligned_cols=9  Identities=44%  Similarity=1.003  Sum_probs=7.8

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|+|||.+.
T Consensus       161 ~QfHPE~~~  169 (181)
T cd01742         161 VQFHPEVTH  169 (181)
T ss_pred             EEcCCcccc
Confidence            699999985


No 36 
>PF00380 Ribosomal_S9:  Ribosomal protein S9/S16;  InterPro: IPR000754 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein S9 is one of the proteins from the small ribosomal subunit. It belongs to the S9P family of ribosomal proteins which, on the basis of sequence similarities [, ], groups bacterial; algal chloroplast; cyanelle and archaeal S9 proteins; and mammalian; plant; and yeast mitochondrial ribosomal S9 proteins. These proteins adopt a beta-alpha-beta fold similar to that found in numerous RNA/DNA-binding proteins, as well as in kinases from the GHMP kinase family [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2V46_I 3T1H_I 3MR8_I 3F1G_I 3D5C_I 3D5A_I 2WDG_I 3MS0_I 2WDM_I 2J02_I ....
Probab=60.36  E-value=12  Score=25.09  Aligned_cols=29  Identities=24%  Similarity=0.425  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHHHHHHHhhCccchhhhhcc
Q 035343           15 PEVLEAIRLIVINNLLQYHPESSSQLAMG   43 (67)
Q Consensus        15 ~e~LE~IRlTIiNNll~yHPEsse~la~G   43 (67)
                      +.+-++||+.|-.-|+++.|+..+.|..-
T Consensus        64 ~gQa~Air~aiaraL~~~~~~~~~~Lk~~   92 (121)
T PF00380_consen   64 SGQAGAIRLAIARALVKFNPSLKPELKKA   92 (121)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTCHHHHCTT
T ss_pred             eeehHHHHHHHHHHHHHHhHHHHHHHhhC
Confidence            67889999999999999999988888654


No 37 
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=59.87  E-value=2.6  Score=28.34  Aligned_cols=8  Identities=63%  Similarity=1.211  Sum_probs=6.9

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|+|||++
T Consensus       178 vQFHPE~~  185 (199)
T PRK13181        178 VQFHPEKS  185 (199)
T ss_pred             EECCCccC
Confidence            69999976


No 38 
>PRK05670 anthranilate synthase component II; Provisional
Probab=58.80  E-value=2.7  Score=28.01  Aligned_cols=8  Identities=63%  Similarity=1.132  Sum_probs=6.9

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|+|||++
T Consensus       165 vQfHPE~~  172 (189)
T PRK05670        165 VQFHPESI  172 (189)
T ss_pred             EeeCCCcC
Confidence            69999985


No 39 
>PRK06774 para-aminobenzoate synthase component II; Provisional
Probab=58.34  E-value=2.8  Score=28.00  Aligned_cols=8  Identities=63%  Similarity=1.132  Sum_probs=6.8

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|+|||+.
T Consensus       169 vQfHPE~~  176 (191)
T PRK06774        169 VQFHPESI  176 (191)
T ss_pred             EEECCCcC
Confidence            69999983


No 40 
>CHL00079 rps9 ribosomal protein S9
Probab=57.71  E-value=12  Score=25.60  Aligned_cols=29  Identities=31%  Similarity=0.308  Sum_probs=25.6

Q ss_pred             CHHHHHHHHHHHHHHHHhhCccchhhhhc
Q 035343           14 DPEVLEAIRLIVINNLLQYHPESSSQLAM   42 (67)
Q Consensus        14 ~~e~LE~IRlTIiNNll~yHPEsse~la~   42 (67)
                      -+.+-++||+.|-.-|++|.||....|-.
T Consensus        72 ~sgQa~Air~aIaraLv~~~~~~k~~Lk~  100 (130)
T CHL00079         72 LTGQAEAIRLGLARALCKINPENRKSLKK  100 (130)
T ss_pred             hhHHHHHHHHHHHHHHHHHCHHHHHHHHH
Confidence            46788999999999999999998888863


No 41 
>PRK00758 GMP synthase subunit A; Validated
Probab=56.94  E-value=3.1  Score=27.44  Aligned_cols=8  Identities=50%  Similarity=1.120  Sum_probs=6.8

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|+|||++
T Consensus       158 ~QfHPE~~  165 (184)
T PRK00758        158 VQFHPEVA  165 (184)
T ss_pred             EEcCCccC
Confidence            59999985


No 42 
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II. This group of sequences represents the small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II.  CPSase II catalyzes the production of carbomyl phosphate (CP) from bicarbonate, glutamine and two molecules of MgATP. The reaction is believed to proceed by a series of four biochemical reactions involving a minimum of three discrete highly reactive intermediates. The synthesis of CP is critical for the initiation of two separate biosynthetic pathways. In one CP is coupled to aspartate, its carbon and nitrogen nuclei ultimately incorporated into the aromatic moieties of pyrimidine nucleotides. In the second pathway CP is condensed with ornithine at the start of the urea cycle and is utilized for the detoxification of ammonia and biosynthesis of arginine. CPSases may be encoded by one or by several genes, depending on the species.  The E.coli enzyme is
Probab=56.62  E-value=3.3  Score=27.45  Aligned_cols=10  Identities=50%  Similarity=0.946  Sum_probs=7.9

Q ss_pred             HHhhCccchh
Q 035343           29 LLQYHPESSS   38 (67)
Q Consensus        29 ll~yHPEsse   38 (67)
                      =+|+|||+..
T Consensus       156 GvQfHPE~~~  165 (178)
T cd01744         156 SVQFHPEASP  165 (178)
T ss_pred             EEeeCCCCCC
Confidence            4699999854


No 43 
>PF13174 TPR_6:  Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A.
Probab=56.44  E-value=11  Score=17.43  Aligned_cols=13  Identities=23%  Similarity=0.386  Sum_probs=10.9

Q ss_pred             HHHHHHHhhCccc
Q 035343           24 IVINNLLQYHPES   36 (67)
Q Consensus        24 TIiNNll~yHPEs   36 (67)
                      .+++.+++.||+|
T Consensus        21 ~~~~~~~~~~P~s   33 (33)
T PF13174_consen   21 EYFQRLIKRYPDS   33 (33)
T ss_dssp             HHHHHHHHHSTTS
T ss_pred             HHHHHHHHHCcCC
Confidence            4788899999986


No 44 
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated
Probab=56.40  E-value=11  Score=26.37  Aligned_cols=23  Identities=13%  Similarity=0.221  Sum_probs=21.4

Q ss_pred             CCHHHHHHHHHHHHHHHHhhCcc
Q 035343           13 DDPEVLEAIRLIVINNLLQYHPE   35 (67)
Q Consensus        13 ~~~e~LE~IRlTIiNNll~yHPE   35 (67)
                      ++++.+...|..|++-||.-||.
T Consensus        76 t~~~~~~~~rk~~l~~ll~~h~~   98 (234)
T PRK07569         76 TNTPRLQEYRRMIVELLFAEGNH   98 (234)
T ss_pred             ECCHHHHHHHHHHHHHHHHhccc
Confidence            47899999999999999999997


No 45 
>PF02518 HATPase_c:  Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;  InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins. The fold of this domain consists of two layers, alpha/beta, which contains an 8-stranded mixed beta-sheet. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0005524 ATP binding; PDB: 3JZ3_A 3DGE_A 2C2A_A 2BU5_A 2BU8_A 2BU6_A 2BU7_A 2BU2_A 2BTZ_A 3K99_D ....
Probab=56.17  E-value=8.9  Score=22.35  Aligned_cols=23  Identities=30%  Similarity=0.538  Sum_probs=21.2

Q ss_pred             CHHHHHHHHHHHHHHHHhhCccc
Q 035343           14 DPEVLEAIRLIVINNLLQYHPES   36 (67)
Q Consensus        14 ~~e~LE~IRlTIiNNll~yHPEs   36 (67)
                      |+++|..|=..+|+|.++++|+.
T Consensus         2 d~~~l~~il~~ll~Na~~~~~~~   24 (111)
T PF02518_consen    2 DPDRLRQILSELLDNAIKHSPEG   24 (111)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHT
T ss_pred             cHHHHHHHHHHHHHHHHHHhcCC
Confidence            78899999999999999999985


No 46 
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit. separate polypeptide chains in most of the Archaea. This N-terminal region would be the smaller subunit.
Probab=55.65  E-value=3.3  Score=27.40  Aligned_cols=9  Identities=44%  Similarity=1.003  Sum_probs=7.4

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|+|||.+.
T Consensus       161 ~QfHPE~~~  169 (188)
T TIGR00888       161 VQFHPEVTH  169 (188)
T ss_pred             EeeCCccCC
Confidence            699999864


No 47 
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase. Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase (ASase). This group contains proteins similar to para-aminobenzoate (PABA) synthase and ASase.  These enzymes catalyze similar reactions and produce similar products, PABA and ortho-aminobenzoate (anthranilate). Each enzyme is composed of non-identical subunits: a glutamine amidotransferase subunit (component II) and a subunit that produces an aminobenzoate products (component I). ASase catalyses the synthesis of anthranilate from chorismate and glutamine and is a tetrameric protein comprising two copies each of components I and II. Component II of ASase belongs to the family of triad GTases which hydrolyze glutamine and transfer nascent ammonia between the active sites. In some bacteria, such as Escherichia coli, component II can be much larger than in other organisms, due to the prese
Probab=55.48  E-value=3.2  Score=27.28  Aligned_cols=10  Identities=50%  Similarity=0.690  Sum_probs=7.8

Q ss_pred             HHhhCccchh
Q 035343           29 LLQYHPESSS   38 (67)
Q Consensus        29 ll~yHPEsse   38 (67)
                      =+|+|||+..
T Consensus       163 gvQfHPE~~~  172 (184)
T cd01743         163 GVQFHPESIL  172 (184)
T ss_pred             EEeeCCCcCC
Confidence            3799999854


No 48 
>PRK00132 rpsI 30S ribosomal protein S9; Reviewed
Probab=55.31  E-value=15  Score=25.00  Aligned_cols=30  Identities=27%  Similarity=0.314  Sum_probs=26.4

Q ss_pred             CHHHHHHHHHHHHHHHHhhCccchhhhhcc
Q 035343           14 DPEVLEAIRLIVINNLLQYHPESSSQLAMG   43 (67)
Q Consensus        14 ~~e~LE~IRlTIiNNll~yHPEsse~la~G   43 (67)
                      -+.+-++||+.|-.-|++|.||..+.|...
T Consensus        72 ~sgQa~Air~aiaraLv~~~~~~r~~Lk~~  101 (130)
T PRK00132         72 ISGQAGAIRHGIARALLEYDPDLRPALKKA  101 (130)
T ss_pred             HHHHHHHHHHHHHHHHHHHCHHHHHHHHHC
Confidence            367889999999999999999999888763


No 49 
>cd06930 NR_LBD_F2 Ligand-binding domain of nuclear receptor family 2. Ligand-binding domain (LBD) of nuclear receptor (NR) family 2:  This is one of the major subfamily of nuclear receptors, including some well known nuclear receptors such as glucocorticoid receptor (GR), mineralocorticoid receptor (MR), estrogen receptor (ER), progesterone receptor (PR), and androgen receptor (AR), other related receptors. Nuclear receptors form a superfamily of ligand-activated transcription regulators, which regulate various physiological functions, from development, reproduction, to homeostasis and metabolism in animals (metazoans). The family contains not only receptors for known ligands but also orphan receptors for which ligands do not exist or have not been identified. NRs share a common structural organization with a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Probab=54.74  E-value=28  Score=21.70  Aligned_cols=30  Identities=13%  Similarity=0.346  Sum_probs=24.0

Q ss_pred             ccCCHHHHHHHHHHHHHHHHhh----Cccchhhh
Q 035343           11 KVDDPEVLEAIRLIVINNLLQY----HPESSSQL   40 (67)
Q Consensus        11 KV~~~e~LE~IRlTIiNNll~y----HPEsse~l   40 (67)
                      .+.+++.++++|..+++-|.+|    ||+....+
T Consensus       119 ~l~~~~~v~~~q~~~~~aL~~~~~~~~~~~~~R~  152 (165)
T cd06930         119 GLKNQQQVEELQEKAQQALQEYIRKRYPQQPARF  152 (165)
T ss_pred             CCcCHHHHHHHHHHHHHHHHHHHHhhCCCchhHH
Confidence            4678999999999999999987    66654443


No 50 
>PRK07765 para-aminobenzoate synthase component II; Provisional
Probab=54.58  E-value=3.6  Score=28.59  Aligned_cols=8  Identities=63%  Similarity=1.165  Sum_probs=6.9

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|+|||++
T Consensus       169 vQfHPE~~  176 (214)
T PRK07765        169 VQFHPESV  176 (214)
T ss_pred             EeeCCCcc
Confidence            69999975


No 51 
>PRK06895 putative anthranilate synthase component II; Provisional
Probab=54.28  E-value=3.7  Score=27.48  Aligned_cols=7  Identities=71%  Similarity=1.379  Sum_probs=6.3

Q ss_pred             HhhCccc
Q 035343           30 LQYHPES   36 (67)
Q Consensus        30 l~yHPEs   36 (67)
                      +|+|||+
T Consensus       166 vQFHPE~  172 (190)
T PRK06895        166 VQFHPES  172 (190)
T ss_pred             EEeCCCc
Confidence            7999997


No 52 
>PLN02335 anthranilate synthase
Probab=52.48  E-value=4  Score=28.59  Aligned_cols=8  Identities=63%  Similarity=1.132  Sum_probs=7.1

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|||||+.
T Consensus       190 vQfHPE~~  197 (222)
T PLN02335        190 VQFHPESI  197 (222)
T ss_pred             EEeCCCCC
Confidence            79999985


No 53 
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=51.46  E-value=4.4  Score=27.48  Aligned_cols=9  Identities=56%  Similarity=0.977  Sum_probs=7.4

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|+|||++.
T Consensus       176 vQfHPE~~~  184 (200)
T PRK13143        176 TQFHPEKSG  184 (200)
T ss_pred             EeCCCccch
Confidence            699999863


No 54 
>COG0103 RpsI Ribosomal protein S9 [Translation, ribosomal structure and biogenesis]
Probab=50.96  E-value=18  Score=25.25  Aligned_cols=30  Identities=27%  Similarity=0.305  Sum_probs=26.1

Q ss_pred             HHHHHHHHHHHHHHHHhhCccchhhhhccc
Q 035343           15 PEVLEAIRLIVINNLLQYHPESSSQLAMGV   44 (67)
Q Consensus        15 ~e~LE~IRlTIiNNll~yHPEsse~la~G~   44 (67)
                      +-+-++||+.|-.-|++|.||.-..|...-
T Consensus        73 ~GQA~AiR~gIaRAL~~~~~~lr~~lk~~g  102 (130)
T COG0103          73 SGQAGAIRHGIARALVEYDPELRPALKKAG  102 (130)
T ss_pred             hHHHHHHHHHHHHHHHHHCHHHHHHHHHCC
Confidence            457799999999999999999998886654


No 55 
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. gamma-Glutamyl Hydrolase catalyzes the cleavage of the gamma-glutamyl chain of folylpoly-gamma-glutamyl substrates and is a central enzyme in folyl and antifolyl poly-gamma-glutamate metabolism. GATase activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate.  gamma-Glutamyl hydrolases belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site.
Probab=50.94  E-value=5  Score=29.21  Aligned_cols=15  Identities=27%  Similarity=0.585  Sum_probs=11.4

Q ss_pred             HhhCccchhhhhcccc
Q 035343           30 LQYHPESSSQLAMGVT   45 (67)
Q Consensus        30 l~yHPEsse~la~G~~   45 (67)
                      +|||||.+ ...+|..
T Consensus       208 vQFHPEks-~few~~~  222 (273)
T cd01747         208 VQWHPEKN-AFEWKKS  222 (273)
T ss_pred             EecCCCcc-ccccccc
Confidence            69999988 5666653


No 56 
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism]
Probab=50.74  E-value=5  Score=32.08  Aligned_cols=8  Identities=75%  Similarity=1.364  Sum_probs=7.0

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|||||+|
T Consensus       338 VQ~HPEAs  345 (368)
T COG0505         338 VQYHPEAS  345 (368)
T ss_pred             EccCCCCC
Confidence            69999986


No 57 
>PRK04374 PII uridylyl-transferase; Provisional
Probab=49.96  E-value=16  Score=31.01  Aligned_cols=27  Identities=15%  Similarity=0.213  Sum_probs=22.4

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVINNL   29 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiNNl   29 (67)
                      |||++. .|+++.++++ ++||..++.-|
T Consensus       840 F~V~d~-~g~~~~~~~~-~~l~~~L~~~l  866 (869)
T PRK04374        840 FQITDE-HDRPLSESAR-QALRDALCACL  866 (869)
T ss_pred             EEEECC-CCCcCChHHH-HHHHHHHHHHh
Confidence            788876 5678888888 99999998766


No 58 
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional
Probab=49.86  E-value=16  Score=28.34  Aligned_cols=23  Identities=22%  Similarity=0.329  Sum_probs=21.7

Q ss_pred             CCHHHHHHHHHHHHHHHHhhCcc
Q 035343           13 DDPEVLEAIRLIVINNLLQYHPE   35 (67)
Q Consensus        13 ~~~e~LE~IRlTIiNNll~yHPE   35 (67)
                      ++++.+.+.|.+++.=||.-||-
T Consensus       142 T~Se~v~~~Rk~vLElLLs~Hp~  164 (297)
T PTZ00305        142 TDSRLVRDAREGNVELILINHPN  164 (297)
T ss_pred             eCCHHHHHHHHHHHHHHHhcCCC
Confidence            48999999999999999999997


No 59 
>cd06950 NR_LBD_Tlx_PNR_like The ligand binding domain of Tailless-like proteins,  orphan nuclear receptors. The ligand binding domain of the photoreceptor cell-specific nuclear receptor (PNR)  like family: This family includes photoreceptor cell-specific nuclear receptor (PNR), Tailless (TLX), and related receptors. TLX is an orphan receptor that is expressed by neural stem/progenitor cells in the adult brain of the subventricular zone (SVZ) and the dentate gyrus (DG). It plays a key role in neural development by promoting cell cycle progression and preventing apoptosis in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TLX and PNR  have  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge 
Probab=49.43  E-value=29  Score=23.79  Aligned_cols=30  Identities=20%  Similarity=0.246  Sum_probs=24.9

Q ss_pred             ccCCHHHHHHHHHHHHHHHHhh----Cccchhhh
Q 035343           11 KVDDPEVLEAIRLIVINNLLQY----HPESSSQL   40 (67)
Q Consensus        11 KV~~~e~LE~IRlTIiNNll~y----HPEsse~l   40 (67)
                      .+.+++.+|++|-.+.+.|.+|    ||+....+
T Consensus       144 ~L~~~~~Ve~lq~~~~~aL~~y~~~~~~~~~~Rf  177 (206)
T cd06950         144 GLKDPAQVEALQDQAQLMLNKHIRTRYPTQPARF  177 (206)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHhCCCcccHH
Confidence            4788899999999999999887    88765544


No 60 
>cd06943 NR_LBD_RXR_like The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily. The ligand binding domain of the retinoid X receptor (RXR) and Ultraspiracle (USP): This family includes two evolutionary related nuclear receptors: retinoid X receptor (RXR) and Ultraspiracle (USP). RXR is a nuclear receptor in mammalian and USP is its counterpart in invertebrates.  The native ligand of retinoid X receptor is 9-cis retinoic acid (RA). RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. RXRs can play different roles in these heterodimers. It acts  either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, func
Probab=49.19  E-value=33  Score=22.92  Aligned_cols=31  Identities=26%  Similarity=0.518  Sum_probs=25.2

Q ss_pred             CccCCHHHHHHHHHHHHHHHHhh----Cccchhhh
Q 035343           10 RKVDDPEVLEAIRLIVINNLLQY----HPESSSQL   40 (67)
Q Consensus        10 ~KV~~~e~LE~IRlTIiNNll~y----HPEsse~l   40 (67)
                      ..+.+++.+|.+|..+.+-|.+|    ||+....+
T Consensus       148 ~~L~~~~~v~~~q~~~~~aL~~y~~~~~~~~~~Rf  182 (207)
T cd06943         148 KGLKSRQEVESLREKVYASLEEYCRQKHPEQPGRF  182 (207)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHhhCCCcccHH
Confidence            36778899999999999999987    78765444


No 61 
>PRK06490 glutamine amidotransferase; Provisional
Probab=49.05  E-value=5.6  Score=28.27  Aligned_cols=10  Identities=50%  Similarity=0.969  Sum_probs=8.3

Q ss_pred             HhhCccchhh
Q 035343           30 LQYHPESSSQ   39 (67)
Q Consensus        30 l~yHPEsse~   39 (67)
                      +|+|||++..
T Consensus       175 ~QfHPE~~~~  184 (239)
T PRK06490        175 LQFHPEVTRA  184 (239)
T ss_pred             EeeCccCCHH
Confidence            5999999854


No 62 
>cd01433 Ribosomal_L16_L10e Ribosomal_L16_L10e: L16 is an essential protein in the large ribosomal subunit of bacteria, mitochondria, and chloroplasts. Large subunits that lack L16 are defective in peptidyl transferase activity, peptidyl-tRNA hydrolysis activity, association with the 30S subunit, binding of aminoacyl-tRNA and interaction with antibiotics. L16 is required for the function of elongation factor P (EF-P), a protein involved in peptide bond synthesis through the stimulation of peptidyl transferase activity by the ribosome. Mutations in L16 and the adjoining bases of 23S rRNA confer antibiotic resistance in bacteria, suggesting a role for L16 in the formation of the antibiotic binding site. The GTPase RbgA (YlqF) is essential for the assembly of the large subunit, and it is believed to regulate the incorporation of L16. L10e is the archaeal and eukaryotic cytosolic homolog of bacterial L16. L16 and L10e exhibit structural differences at the N-terminus.
Probab=49.02  E-value=19  Score=22.93  Aligned_cols=37  Identities=27%  Similarity=0.282  Sum_probs=26.8

Q ss_pred             cCCHHHHHHHHHHHHHHHHhh--------Ccc-----chhhhhcccccCC
Q 035343           12 VDDPEVLEAIRLIVINNLLQY--------HPE-----SSSQLAMGVTFGV   48 (67)
Q Consensus        12 V~~~e~LE~IRlTIiNNll~y--------HPE-----sse~la~G~~fg~   48 (67)
                      -..++.||+.|++|..+|-..        ||-     .+.+--||..+|.
T Consensus        19 ~i~~~~lEa~R~~i~r~l~k~~~~~~ir~~p~~~vt~k~~~~rMGkGKG~   68 (112)
T cd01433          19 RITAEQLEAARIAINRYLKKKGGKLWIRVFPDHPVTKKPLETRMGKGKGK   68 (112)
T ss_pred             eECHHHHHHHHHHHHHHhhhcCceEEEEecCCccEEECccccccCCCCCC
Confidence            457899999999999999875        442     2345667776664


No 63 
>PF08818 DUF1801:  Domain of unknown function (DU1801);  InterPro: IPR014922 This large entry of bacterial proteins is uncharacterised. They contain a presumed domain about 110 amino acids in length. ; PDB: 2KL4_A 2OC6_B 2I8D_B.
Probab=46.46  E-value=12  Score=22.22  Aligned_cols=28  Identities=25%  Similarity=0.491  Sum_probs=22.5

Q ss_pred             HHHHHHHHHHHHHHHHhhCccchhhhhccccc
Q 035343           15 PEVLEAIRLIVINNLLQYHPESSSQLAMGVTF   46 (67)
Q Consensus        15 ~e~LE~IRlTIiNNll~yHPEsse~la~G~~f   46 (67)
                      -+.++++|-.|    ++.+|+..|.+.+|.++
T Consensus         3 r~~~~~lr~li----~~~~P~~~e~ikwg~P~   30 (103)
T PF08818_consen    3 REILEELRELI----LEAAPDLEEVIKWGMPA   30 (103)
T ss_dssp             HHHHHHHHHHH----HHHSTTSEEEEETTEEE
T ss_pred             HHHHHHHHHHH----HHhCcChhheeecceeE
Confidence            36778888776    46789999999999876


No 64 
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing)
Probab=46.13  E-value=6  Score=31.49  Aligned_cols=8  Identities=88%  Similarity=1.456  Sum_probs=6.8

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|||||++
T Consensus       398 VQFHPEa~  405 (415)
T PLN02771        398 LQYHPEAS  405 (415)
T ss_pred             EEcCCCCC
Confidence            69999984


No 65 
>cd06952 NR_LBD_TR2_like The ligand binding domain of the orphan nuclear receptors TR4 and TR2. The ligand binding domain of the TR4 and TR2 (human testicular receptor 4 and 2):  TR4 and TR2 are orphan nuclear receptors. Several isoforms of TR4 and TR2 have been isolated in various tissues. TR2 is abundantly expressed in the androgen-sensitive prostate. TR4 transcripts are expressed in many tissues, including central nervous system, adrenal gland, spleen, thyroid gland, and prostate. The expression of TR2 is negatively regulated by androgen, retinoids, and radiation. The expression of both mouse TR2 and TR4 is up-regulated by neurocytokine ciliary neurotrophic factor (CNTF) in mouse. It has shown that human TR2 binds to a wide spectrum of natural hormone response elements (HREs) with distinct affinities suggesting that TR2 may cross-talk with other gene expression regulation systems. The genes responding to TR2 or TR4 include genes that are regulated by retinoic acid receptor, vitamin D
Probab=45.78  E-value=35  Score=23.28  Aligned_cols=31  Identities=19%  Similarity=0.274  Sum_probs=24.7

Q ss_pred             CccCCHHHHHHHHHHHHHHHHhh----Cccchhhh
Q 035343           10 RKVDDPEVLEAIRLIVINNLLQY----HPESSSQL   40 (67)
Q Consensus        10 ~KV~~~e~LE~IRlTIiNNll~y----HPEsse~l   40 (67)
                      .-+++++..+++|-.|++.|-+|    ||+.+..+
T Consensus       146 ~~l~~~~~v~~lq~~i~~aL~~y~~~~~p~~~~R~  180 (222)
T cd06952         146 PGQELRQQIEKLQEKALMELRDYVGKTYPEDEYRL  180 (222)
T ss_pred             cCCcCHHHHHHHHHHHHHHHHHHHHHhCCCcccHH
Confidence            34689999999999999998877    57766544


No 66 
>PF00226 DnaJ:  DnaJ domain;  InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein []. Structurally, the DnaJ protein consists of an N-terminal conserved domain (called 'J' domain) of about 70 amino acids, a glycine-rich region ('G' domain') of about 30 residues, a central domain containing four repeats of a CXXCXGXG motif ('CRR' domain) and a C-terminal region of 120 to 170 residues. Such a structure is shown in the following schematic representation:  +------------+-+-------+-----+-----------+--------------------------------+ | N-terminal | | Gly-R | | CXXCXGXG | C-terminal | +------------+-+-------+-----+-----------+--------------------------------+   It is thought that the 'J' domain of DnaJ mediates the interaction with the dnaK protein and consists of four helices, the second of which has a charged surface that includes at least one pair of basic residues that are essential for interaction with the ATPase domain of Hsp70. The J- and CRR-domains are found in many prokaryotic and eukaryotic proteins [], either together or separately. In yeast, J-domains have been classified into 3 groups; the class III proteins are functionally distinct and do not appear to act as molecular chaperones []. ; GO: 0031072 heat shock protein binding; PDB: 2GUZ_C 2L6L_A 1HDJ_A 2EJ7_A 1FPO_C 2CUG_A 2QSA_A 2OCH_A 3BVO_B 3APQ_A ....
Probab=45.77  E-value=21  Score=19.55  Aligned_cols=24  Identities=29%  Similarity=0.297  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHHHHhhCccchh
Q 035343           15 PEVLEAIRLIVINNLLQYHPESSS   38 (67)
Q Consensus        15 ~e~LE~IRlTIiNNll~yHPEsse   38 (67)
                      ..-.++||..--+=+.++||+-..
T Consensus        11 ~~~~~eik~~y~~l~~~~HPD~~~   34 (64)
T PF00226_consen   11 DASDEEIKKAYRRLSKQYHPDKNS   34 (64)
T ss_dssp             TSSHHHHHHHHHHHHHHTSTTTGT
T ss_pred             CCCHHHHHHHHHhhhhccccccch
Confidence            445788999999999999998743


No 67 
>smart00430 HOLI Ligand binding domain of hormone receptors.
Probab=45.45  E-value=26  Score=20.88  Aligned_cols=25  Identities=28%  Similarity=0.474  Sum_probs=21.2

Q ss_pred             CCccCCH--HHHHHHHHHHHHHHHhhC
Q 035343            9 GRKVDDP--EVLEAIRLIVINNLLQYH   33 (67)
Q Consensus         9 g~KV~~~--e~LE~IRlTIiNNll~yH   33 (67)
                      +.++.++  +.+|++|..+++.|.+|-
T Consensus       112 ~~~l~~~~~~~~~~~~~~~~~~L~~y~  138 (163)
T smart00430      112 GPGLSEEGKEILEKLQEKLANALHDYY  138 (163)
T ss_pred             hhhhChHHHHHHHHHHHHHHHHHHHHH
Confidence            4567777  899999999999998774


No 68 
>cd06940 NR_LBD_REV_ERB The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily. The ligand binding domain (LBD) of REV-ERB receptors:  REV-ERBs are transcriptional regulators belonging to the nuclear receptor superfamily. They regulate a number of physiological functions including the circadian rhythm, lipid metabolism, and cellular differentiation. The LBD domain of REV-ERB is unusual   in the nuclear receptor family by lacking the AF-2 region that is responsible for coactivator interaction.  REV-ERBs act as constitutive repressors because of their inability to bind coactivators.  REV-ERB receptors can bind to two classes of DNA response elements as either a monomer or heterodimer, indicating functional diversity. When bound to the DNA, they recruit corepressors (NcoR/histone deacetylase 3) to the promoter, resulting in repression of the target gene. The porphyrin heme has been demonstrated to function as a ligand for REV-ERB. Like other members of 
Probab=45.27  E-value=39  Score=22.87  Aligned_cols=31  Identities=23%  Similarity=0.431  Sum_probs=25.8

Q ss_pred             CccCCHHHHHHHHHHHHHHHHhh----Cccchhhh
Q 035343           10 RKVDDPEVLEAIRLIVINNLLQY----HPESSSQL   40 (67)
Q Consensus        10 ~KV~~~e~LE~IRlTIiNNll~y----HPEsse~l   40 (67)
                      ..+.+++.+|++|..+++-|-.|    ||+....+
T Consensus       129 ~~L~~~~~Ve~lq~~~~~aL~~~~~~~~p~~~~rf  163 (189)
T cd06940         129 SGLENVNLVEALQETLIRALRTLIAKNHPNEPSIF  163 (189)
T ss_pred             cCCCCHHHHHHHHHHHHHHHHHHHHHhCCCCccHH
Confidence            46889999999999999988877    88866544


No 69 
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine 
Probab=44.27  E-value=6.7  Score=26.39  Aligned_cols=9  Identities=44%  Similarity=0.796  Sum_probs=7.3

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|+|||...
T Consensus       167 vQfHPE~~~  175 (189)
T cd01745         167 VQWHPEWLA  175 (189)
T ss_pred             EecCCCcCc
Confidence            699999864


No 70 
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit. This model represents the whole of the small chain of the glutamine-dependent form (EC 6.3.5.5) of carbamoyl phosphate synthase, CPSase II. The C-terminal domain has glutamine amidotransferase activity. Note that the sequence from the mammalian urea cycle form has lost the active site Cys, resulting in an ammonia-dependent form, CPSase I (EC 6.3.4.16). CPSases of pyrimidine biosynthesis, arginine biosynthesis, and the urea cycle may be encoded by one or by several genes, depending on the species.
Probab=43.95  E-value=6.5  Score=30.21  Aligned_cols=9  Identities=67%  Similarity=1.136  Sum_probs=7.4

Q ss_pred             HHhhCccch
Q 035343           29 LLQYHPESS   37 (67)
Q Consensus        29 ll~yHPEss   37 (67)
                      =+|||||++
T Consensus       331 gVQfHPE~~  339 (358)
T TIGR01368       331 SVQYHPEAS  339 (358)
T ss_pred             EEEECCCCC
Confidence            379999985


No 71 
>cd04369 Bromodomain Bromodomain. Bromodomains are found in many chromatin-associated proteins and in nuclear histone acetyltransferases. They interact specifically with acetylated lysine.
Probab=43.53  E-value=34  Score=19.05  Aligned_cols=29  Identities=21%  Similarity=0.241  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHHHHHHHhhCccchhhhhccc
Q 035343           15 PEVLEAIRLIVINNLLQYHPESSSQLAMGV   44 (67)
Q Consensus        15 ~e~LE~IRlTIiNNll~yHPEsse~la~G~   44 (67)
                      .+..+++|+ |++|-+.||+..+....++.
T Consensus        61 ~~f~~D~~l-i~~Na~~~n~~~~~~~~~a~   89 (99)
T cd04369          61 EEFEADVRL-IFSNAKTYNGPGSPIYKDAK   89 (99)
T ss_pred             HHHHHHHHH-HHHHHHHHCCCCCHHHHHHH
Confidence            345566665 57888999998877665543


No 72 
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=43.07  E-value=6.9  Score=27.64  Aligned_cols=9  Identities=56%  Similarity=1.128  Sum_probs=7.6

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      .|||||.|.
T Consensus       166 ~QFHPEkS~  174 (192)
T PRK13142        166 IQFHPEKSG  174 (192)
T ss_pred             EecCcccCc
Confidence            489999975


No 73 
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional
Probab=42.04  E-value=7.5  Score=30.31  Aligned_cols=8  Identities=75%  Similarity=1.364  Sum_probs=7.0

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|||||++
T Consensus       350 VQFHPE~~  357 (382)
T CHL00197        350 VQYHPEAS  357 (382)
T ss_pred             EeeCCCCC
Confidence            69999984


No 74 
>smart00271 DnaJ DnaJ molecular chaperone homology domain.
Probab=41.77  E-value=27  Score=18.67  Aligned_cols=23  Identities=26%  Similarity=0.488  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHhhCccchh
Q 035343           16 EVLEAIRLIVINNLLQYHPESSS   38 (67)
Q Consensus        16 e~LE~IRlTIiNNll~yHPEsse   38 (67)
                      ...++||..--+=++++||....
T Consensus        13 ~~~~~ik~ay~~l~~~~HPD~~~   35 (60)
T smart00271       13 ASLDEIKKAYRKLALKYHPDKNP   35 (60)
T ss_pred             CCHHHHHHHHHHHHHHHCcCCCC
Confidence            45678888888888999998754


No 75 
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase. This model describes GlnD, the uridylyltransferase/uridylyl-removing enzyme for the nitrogen regulatory protein PII. Not all homologs of PII share the property of uridylyltransferase modification on the characteristic Tyr residue (see Prosite pattern PS00496 and document PDOC00439), but the modification site is preserved in the PII homolog of all species with a member of this family.
Probab=41.77  E-value=23  Score=29.33  Aligned_cols=27  Identities=15%  Similarity=0.148  Sum_probs=22.3

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVINNL   29 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiNNl   29 (67)
                      |||++.. |.|+++ ++++.|+..+++.+
T Consensus       823 F~v~~~~-g~~~~~-~~~~~l~~~L~~~l  849 (850)
T TIGR01693       823 FYVTDLF-GLKLTD-EEEQRLLEVLAASV  849 (850)
T ss_pred             EEEECCC-CCCCCH-HHHHHHHHHHHHHh
Confidence            6777665 889988 89999999998865


No 76 
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed
Probab=41.25  E-value=7.7  Score=29.78  Aligned_cols=9  Identities=67%  Similarity=1.136  Sum_probs=7.3

Q ss_pred             HHhhCccch
Q 035343           29 LLQYHPESS   37 (67)
Q Consensus        29 ll~yHPEss   37 (67)
                      =+|||||+.
T Consensus       335 gVQfHPE~~  343 (360)
T PRK12564        335 SVQYHPEAS  343 (360)
T ss_pred             EEEeCCcCC
Confidence            369999985


No 77 
>TIGR03582 EF_0829 PRD domain protein EF_0829/AHA_3910. Members of this family of relatively uncommon proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. This protein contains a PRD domain (see pfam00874). The function is unknown.
Probab=41.06  E-value=16  Score=24.32  Aligned_cols=32  Identities=19%  Similarity=0.292  Sum_probs=22.8

Q ss_pred             ceeecCCCCccC--CHHHHHHHHH---HHHHHHHhhC
Q 035343            2 MLVCSDTGRKVD--DPEVLEAIRL---IVINNLLQYH   33 (67)
Q Consensus         2 ~It~a~Tg~KV~--~~e~LE~IRl---TIiNNll~yH   33 (67)
                      .+.|+.|||++.  |++++++|..   .|-+.+++.+
T Consensus        50 ml~Rs~~GE~lp~vD~~Lf~EIs~~sl~la~~v~~~f   86 (107)
T TIGR03582        50 MVYRSTTGETLPEVDRSLFDEISKESIKLAEEVVAAL   86 (107)
T ss_pred             HHHHHHcCCcCCccCHHHHHHHHHHHHHHHHHHHHHh
Confidence            456889999985  9999999986   2334444443


No 78 
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed
Probab=40.74  E-value=7.8  Score=29.73  Aligned_cols=8  Identities=50%  Similarity=1.153  Sum_probs=6.7

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|||||+.
T Consensus       326 VQfHPE~~  333 (354)
T PRK12838        326 VQFHPEAH  333 (354)
T ss_pred             EEeCCCCC
Confidence            59999983


No 79 
>PF06226 DUF1007:  Protein of unknown function (DUF1007);  InterPro: IPR010412 This is a family of conserved bacterial proteins with unknown function.
Probab=40.69  E-value=35  Score=23.84  Aligned_cols=27  Identities=33%  Similarity=0.457  Sum_probs=23.6

Q ss_pred             CCCccCCHHHHHHHHHHHHHHHHhhCc
Q 035343            8 TGRKVDDPEVLEAIRLIVINNLLQYHP   34 (67)
Q Consensus         8 Tg~KV~~~e~LE~IRlTIiNNll~yHP   34 (67)
                      .+..+.+++.|.++.-.+++||-.||=
T Consensus        62 ~~dg~~~~~el~~l~~~~~~~l~~~~y   88 (212)
T PF06226_consen   62 DGDGKLDPEELAALAKEIFDNLKEYNY   88 (212)
T ss_pred             cccCCCCHHHHHHHHHHHHhhhhhcCc
Confidence            366788999999999999999998774


No 80 
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G. This model represents the G subunit (one of 14: A-N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This model excludes related subunits from formate dehydrogenase complexes.
Probab=40.59  E-value=26  Score=27.62  Aligned_cols=23  Identities=30%  Similarity=0.333  Sum_probs=21.6

Q ss_pred             CCHHHHHHHHHHHHHHHHhhCcc
Q 035343           13 DDPEVLEAIRLIVINNLLQYHPE   35 (67)
Q Consensus        13 ~~~e~LE~IRlTIiNNll~yHPE   35 (67)
                      ++++.+++.|..++.-||.-||-
T Consensus        72 t~~~~~~~~r~~~~e~ll~~h~~   94 (603)
T TIGR01973        72 TNSEKVKKAREGVMEFLLINHPL   94 (603)
T ss_pred             eCCHHHHHHHHHHHHHHHhcCCC
Confidence            57999999999999999999996


No 81 
>cd06257 DnaJ DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s, an important chaperonine family. Hsp40 proteins are characterized by the presence of a J domain, which mediates the interaction with Hsp70. They may contain other domains as well, and the architectures provide a means of classification.
Probab=40.41  E-value=29  Score=18.13  Aligned_cols=24  Identities=25%  Similarity=0.360  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHHHHHHhhCccchh
Q 035343           15 PEVLEAIRLIVINNLLQYHPESSS   38 (67)
Q Consensus        15 ~e~LE~IRlTIiNNll~yHPEsse   38 (67)
                      ....++||..--.=+.++||....
T Consensus        11 ~~~~~~ik~~y~~l~~~~HPD~~~   34 (55)
T cd06257          11 DASDEEIKKAYRKLALKYHPDKNP   34 (55)
T ss_pred             CCCHHHHHHHHHHHHHHHCcCCCC
Confidence            345678888887888999998764


No 82 
>PRK09065 glutamine amidotransferase; Provisional
Probab=39.45  E-value=9.7  Score=26.79  Aligned_cols=11  Identities=36%  Similarity=0.927  Sum_probs=8.6

Q ss_pred             HhhCccchhhh
Q 035343           30 LQYHPESSSQL   40 (67)
Q Consensus        30 l~yHPEsse~l   40 (67)
                      +|+|||....+
T Consensus       182 vQfHPE~~~~~  192 (237)
T PRK09065        182 VQFHPEFTAHI  192 (237)
T ss_pred             EEeCCcCCHHH
Confidence            69999986654


No 83 
>PTZ00173 60S ribosomal protein L10; Provisional
Probab=38.47  E-value=48  Score=24.80  Aligned_cols=19  Identities=26%  Similarity=0.326  Sum_probs=16.3

Q ss_pred             CCHHHHHHHHHHHHHHHHh
Q 035343           13 DDPEVLEAIRLIVINNLLQ   31 (67)
Q Consensus        13 ~~~e~LE~IRlTIiNNll~   31 (67)
                      ..++.||+.|.+|-.+|++
T Consensus        60 Iss~aLEAaRia~nr~l~K   78 (213)
T PTZ00173         60 ISSEALEAARISANKYMVK   78 (213)
T ss_pred             ccHHHHHHHHHHHHHhhhh
Confidence            4689999999999999844


No 84 
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional
Probab=37.81  E-value=9.4  Score=30.63  Aligned_cols=8  Identities=63%  Similarity=1.140  Sum_probs=6.4

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +||||||-
T Consensus       167 VQFHPEs~  174 (531)
T PRK09522        167 FQFHPESI  174 (531)
T ss_pred             EEecCccc
Confidence            68999964


No 85 
>cd07070 NR_LBD_SF-1 The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily. The ligand binding domain of nuclear receptor steroidogenic factor 1 (SF-1): SF-1, a member of the  nuclear hormone receptor superfamily, is an essential regulator of endocrine development and function and is considered a master regulator of reproduction. Most nuclear receptors function as homodimer or heterodimers, however SF-1 binds to its target genes as a monomer, recognizing the variations of the DNA sequence motif, T/CCA AGGTCA. SF-1 functions cooperatively with other transcription factors to modulate gene expression. Phospholipids have been determined as potential ligands of SF-1. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, SF-1 has  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=37.80  E-value=55  Score=23.06  Aligned_cols=31  Identities=13%  Similarity=0.310  Sum_probs=25.7

Q ss_pred             CccCCHHHHHHHHHHHHHHHHhh----Cccchhhh
Q 035343           10 RKVDDPEVLEAIRLIVINNLLQY----HPESSSQL   40 (67)
Q Consensus        10 ~KV~~~e~LE~IRlTIiNNll~y----HPEsse~l   40 (67)
                      .-+.++..+|.+|..+.+-|.+|    ||..+..+
T Consensus       160 ~gL~~~~~Ve~lQe~~~~aL~~y~~~~~p~~~~Rf  194 (237)
T cd07070         160 KFLNNHSLVKDAQEKANAALLDYTLCHYPHCGDKF  194 (237)
T ss_pred             cCCCCHHHHHHHHHHHHHHHHHHHHhcCCCcchHH
Confidence            35778899999999999999988    78776544


No 86 
>PF05763 DUF835:  Protein of unknown function (DUF835);  InterPro: IPR008553 The members of this archaebacterial protein entry are around 250-300 amino acid residues in length. The function of these proteins is not known.
Probab=37.58  E-value=39  Score=22.62  Aligned_cols=30  Identities=17%  Similarity=0.238  Sum_probs=25.1

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHHHHHh
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVINNLLQ   31 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiNNll~   31 (67)
                      ++||... |++-..|..|+.|..+|.+-|=+
T Consensus        44 iWlT~~~-~~~~I~Pt~L~~l~~~i~~fl~~   73 (136)
T PF05763_consen   44 IWLTKVE-GENAISPTNLHKLLDTIVRFLKE   73 (136)
T ss_pred             EEEeccC-CCCccCchhhHHHHHHHHHHHHh
Confidence            4678887 88999999999999998876655


No 87 
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=36.85  E-value=32  Score=23.09  Aligned_cols=16  Identities=38%  Similarity=0.928  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHhhCc
Q 035343           19 EAIRLIVINNLLQYHP   34 (67)
Q Consensus        19 E~IRlTIiNNll~yHP   34 (67)
                      +++|..+.+-++.|||
T Consensus       323 ~~~~~~~~~~~~~~~~  338 (338)
T cd07859         323 EDVRELIYREILEYHP  338 (338)
T ss_pred             HHHHHHHHHHHHhcCC
Confidence            6778888899999998


No 88 
>PF12229 PG_binding_4:  Putative peptidoglycan binding domain;  InterPro: IPR022029  This domain is found associated with the L,D-transpeptidase domain PF03734 from PFAM. The structure of this domain has been solved and shows a mixed alpha-beta fold composed of nine beta strands and four alpha helices. This domain is usually found to be duplicated. Therefore, it seems likely that this domain acts to bind the two unlinked peptidoglycan chains and bring them into close association so they can be cross linked by the transpeptidase domain. ; PDB: 2HKL_C 1ZAT_A.
Probab=36.83  E-value=19  Score=20.90  Aligned_cols=27  Identities=26%  Similarity=0.327  Sum_probs=18.3

Q ss_pred             ceeecCCCCccCCHHHHHHHHHHHHHH
Q 035343            2 MLVCSDTGRKVDDPEVLEAIRLIVINN   28 (67)
Q Consensus         2 ~It~a~Tg~KV~~~e~LE~IRlTIiNN   28 (67)
                      .|+....|++|......++|...|.++
T Consensus        83 ~i~~~~~G~~id~~~~~~~i~~al~~~  109 (114)
T PF12229_consen   83 TITPGQYGWKIDVDKLAEAIKKALKNG  109 (114)
T ss_dssp             EE---SS-EEE-HHHHHHHHHHHHHTT
T ss_pred             EEcCCcCeEEEcHHHHHHHHHHHHHcC
Confidence            467888999999999999998887664


No 89 
>cd07068 NR_LBD_ER_like The ligand binding domain of estrogen receptor and estrogen receptor-related receptors. The ligand binding domain of estrogen receptor (ER) and estrogen receptor-related receptors (ERRs): Estrogen receptors are a group of receptors which are activated by the hormone estrogen. Estrogen regulates many physiological processes including reproduction, bone integrity, cardiovascular health, and behavior. The main mechanism of action of the estrogen receptor is as a transcription factor by binding to the estrogen response element of target genes upon activation by estrogen and then recruiting coactivator proteins which are responsible for the transcription of target genes. Additionally some ERs may associate with other membrane proteins and can be rapidly activated by exposure of cells to estrogen.  ERRs are closely related to the estrogen receptor (ER) family. But, it lacks the ability to bind estrogen.  ERRs can interfere with the classic ER-mediated estrogen signalin
Probab=34.82  E-value=65  Score=22.08  Aligned_cols=27  Identities=19%  Similarity=0.469  Sum_probs=21.9

Q ss_pred             cCCHHHHHHHHHHHHHHHHhh----Cc-cchh
Q 035343           12 VDDPEVLEAIRLIVINNLLQY----HP-ESSS   38 (67)
Q Consensus        12 V~~~e~LE~IRlTIiNNll~y----HP-Esse   38 (67)
                      +.+++.+|.+|..+++-|.+|    || +...
T Consensus       146 L~~~~~V~~~q~~~~~aL~~y~~~~~~~~~~~  177 (221)
T cd07068         146 LEDREAVQQLRDAILDALVDVEAKRHGSQQPR  177 (221)
T ss_pred             ccCHHHHHHHHHHHHHHHHHHHHHhCCCcccc
Confidence            478999999999999999877    66 4433


No 90 
>PF00252 Ribosomal_L16:  Ribosomal protein L16p/L10e;  InterPro: IPR016180 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This entry represents a structural domain with an alpha/beta-hammerhead fold, where the beta-hammerhead motif is similar to that in barrel-sandwich hybrids. Domains of this structure can be found in ribosomal proteins L10e and L16. ; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005840 ribosome; PDB: 2ZJR_J 1Y69_K 3DLL_J 2ZJQ_J 2ZJP_J 3PIO_J 3CF5_J 3PIP_J 2ZKR_h 3J11_O ....
Probab=34.67  E-value=42  Score=22.19  Aligned_cols=19  Identities=26%  Similarity=0.253  Sum_probs=15.8

Q ss_pred             CCHHHHHHHHHHHHHHHHh
Q 035343           13 DDPEVLEAIRLIVINNLLQ   31 (67)
Q Consensus        13 ~~~e~LE~IRlTIiNNll~   31 (67)
                      ..+..||++|++|..+|=.
T Consensus        41 l~~~qlEa~R~~i~r~lkk   59 (133)
T PF00252_consen   41 LTSNQLEAARIAINRYLKK   59 (133)
T ss_dssp             EEHHHHHHHHHHHHHHHHH
T ss_pred             echhhhHHHHHHHHHHhhh
Confidence            4578999999999998843


No 91 
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine 
Probab=34.06  E-value=12  Score=24.40  Aligned_cols=6  Identities=83%  Similarity=1.608  Sum_probs=5.0

Q ss_pred             HhhCcc
Q 035343           30 LQYHPE   35 (67)
Q Consensus        30 l~yHPE   35 (67)
                      +|+|||
T Consensus       175 ~QfHPE  180 (188)
T cd01741         175 LQFHPE  180 (188)
T ss_pred             EccCch
Confidence            588998


No 92 
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms]
Probab=33.86  E-value=40  Score=27.98  Aligned_cols=24  Identities=29%  Similarity=0.621  Sum_probs=21.5

Q ss_pred             CHHHHHHHHHHHHHHHHhhCccch
Q 035343           14 DPEVLEAIRLIVINNLLQYHPESS   37 (67)
Q Consensus        14 ~~e~LE~IRlTIiNNll~yHPEss   37 (67)
                      ||+.+-++=.-||+|-++|-|+-+
T Consensus       339 D~DK~tQVldNii~NA~KYsP~Gg  362 (459)
T COG5002         339 DPDKMTQVLDNIISNALKYSPDGG  362 (459)
T ss_pred             ChhHHHHHHHHHHHHHhhcCCCCC
Confidence            788888899999999999999865


No 93 
>KOG0026 consensus Anthranilate synthase, beta chain [Amino acid transport and metabolism]
Probab=33.09  E-value=12  Score=28.30  Aligned_cols=8  Identities=63%  Similarity=1.132  Sum_probs=6.6

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +||||||-
T Consensus       191 VQfHPESI  198 (223)
T KOG0026|consen  191 VQFHPESI  198 (223)
T ss_pred             eeecchhh
Confidence            68999983


No 94 
>PF08469 NPHI_C:  Nucleoside triphosphatase I C-terminal;  InterPro: IPR013676 This viral domain is found to the C terminus of Poxvirus nucleoside triphosphatase phosphohydrolase I (NPH I) [] together with the helicase conserved C-terminal domain (IPR001650 from INTERPRO). ; GO: 0005524 ATP binding, 0017111 nucleoside-triphosphatase activity, 0006351 transcription, DNA-dependent
Probab=32.98  E-value=32  Score=24.65  Aligned_cols=32  Identities=19%  Similarity=0.299  Sum_probs=25.7

Q ss_pred             CceeecCCCCccCCHHHHHHHHH-----HHHHHHHhh
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRL-----IVINNLLQY   32 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRl-----TIiNNll~y   32 (67)
                      |.|-+..+|++-+|-++|+-||-     +.|+++|+.
T Consensus        15 FIiAr~~ng~~sVDedlldiIk~Kskef~qLf~vlK~   51 (148)
T PF08469_consen   15 FIIARLSNGRPSVDEDLLDIIKDKSKEFNQLFKVLKE   51 (148)
T ss_pred             EEEEEcCCCCcchHHHHHHHHHHHHHHHHHHHHHhHH
Confidence            45667899999999999999984     567777763


No 95 
>cd06929 NR_LBD_F1 Ligand-binding domain of nuclear receptor family 1. Ligand-binding domain (LBD) of nuclear receptor (NR) family 1:  This is one of the major subfamily of nuclear receptors, including thyroid receptor, retinoid acid receptor, ecdysone receptor, farnesoid X receptor, vitamin D receptor, and other related receptors. Nuclear receptors form a superfamily of ligand-activated transcription regulators, which regulate various physiological functions, from development, reproduction, to homeostasis and metabolism in animals (metazoans). The family contains not only receptors for known ligands but also orphan receptors for which ligands do not exist or have not been identified. NRs share a common structural organization with a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=32.81  E-value=93  Score=19.75  Aligned_cols=30  Identities=20%  Similarity=0.525  Sum_probs=23.9

Q ss_pred             ccCCHHHHHHHHHHHHHHHHhh----Cccchhhh
Q 035343           11 KVDDPEVLEAIRLIVINNLLQY----HPESSSQL   40 (67)
Q Consensus        11 KV~~~e~LE~IRlTIiNNll~y----HPEsse~l   40 (67)
                      .+.+++.++++|..+++-|.+|    ||+....+
T Consensus       120 ~l~~~~~v~~~q~~~~~aL~~y~~~~~~~~~~Rf  153 (174)
T cd06929         120 GLQDVDTVEKLQERLLEALQRYLKVNHPDAPQMF  153 (174)
T ss_pred             cCcCHHHHHHHHHHHHHHHHHHHHhcCCCChhHH
Confidence            5668999999999999999988    77544443


No 96 
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional
Probab=32.62  E-value=12  Score=25.32  Aligned_cols=9  Identities=33%  Similarity=0.781  Sum_probs=7.1

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|+|||.+.
T Consensus       167 ~QfHPE~~~  175 (189)
T PRK13525        167 TSFHPELTD  175 (189)
T ss_pred             EEeCCccCC
Confidence            689999754


No 97 
>PLN00210 40S ribosomal protein S16; Provisional
Probab=32.56  E-value=59  Score=22.43  Aligned_cols=21  Identities=24%  Similarity=0.332  Sum_probs=18.8

Q ss_pred             CHHHHHHHHHHHHHHHHhhCc
Q 035343           14 DPEVLEAIRLIVINNLLQYHP   34 (67)
Q Consensus        14 ~~e~LE~IRlTIiNNll~yHP   34 (67)
                      -+.+-++||+.|-.-|+.|+|
T Consensus        72 ~sgQa~Air~aiaraL~~~~~   92 (141)
T PLN00210         72 HTSQIYAIRQSIAKALVAYYQ   92 (141)
T ss_pred             HhHHHHHHHHHHHHHHHHhcc
Confidence            467889999999999999977


No 98 
>COG1701 Uncharacterized protein conserved in archaea [Function unknown]
Probab=32.55  E-value=47  Score=25.74  Aligned_cols=29  Identities=45%  Similarity=0.497  Sum_probs=24.9

Q ss_pred             CCCccCCHHHHHHHHHHHHHHHHhhCccch
Q 035343            8 TGRKVDDPEVLEAIRLIVINNLLQYHPESS   37 (67)
Q Consensus         8 Tg~KV~~~e~LE~IRlTIiNNll~yHPEss   37 (67)
                      -|||-.+|+ +|+||-..-.=||+.||-.|
T Consensus        47 iGEkT~~~A-~eA~raAaA~LlLAk~PVIS   75 (256)
T COG1701          47 IGEKTIPPA-LEAIRAAAAALLLAKHPVIS   75 (256)
T ss_pred             cccccCchH-HHHHHHHHHHHHhccCCeEE
Confidence            478877765 79999999999999999776


No 99 
>PRK07053 glutamine amidotransferase; Provisional
Probab=32.47  E-value=15  Score=26.06  Aligned_cols=11  Identities=45%  Similarity=0.872  Sum_probs=8.8

Q ss_pred             HhhCccchhhh
Q 035343           30 LQYHPESSSQL   40 (67)
Q Consensus        30 l~yHPEsse~l   40 (67)
                      +|+|||.+...
T Consensus       174 ~QfHpE~~~~~  184 (234)
T PRK07053        174 LQFHPEAREDR  184 (234)
T ss_pred             EeeCccCCHHH
Confidence            69999987653


No 100
>cd06932 NR_LBD_PPAR The ligand binding domain of peroxisome proliferator-activated receptors. The ligand binding domain (LBD) of peroxisome proliferator-activated receptors (PPAR):  Peroxisome proliferator-activated receptors (PPARs) are members of the nuclear receptor superfamily of ligand-activated transcription factors. PPARs play important roles in regulating cellular differentiation, development and lipid metabolism. Activated PPAR forms a heterodimer with the retinoid X receptor (RXR) that binds to the hormone response element located upstream of the peroxisome proliferator responsive genes and interacts with co-activators. There are three subtypes of peroxisome proliferator activated receptors, alpha, beta (or delta), and gamma, each with a distinct tissue distribution. Several essential fatty acids, oxidized lipids and prostaglandin J derivatives can bind and activate PPAR.  Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, P
Probab=32.37  E-value=71  Score=23.01  Aligned_cols=30  Identities=23%  Similarity=0.268  Sum_probs=24.6

Q ss_pred             CccCCHHHHHHHHHHHHHHHHhh----Cccchhh
Q 035343           10 RKVDDPEVLEAIRLIVINNLLQY----HPESSSQ   39 (67)
Q Consensus        10 ~KV~~~e~LE~IRlTIiNNll~y----HPEsse~   39 (67)
                      .-+.+++.+|++|-.+++-|-.|    ||+....
T Consensus       181 ~gL~~~~~Ve~lQe~~~~aL~~~i~~~~p~~~~r  214 (259)
T cd06932         181 PGLINRKPVERIQEHVLQALELQLKKNHPDSPQL  214 (259)
T ss_pred             ccCcCHHHHHHHHHHHHHHHHHHHhhhCCCcccH
Confidence            34789999999999999998877    8876443


No 101
>cd07069 NR_LBD_Lrh-1 The ligand binding domain of the liver receptor homolog-1, a member of  nuclear receptor superfamily,. The ligand binding domain (LBD) of the liver receptor homolog-1 (LRH-1): LRH-1 belongs to nuclear hormone receptor superfamily, and is expressed mainly in the liver, intestine, exocrine pancreas, and ovary. Most nuclear receptors function as homodimer or heterodimers. However, LRH-1 binds DNA as a monomer, and is a regulator of bile-acid homeostasis, steroidogenesis, reverse cholesterol transport and the initial stages of embryonic development. Recently, phospholipids have been identified as potential ligand for LRH-1 and steroidogenic factor-1 (SF-1).  Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, LRH-1 has  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=32.32  E-value=80  Score=22.45  Aligned_cols=30  Identities=20%  Similarity=0.470  Sum_probs=25.3

Q ss_pred             ccCCHHHHHHHHHHHHHHHHhh----Cccchhhh
Q 035343           11 KVDDPEVLEAIRLIVINNLLQY----HPESSSQL   40 (67)
Q Consensus        11 KV~~~e~LE~IRlTIiNNll~y----HPEsse~l   40 (67)
                      -+.+++.+|++|-++++-|-.|    ||+....+
T Consensus       163 gL~~~~~Ve~lQe~~~~aL~~yi~~~~p~~~~Rf  196 (241)
T cd07069         163 NLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKF  196 (241)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHhcCCCchhHH
Confidence            4788999999999999999887    78876654


No 102
>PF03914 CBF:  CBF/Mak21 family;  InterPro: IPR005612 This domain is present in the CAATT-binding protein which is essential for growth and necessary for 60S ribosomal subunit biogenesis. Other proteins containing this domain stimulate transcription from the HSP70 promoter.
Probab=32.22  E-value=37  Score=22.31  Aligned_cols=24  Identities=33%  Similarity=0.369  Sum_probs=19.7

Q ss_pred             HHHHHHHHhhCccchhhhhccccc
Q 035343           23 LIVINNLLQYHPESSSQLAMGVTF   46 (67)
Q Consensus        23 lTIiNNll~yHPEsse~la~G~~f   46 (67)
                      +.+|.+||+.||+...-+...+..
T Consensus        87 L~~i~~ll~~~p~l~~ll~~~~~~  110 (164)
T PF03914_consen   87 LALIRKLLKRHPNLKSLLDNEEKK  110 (164)
T ss_pred             HHHHHHHHHHCHHHHHHhcCCccc
Confidence            678999999999888888766654


No 103
>PRK08250 glutamine amidotransferase; Provisional
Probab=32.22  E-value=15  Score=25.88  Aligned_cols=11  Identities=27%  Similarity=0.292  Sum_probs=8.6

Q ss_pred             HhhCccchhhh
Q 035343           30 LQYHPESSSQL   40 (67)
Q Consensus        30 l~yHPEsse~l   40 (67)
                      +|+|||.....
T Consensus       176 ~QfHPE~~~~~  186 (235)
T PRK08250        176 FQCHMEFTVEA  186 (235)
T ss_pred             EeecCcCCHHH
Confidence            69999987654


No 104
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis. Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis. Glutamine amidotransferase (GATase) activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate.  This group contains proteins like Bacillus subtilus YaaE  and Plasmodium falciparum Pdx2 which are members of the triad glutamine aminotransferase family and function in a pathway for the biosynthesis of vitamin B6.
Probab=32.04  E-value=13  Score=24.79  Aligned_cols=10  Identities=30%  Similarity=0.733  Sum_probs=7.4

Q ss_pred             HhhCccchhh
Q 035343           30 LQYHPESSSQ   39 (67)
Q Consensus        30 l~yHPEsse~   39 (67)
                      +|+|||.+..
T Consensus       166 ~qfHPE~~~~  175 (183)
T cd01749         166 TSFHPELTDD  175 (183)
T ss_pred             EEcCCccCCC
Confidence            5899996643


No 105
>cd06951 NR_LBD_Dax1_like The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain. The ligand binding domain of DAX1-like proteins: This orphan nuclear receptor family includes  DAX1 (dosage-sensitive sex reversal adrenal hypoplasia congenita critical region on chromosome X gene 1) and the Small Heterodimer Partner (SHP). Both receptors have a typical ligand binding domain, but lack the DNA binding domain, typical to almost all of the nuclear receptors. They function as a transcriptional coregulator by directly interacting with other nuclear receptors. DAX1 and SHP can form heterodimers with each other, as well as with many other nuclear receptors. In addition, DAX1 can also form homodimers. DAX1 plays an important role in the normal development of several hormone-producing tissues.  SHP has shown to regulate a variety of target genes.
Probab=31.98  E-value=72  Score=22.33  Aligned_cols=29  Identities=17%  Similarity=0.162  Sum_probs=23.8

Q ss_pred             ccCCHHHHHHHHHHHHHHHHhh----Cccchhhh
Q 035343           11 KVDDPEVLEAIRLIVINNLLQY----HPESSSQL   40 (67)
Q Consensus        11 KV~~~e~LE~IRlTIiNNll~y----HPEsse~l   40 (67)
                      -+ +++.+|++|-.+++-|-+|    ||+....+
T Consensus       152 gl-~~~~Ve~lQe~~~~aL~~yi~~~~p~~~~Rf  184 (222)
T cd06951         152 LL-CPHYIEALQKEAQQALNEHTMMTRPLEQLRS  184 (222)
T ss_pred             cc-CHHHHHHHHHHHHHHHHHHHHhhCCCcccHH
Confidence            35 8999999999999999877    78766553


No 106
>PRK01759 glnD PII uridylyl-transferase; Provisional
Probab=31.61  E-value=53  Score=27.75  Aligned_cols=28  Identities=7%  Similarity=0.138  Sum_probs=22.6

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVINNLL   30 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiNNll   30 (67)
                      |||++. .|.++. +++++.||.+|...|-
T Consensus       722 F~V~d~-~g~~~~-~~~~~~l~~~L~~aL~  749 (854)
T PRK01759        722 FIVTEL-NGKLLE-FDRRRQLEQALTKALN  749 (854)
T ss_pred             EEEeCC-CCCCCC-HHHHHHHHHHHHHHHc
Confidence            688886 677884 7899999999877774


No 107
>cd06934 NR_LBD_PXR_like The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor. The ligand binding domain of xenobiotic receptors: This xenobiotic receptor family includes pregnane X receptor (PXR), constitutive androstane receptor (CAR) and other related nuclear receptors.  They function as sensors of toxic byproducts of cell metabolism and of exogenous chemicals, to facilitate their elimination. The nuclear receptor pregnane X receptor (PXR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. The ligand binding domain of PXR shows remarkable flexibility to accommodate both large and small molecules. PXR functions as a heterodimer with retinoic X receptor-alpha (RXRa) and binds to a variety of response elements in the promoter regions of a diverse set of target genes involved in the metabolism, transport, and elimination of
Probab=31.42  E-value=69  Score=22.41  Aligned_cols=27  Identities=19%  Similarity=0.347  Sum_probs=23.4

Q ss_pred             CccCCHHHHHHHHHHHHHHHHhh----Cccc
Q 035343           10 RKVDDPEVLEAIRLIVINNLLQY----HPES   36 (67)
Q Consensus        10 ~KV~~~e~LE~IRlTIiNNll~y----HPEs   36 (67)
                      .-+.+++.+|++|-.+++.|-.|    ||..
T Consensus       152 ~gL~~~~~Ve~lQe~~~~aL~~yi~~~~p~~  182 (226)
T cd06934         152 PGVTQHDVIDQLQEKMALTLKSYIDSKRPGP  182 (226)
T ss_pred             cCCcChHHHHHHHHHHHHHHHHHHHHcCCCC
Confidence            45789999999999999999988    8754


No 108
>cd06944 NR_LBD_Ftz-F1_like The ligand binding domain of FTZ-F1 like nuclear receptors. The ligand binding domain of FTZ-F1 like nuclear receptors: This nuclear receptor family includes at least three subgroups of receptors that function in embryo development and differentiation, and other processes. FTZ-F1 interacts with the cis-acting DNA motif of ftz gene, which required at several stages of development. Particularly, FTZ-F1 genes are strongly linked to steroid biosynthesis and sex-determination; LRH-1 is a regulator of bile-acid homeostasis, steroidogenesis, reverse cholesterol transport and the initial stages of embryonic development. SF-1 is an essential regulator of endocrine development and function and is considered a master regulator of reproduction; SF-1 functions cooperatively with other transcription factors to modulate gene expression. Phospholipids have been identified as potential ligand for LRH-1 and steroidogenic factor-1 (SF-1). However, the ligand for FTZ-F1 has not 
Probab=31.26  E-value=79  Score=22.15  Aligned_cols=28  Identities=21%  Similarity=0.515  Sum_probs=23.2

Q ss_pred             cCCHHHHHHHHHHHHHHHHhh----Cccchhh
Q 035343           12 VDDPEVLEAIRLIVINNLLQY----HPESSSQ   39 (67)
Q Consensus        12 V~~~e~LE~IRlTIiNNll~y----HPEsse~   39 (67)
                      +.+++.+|.+|-.+.+-|.+|    ||+.+..
T Consensus       162 L~~~~~Ve~~q~~~~~aL~~y~~~~~~~~~~R  193 (237)
T cd06944         162 LENRQLVESVQEQVNAALLDYTLCNYPQQTDK  193 (237)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHhhCCCCccH
Confidence            567899999999999999988    7776543


No 109
>cd06953 NR_LBD_DHR4_like The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4. The ligand binding domain of Ecdysone-induced receptor DHR4: Ecdysone-induced orphan receptor DHR4 is a member of the nuclear receptor family. DHR4 is expressed during the early Drosophila larval development and is induced by ecdysone. DHR4 coordinates growth and maturation in Drosophila by mediating endocrine response to the attainment of proper body size during larval development. Mutations in DHR4 result in shorter larval development which translates into smaller and lighter flies. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR4  has  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=31.06  E-value=88  Score=21.57  Aligned_cols=29  Identities=14%  Similarity=0.250  Sum_probs=23.2

Q ss_pred             ccCCHHHHHHHHHHHHHHHHhh----Cccchhh
Q 035343           11 KVDDPEVLEAIRLIVINNLLQY----HPESSSQ   39 (67)
Q Consensus        11 KV~~~e~LE~IRlTIiNNll~y----HPEsse~   39 (67)
                      -+.+++.+|.+|..+.+-|.+|    ||.....
T Consensus       149 gLs~~~~Ve~lQ~~~~~aL~~y~~~~~~~~p~R  181 (213)
T cd06953         149 GLTNASQLESLQKRYWYVLQDFTELNYPNQPNR  181 (213)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHhCCCcchH
Confidence            5678889999999999998877    6665444


No 110
>cd06937 NR_LBD_RAR The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily. The ligand binding domain (LBD) of retinoic acid receptor (RAR): Retinoic acid receptors are members of the nuclear receptor (NR) superfamily of ligand-regulated transcription factors. RARs mediate the biological effect of retinoids, including both naturally dietary vitamin A (retinol) metabolites and active synthetic analogs. Retinoids play key roles in a wide variety of essential biological processes, such as vertebrate embryonic morphogenesis and organogenesis, differentiation and apoptosis, and homeostasis. RARs function as heterodimers with retinoic X receptors by binding to specific RAR response elements (RAREs) found in the promoter regions of retinoid target genes. In the absence of ligand, the RAR-RXR heterodimer recruits the corepressor proteins NCoR or AMRT, and associated factors such as histone deacetylases or DNA-methyltransferases, leading to
Probab=30.67  E-value=83  Score=22.10  Aligned_cols=30  Identities=17%  Similarity=0.496  Sum_probs=24.5

Q ss_pred             CccCCHHHHHHHHHHHHHHHHhh----Cccchhh
Q 035343           10 RKVDDPEVLEAIRLIVINNLLQY----HPESSSQ   39 (67)
Q Consensus        10 ~KV~~~e~LE~IRlTIiNNll~y----HPEsse~   39 (67)
                      ..+.+++.+|++|-.+++-|-.|    ||+....
T Consensus       155 ~gL~~~~~Ve~lQe~~~~aL~~yi~~~~p~~p~r  188 (231)
T cd06937         155 QDLEEPDRVEKLQEPLLEALKIYARKRRPDKPHM  188 (231)
T ss_pred             ccCCCHHHHHHHHHHHHHHHHHHHHhhCCCcccH
Confidence            45789999999999999988876    7876444


No 111
>cd06941 NR_LBD_DmE78_like The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily. The ligand binding domain (LBD) of Drosophila ecdysone-induced protein 78 (E78) like: Drosophila ecdysone-induced protein 78 (E78) is a transcription factor belonging to the nuclear receptor superfamily.  E78 is a product of the ecdysone-inducible gene found in an early late puff locus at position 78C during the onset of Drosophila metamorphosis. Two isoforms of E78, E78A and E78B, are expressed from two nested transcription units. An E78 orthologue from the Platyhelminth Schistosoma mansoni (SmE78) has also been identified. It is the first E78 orthologue known outside of the molting animals--the Ecdysozoa. SmE78 may be involved in transduction of an ecdysone signal in S. mansoni, consistent with its function in Drosophila.  Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, E78-like receptors ha
Probab=30.65  E-value=88  Score=20.88  Aligned_cols=28  Identities=14%  Similarity=0.300  Sum_probs=21.9

Q ss_pred             ccCCHHHHHHHHHHHHHHHHhh----Cccchh
Q 035343           11 KVDDPEVLEAIRLIVINNLLQY----HPESSS   38 (67)
Q Consensus        11 KV~~~e~LE~IRlTIiNNll~y----HPEsse   38 (67)
                      -+.+++.+|++|..+++-|-.|    ||+...
T Consensus       120 gl~~~~~Ve~lq~~~~~aL~~~i~~~~p~~~~  151 (195)
T cd06941         120 GLSEPKKVAILQDRVLEALKVQVSRNRPAEAQ  151 (195)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHhhCCCccc
Confidence            4678999999999999888666    676533


No 112
>PRK09203 rplP 50S ribosomal protein L16; Reviewed
Probab=30.63  E-value=51  Score=22.28  Aligned_cols=18  Identities=17%  Similarity=0.239  Sum_probs=15.8

Q ss_pred             cCCHHHHHHHHHHHHHHH
Q 035343           12 VDDPEVLEAIRLIVINNL   29 (67)
Q Consensus        12 V~~~e~LE~IRlTIiNNl   29 (67)
                      -..++.||++|.+|..+|
T Consensus        41 ~i~~~qlEaaR~~i~r~L   58 (138)
T PRK09203         41 WITARQIEAARIAMTRHI   58 (138)
T ss_pred             eEcHHHHHHHHHHHHHHh
Confidence            457899999999998887


No 113
>PF06628 Catalase-rel:  Catalase-related immune-responsive;  InterPro: IPR010582 Catalases (1.11.1.6 from EC) are antioxidant enzymes that catalyse the conversion of hydrogen peroxide to water and molecular oxygen, serving to protect cells from its toxic effects []. Hydrogen peroxide is produced as a consequence of oxidative cellular metabolism and can be converted to the highly reactive hydroxyl radical via transition metals, this radical being able to damage a wide variety of molecules within a cell, leading to oxidative stress and cell death. Catalases act to neutralise hydrogen peroxide toxicity, and are produced by all aerobic organisms ranging from bacteria to man. Most catalases are mono-functional, haem-containing enzymes, although there are also bifunctional haem-containing peroxidase/catalases (IPR000763 from INTERPRO) that are closely related to plant peroxidases, and non-haem, manganese-containing catalases (IPR007760 from INTERPRO) that are found in bacteria []. This entry represents a small conserved region within catalase enzymes that carries the immune-responsive amphipathic octa-peptide that is recognised by T cells [].; PDB: 2CAH_A 1NM0_A 1H7K_A 1E93_A 1H6N_A 3HB6_A 2CAG_A 1M85_A 1MQF_A 1A4E_C ....
Probab=30.52  E-value=39  Score=19.87  Aligned_cols=24  Identities=17%  Similarity=0.288  Sum_probs=19.8

Q ss_pred             HHHHHHHHHHHhhCccchhhhhcc
Q 035343           20 AIRLIVINNLLQYHPESSSQLAMG   43 (67)
Q Consensus        20 ~IRlTIiNNll~yHPEsse~la~G   43 (67)
                      +||-..|.++-+-+||-++.++.|
T Consensus        43 ~i~~r~l~~f~~vd~~lg~~v~~~   66 (68)
T PF06628_consen   43 EIQERVLAYFYKVDPDLGQRVAEA   66 (68)
T ss_dssp             HHHHHHHHHHHHH-HHHHHHHHHH
T ss_pred             hHHHHHHHHHHHhCHHHHHHHHHH
Confidence            388889999999999999998865


No 114
>PF10523 BEN:  BEN domain;  InterPro: IPR018379 The BEN domain is found in diverse proteins including:    SMAR1 (Scaffold/Matrix attachment region-binding protein 1; also known as BANP), a tumour-suppressor MAR-binding protein that down-regulates Cyclin D1 expression by recruiting HDAC1-mSin3A co-repressor complex at Cyclin D1 promoter locus; SMAR1 is the target of prostaglandin A2 (PGA2) induced growth arrest [, ].  NAC1, a novel member of the POZ/BTB (Pox virus and Zinc finger/Bric-a-bracTramtrack Broad complex), but which varies from other proteins of this class in that it lacks the characteristic DNA-binding motif [].  Mod(mdg4) isoform C, the modifier of the mdg4 locus in Drosophila melanogaster (Fruit fly), where mdg4 encodes chromatin proteins which are involved in position effect variegation, establishment of chromatin boundaries, nerve path finding, meiotic chromosome pairing and apoptosis []. Trans-splicing of Mod(mdg4) produces at least 26 transcripts.  E5R protein from Chordopoxvirus virosomes, which is found in cytoplasmic sites of viral DNA replication []. Several proteins of polydnaviruses.   The BEN domain is predicted to function as an adaptor for the higher-order structuring of chromatin, and recruitment of chromatin modifying factors in transcriptional regulation. It has been suggested to mediate protein-DNA and protein-protein interactions during chromatin organisation and transcription. The presence of BEN domains in a poxviral early virosomal protein and in polydnaviral proteins also suggests a possible role in the organisation of viral DNA during replication or transcription. They are generally linked to other globular domains with functions related to transcriptional regulation and chromatin structure, such as BTB, C4DM, and C2H2 fingers []. This domain is predicted to form an all-alpha fold with four conserved helices. Its conservation pattern revealed several conserved residues, most of which have hydrophobic side-chains and are likely to stabilise the fold through helix-helix packing [].
Probab=29.40  E-value=98  Score=17.43  Aligned_cols=22  Identities=36%  Similarity=0.437  Sum_probs=16.5

Q ss_pred             CCCCccCCHHHHHHHHHHHHHH
Q 035343            7 DTGRKVDDPEVLEAIRLIVINN   28 (67)
Q Consensus         7 ~Tg~KV~~~e~LE~IRlTIiNN   28 (67)
                      ..++..-||..|.+||-.|...
T Consensus        32 ~~~k~~Ld~~kl~~I~~~v~~~   53 (79)
T PF10523_consen   32 SPGKPQLDPNKLSAIRNYVEER   53 (79)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHH
Confidence            3567778899998888877654


No 115
>PF06743 FAST_1:  FAST kinase-like protein, subdomain 1;  InterPro: IPR010622 This entry represents a conserved region of eukaryotic Fas-activated serine/threonine (FAST) kinases that contains several conserved leucine residues. FAST kinase is rapidly activated during Fas-mediated apoptosis, when it phosphorylates TIA-1, a nuclear RNA-binding protein that has been implicated as an effector of apoptosis []. Note that many family members are hypothetical proteins.; GO: 0004672 protein kinase activity
Probab=29.40  E-value=8.2  Score=22.87  Aligned_cols=32  Identities=19%  Similarity=0.421  Sum_probs=22.0

Q ss_pred             HhhCccchhhhh------cccccCCCCCccccceeeec
Q 035343           30 LQYHPESSSQLA------MGVTFGVDPPKQQVFAFWSY   61 (67)
Q Consensus        30 l~yHPEsse~la------~G~~fg~~pp~k~vd~~~~~   61 (67)
                      |.|+|..++++-      ....++.-+|...|+.-||.
T Consensus        11 LNy~P~~~~~f~~~~~~~L~~~l~~~~p~~ll~~v~Sl   48 (71)
T PF06743_consen   11 LNYQPPNAEEFFEKLIERLESYLDEFSPEDLLDLVWSL   48 (71)
T ss_pred             cCCCCCCHHHHHHHHHHHHHHhcccCCHHHHHHHHHHH
Confidence            568888877652      23445566688888888874


No 116
>cd06948 NR_LBD_COUP-TF Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family. The ligand binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs): COUP-TFs are orphan members of the steroid/thyroid hormone receptor superfamily. They are expressed in many tissues and are involved in the regulation of several important biological processes, such as neurogenesis, organogenesis, cell fate determination, and metabolic homeostasis. In mammals two isoforms named COUP-TFI and COUP-TFII have been identified. Both genes show an exceptional homology and overlapping expression patterns, suggesting that they may serve redundant functions. Although COUP-TF was originally characterized as a transcriptional activator of the chicken ovalbumin gene, COUP-TFs are generally considered to be repressors of transcription for other nuclear hormone receptors, such as retinoic acid receptor (RAR), thyroid hormone
Probab=29.18  E-value=91  Score=21.78  Aligned_cols=29  Identities=21%  Similarity=0.392  Sum_probs=23.6

Q ss_pred             ccCCHHHHHHHHHHHHHHHHhh----Cccchhh
Q 035343           11 KVDDPEVLEAIRLIVINNLLQY----HPESSSQ   39 (67)
Q Consensus        11 KV~~~e~LE~IRlTIiNNll~y----HPEsse~   39 (67)
                      .+.+.+.+|.+|-.+++.|.+|    ||.....
T Consensus       150 ~L~~~~~v~~~q~~~~~aL~~y~~~~~~~~~~R  182 (236)
T cd06948         150 GLSDPAHIESLQEKSQCALEEYVRTQYPNQPTR  182 (236)
T ss_pred             cccCHHHHHHHHHHHHHHHHHHHHHhCCCcccH
Confidence            5678889999999999999987    7765443


No 117
>KOG1224 consensus Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis]
Probab=29.18  E-value=15  Score=31.89  Aligned_cols=8  Identities=88%  Similarity=1.335  Sum_probs=6.6

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +||||||-
T Consensus       194 ~qyHPES~  201 (767)
T KOG1224|consen  194 LQYHPESI  201 (767)
T ss_pred             eeeChHHh
Confidence            68999984


No 118
>PRK09129 NADH dehydrogenase subunit G; Validated
Probab=29.18  E-value=53  Score=26.73  Aligned_cols=23  Identities=26%  Similarity=0.199  Sum_probs=21.4

Q ss_pred             CCHHHHHHHHHHHHHHHHhhCcc
Q 035343           13 DDPEVLEAIRLIVINNLLQYHPE   35 (67)
Q Consensus        13 ~~~e~LE~IRlTIiNNll~yHPE   35 (67)
                      ++++.+.+.|.+++.=||.-||.
T Consensus        74 t~~~~~~~~r~~~l~~ll~~h~~   96 (776)
T PRK09129         74 TRSEKALKAQKSVMEFLLINHPL   96 (776)
T ss_pred             cCCHHHHHHHHHHHHHHHhcCCC
Confidence            47899999999999999999995


No 119
>cd06931 NR_LBD_HNF4_like The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes. The ligand binding domain of hepatocyte nuclear factor 4 (HNF4) like proteins: HNF4 is a member of the nuclear receptor superfamily. HNF4 plays a key role in establishing and maintenance of hepatocyte differentiation in the liver. It is also expressed in gut, kidney, and pancreatic beta cells. HNF4 was originally classified as an orphan receptor, but later it is found that HNF4 binds with very high affinity to a variety of fatty acids. However, unlike other nuclear receptors, the ligands do not act as a molecular switch for HNF4. They seem to constantly bind to the receptor, which is constitutively active as a transcription activator. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, HNF4  has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal lig
Probab=29.17  E-value=1.2e+02  Score=20.54  Aligned_cols=31  Identities=23%  Similarity=0.458  Sum_probs=23.9

Q ss_pred             CCccCCHHHHHHHHHHHHHHHHhh----Cccchhh
Q 035343            9 GRKVDDPEVLEAIRLIVINNLLQY----HPESSSQ   39 (67)
Q Consensus         9 g~KV~~~e~LE~IRlTIiNNll~y----HPEsse~   39 (67)
                      ...+.+++..+.+|..+++-|.+|    ||+.+..
T Consensus       148 ~~~ls~~~~i~~~r~~~~~aL~~y~~~~~~~~~~R  182 (222)
T cd06931         148 AKGLSDPQKIKRLRFQVQVSLEDYINDRQYDSRGR  182 (222)
T ss_pred             ccCCCCHHHHHHHHHHHHHHHHHHHHhcCCchhhH
Confidence            457888999999999999888875    5555443


No 120
>PLN02889 oxo-acid-lyase/anthranilate synthase
Probab=29.17  E-value=16  Score=31.94  Aligned_cols=7  Identities=86%  Similarity=1.483  Sum_probs=6.4

Q ss_pred             HhhCccc
Q 035343           30 LQYHPES   36 (67)
Q Consensus        30 l~yHPEs   36 (67)
                      +||||||
T Consensus       312 VQfHPES  318 (918)
T PLN02889        312 LQFHPES  318 (918)
T ss_pred             EEeCCcc
Confidence            6999998


No 121
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription]
Probab=28.82  E-value=46  Score=27.36  Aligned_cols=37  Identities=30%  Similarity=0.487  Sum_probs=28.3

Q ss_pred             CCccCCHHHHHHHHHHHHHHHHhhCccchhhhhccccc
Q 035343            9 GRKVDDPEVLEAIRLIVINNLLQYHPESSSQLAMGVTF   46 (67)
Q Consensus         9 g~KV~~~e~LE~IRlTIiNNll~yHPEsse~la~G~~f   46 (67)
                      |.=-.-.|-.+++||| ++|.+.|.|+...--+||..+
T Consensus       277 ~~Y~~~~eF~~DVRL~-F~Ncm~YNp~g~dV~~Ma~~L  313 (640)
T KOG1474|consen  277 GEYKSAEEFAADVRLT-FDNCMTYNPEGSDVYAMAKKL  313 (640)
T ss_pred             cccCCHHHHHHHHHHH-HHHHHhcCCCCCHHHHHHHHH
Confidence            3333445678899975 689999999999988888643


No 122
>PF02852 Pyr_redox_dim:  Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain;  InterPro: IPR004099 This entry represents a dimerisation domain that is usually found at the C-terminal of both class I and class II oxidoreductases, as well as in NADH oxidases and peroxidases [, , ].; GO: 0016491 oxidoreductase activity, 0050660 flavin adenine dinucleotide binding, 0045454 cell redox homeostasis, 0055114 oxidation-reduction process, 0005737 cytoplasm; PDB: 3II4_B 2A8X_A 2BC0_B 2BC1_B 2W0H_A 2X50_B 2JK6_A 2YAU_A 2EQ9_E 2EQ6_B ....
Probab=28.58  E-value=24  Score=21.35  Aligned_cols=16  Identities=25%  Similarity=0.505  Sum_probs=13.1

Q ss_pred             HHHHHhhCccchhhhh
Q 035343           26 INNLLQYHPESSSQLA   41 (67)
Q Consensus        26 iNNll~yHPEsse~la   41 (67)
                      +.+++.+||..+|.|.
T Consensus        92 l~~~~~~~Pt~se~~~  107 (110)
T PF02852_consen   92 LADDIFYHPTFSEAIQ  107 (110)
T ss_dssp             HHTSBSSSTSTGHHHH
T ss_pred             HhCCeeeCCChhHHHH
Confidence            5567889999999875


No 123
>PLN02347 GMP synthetase
Probab=28.47  E-value=17  Score=29.38  Aligned_cols=9  Identities=67%  Similarity=1.184  Sum_probs=7.4

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|||||++.
T Consensus       179 vQFHPE~~~  187 (536)
T PLN02347        179 LQYHPEVTH  187 (536)
T ss_pred             EEccCCCCc
Confidence            799999853


No 124
>TIGR01164 rplP_bact ribosomal protein L16, bacterial/organelle. This model describes bacterial and organellar ribosomal protein L16. The homologous protein of the eukaryotic cytosol is designated L10
Probab=28.35  E-value=62  Score=21.55  Aligned_cols=19  Identities=16%  Similarity=0.109  Sum_probs=15.9

Q ss_pred             cCCHHHHHHHHHHHHHHHH
Q 035343           12 VDDPEVLEAIRLIVINNLL   30 (67)
Q Consensus        12 V~~~e~LE~IRlTIiNNll   30 (67)
                      -..++.||+.|.+|..+|-
T Consensus        40 ~i~~~qlEaaR~~i~r~l~   58 (126)
T TIGR01164        40 WITARQIEAARVAMTRYVK   58 (126)
T ss_pred             eEcHHHHHHHHHHHHHHHh
Confidence            3468999999999988884


No 125
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2. Pyridoxal 5'-phosphate (PLP) is synthesized by the PdxA/PdxJ pathway in some species (mostly within the gamma subdivision of the proteobacteria) and by the Pdx1/Pdx2 pathway in most other organisms. This family describes Pdx2, the glutaminase subunit of the PLP synthase.
Probab=27.42  E-value=17  Score=24.72  Aligned_cols=9  Identities=33%  Similarity=0.752  Sum_probs=7.0

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|+|||.+.
T Consensus       166 vQfHPE~~~  174 (184)
T TIGR03800       166 SSFHPELTD  174 (184)
T ss_pred             EEeCCccCC
Confidence            589999764


No 126
>PF06348 DUF1059:  Protein of unknown function (DUF1059);  InterPro: IPR009409 This entry consists of short hypothetical archaeal and bacterial proteins of unknown function.
Probab=27.28  E-value=70  Score=18.57  Aligned_cols=17  Identities=29%  Similarity=0.264  Sum_probs=13.7

Q ss_pred             CCccCCHHHHHHHHHHH
Q 035343            9 GRKVDDPEVLEAIRLIV   25 (67)
Q Consensus         9 g~KV~~~e~LE~IRlTI   25 (67)
                      |..-..+|+++.||..|
T Consensus        38 g~~~~~~el~~~ir~~I   54 (57)
T PF06348_consen   38 GMTEIPEELREKIRSAI   54 (57)
T ss_pred             CCccCCHHHHHHHHHHh
Confidence            55556789999999877


No 127
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional
Probab=26.95  E-value=18  Score=24.32  Aligned_cols=9  Identities=33%  Similarity=0.767  Sum_probs=6.5

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|+|||...
T Consensus       177 ~QfHPE~~~  185 (200)
T PRK13527        177 TAFHPELTD  185 (200)
T ss_pred             EEeCCCCCC
Confidence            588999653


No 128
>PRK05007 PII uridylyl-transferase; Provisional
Probab=26.91  E-value=73  Score=27.07  Aligned_cols=31  Identities=16%  Similarity=0.240  Sum_probs=24.1

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHHHHHHhhC
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVINNLLQYH   33 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIiNNll~yH   33 (67)
                      |+|++. .|.++ .+++++.||.+|.+.|-...
T Consensus       746 F~V~d~-~g~~~-~~~~~~~I~~~L~~aL~~~~  776 (884)
T PRK05007        746 FIVLEP-DGSPL-SQDRHQVIRKALEQALTQSS  776 (884)
T ss_pred             EEEECC-CCCCC-CHHHHHHHHHHHHHHHcCCC
Confidence            567775 56778 47899999999999886643


No 129
>PRK00275 glnD PII uridylyl-transferase; Provisional
Probab=26.82  E-value=73  Score=27.17  Aligned_cols=41  Identities=17%  Similarity=0.295  Sum_probs=27.0

Q ss_pred             CceeecCCCCccC-CHHHHHHHHHHHHHHHHhhCccchhhhhcc
Q 035343            1 MMLVCSDTGRKVD-DPEVLEAIRLIVINNLLQYHPESSSQLAMG   43 (67)
Q Consensus         1 ~~It~a~Tg~KV~-~~e~LE~IRlTIiNNll~yHPEsse~la~G   43 (67)
                      |+|++.+ |.++. +++++|.||.+|.+.|-. ..++.+.++.-
T Consensus       749 F~V~d~~-g~~~~~~~~r~~~i~~~L~~~L~~-~~~~~~~~~~~  790 (895)
T PRK00275        749 YIVLDDD-GEPIGDNPARIEQIREGLTEALRN-PDDYPTIIQRR  790 (895)
T ss_pred             EEEeCCC-CCCccchHHHHHHHHHHHHHHHcC-CCccchhhhhh
Confidence            5677765 66754 579999999999776643 33334445443


No 130
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]
Probab=26.55  E-value=46  Score=27.20  Aligned_cols=32  Identities=38%  Similarity=0.603  Sum_probs=24.5

Q ss_pred             HHHHHHHHHHHHHHHhhCccchhhhhcccccCCCCCcccc
Q 035343           16 EVLEAIRLIVINNLLQYHPESSSQLAMGVTFGVDPPKQQV   55 (67)
Q Consensus        16 e~LE~IRlTIiNNll~yHPEsse~la~G~~fg~~pp~k~v   55 (67)
                      +++++||-+|=--|  .|||-=+.      .|++||++++
T Consensus       158 ~Qi~EirE~VELPL--~~PElF~~------~GI~PPKGVL  189 (406)
T COG1222         158 EQIQEIREVVELPL--KNPELFEE------LGIDPPKGVL  189 (406)
T ss_pred             HHHHHHHHHhcccc--cCHHHHHH------cCCCCCCceE
Confidence            68899998885444  58987765      5899998765


No 131
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cbp (CREB binding protein or CREBBP) is an acetyltransferase acting on histone, which gives a specific tag for transcriptional activation and also acetylates non-histone proteins. CREBBP binds specifically to phosphorylated CREB protein and augments the activity of phosphorylated CREB to activate transcription of cAMP-responsive genes. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=26.39  E-value=77  Score=20.06  Aligned_cols=26  Identities=27%  Similarity=0.339  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHHHHhhCccchhhh
Q 035343           15 PEVLEAIRLIVINNLLQYHPESSSQL   40 (67)
Q Consensus        15 ~e~LE~IRlTIiNNll~yHPEsse~l   40 (67)
                      ||.|-+.=+.|+++|.+.||.|.-..
T Consensus         1 ~~~l~~~~~~il~~l~~~~~~s~~F~   26 (108)
T cd05495           1 PEELRQALMPTLEKLYKQDPESLPFR   26 (108)
T ss_pred             CHHHHHHHHHHHHHHHHcCcccchhc
Confidence            45566666789999999999886443


No 132
>PRK05665 amidotransferase; Provisional
Probab=26.22  E-value=23  Score=25.31  Aligned_cols=11  Identities=36%  Similarity=0.449  Sum_probs=8.7

Q ss_pred             HhhCccchhhh
Q 035343           30 LQYHPESSSQL   40 (67)
Q Consensus        30 l~yHPEsse~l   40 (67)
                      +|+|||.+...
T Consensus       182 ~QfHPE~~~~~  192 (240)
T PRK05665        182 FQGHPEFVHDY  192 (240)
T ss_pred             EecCCcCcHHH
Confidence            68999987654


No 133
>PF02075 RuvC:  Crossover junction endodeoxyribonuclease RuvC;  InterPro: IPR002176 The Escherichia coli ruvC gene is involved in DNA repair and in the late step of RecE and RecF pathway recombination []. RuvC protein (3.1.22.4 from EC) cleaves cruciform junctions, which are formed by the extrusion of inverted repeat sequences from a super-coiled plasmid and which are structurally analogous to Holliday junctions, by introducing nicks into strands with the same polarity. The nicks leave a 5'terminal phosphate and a 3'terminal hydroxyl group which are ligated by E. coli or Bacteriophage T4 DNA ligases. Analysis of the cleavage sites suggests that DNA topology rather than a particular sequence determines the cleavage site. RuvC protein also cleaves Holliday junctions that are formed between gapped circular and linear duplex DNA by the function of RecA protein. The active form of RuvC protein is a dimer. This is mechanistically suited for an endonuclease involved in swapping DNA strands at the crossover junctions. It is inferred that RuvC protein is an endonuclease that resolves Holliday structures in vivo [].  RucC is a small protein of about 20 kD. It requires and binds a magnesium ion. The structure of E. coli ruvC is a 3-layer alpha-beta sandwich containing a 5-stranded beta-sheet sandwiched between 5 alpha-helices [].; GO: 0004520 endodeoxyribonuclease activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1HJR_A.
Probab=26.00  E-value=64  Score=21.43  Aligned_cols=29  Identities=28%  Similarity=0.332  Sum_probs=19.4

Q ss_pred             CCCccCCHHHHHHHHHHHHHHHHhhCccc
Q 035343            8 TGRKVDDPEVLEAIRLIVINNLLQYHPES   36 (67)
Q Consensus         8 Tg~KV~~~e~LE~IRlTIiNNll~yHPEs   36 (67)
                      |..|-..++||..|...+-.=+-+|+|+.
T Consensus        33 t~~~~~~~~Rl~~I~~~l~~li~~~~P~~   61 (149)
T PF02075_consen   33 TSSKDSLPERLKEIYEELEELIEEYNPDE   61 (149)
T ss_dssp             ---S--HHHHHHHHHHHHHHHHHHH--SE
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHhhCCCE
Confidence            44555678999999999988888999984


No 134
>PF11842 DUF3362:  Domain of unknown function (DUF3362);  InterPro: IPR024560 This domain tends to occur to the C terminus of a radical SAM domain (PF04055 from PFAM) in members of the uncharacterised protein family UPF0313. Radical SAM proteins catalyse diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation. Evidence exists that these proteins generate a radical species by reductive cleavage of S:-adenosylmethionine (SAM) through an unusual Fe-S centre [, ].
Probab=25.99  E-value=40  Score=23.87  Aligned_cols=28  Identities=43%  Similarity=0.482  Sum_probs=19.5

Q ss_pred             CCCccCCHHHHHHHHHHHHHHHHhhC-ccch
Q 035343            8 TGRKVDDPEVLEAIRLIVINNLLQYH-PESS   37 (67)
Q Consensus         8 Tg~KV~~~e~LE~IRlTIiNNll~yH-PEss   37 (67)
                      ++|+|.-|.-.++=||-  .-||+|| ||--
T Consensus        31 ~~e~V~vpk~~~er~lq--kAll~Y~~PeN~   59 (150)
T PF11842_consen   31 TMEKVYVPKGERERRLQ--KALLRYHDPENW   59 (150)
T ss_pred             CCCeeeccCCHHHHHHH--HHHHhhcChhhH
Confidence            48888777666665554  5689998 6643


No 135
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional
Probab=25.90  E-value=20  Score=25.61  Aligned_cols=8  Identities=50%  Similarity=0.974  Sum_probs=6.7

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|+|||+.
T Consensus       219 VQwHPE~~  226 (254)
T PRK11366        219 VQWHPEWN  226 (254)
T ss_pred             EEeCCCcC
Confidence            79999965


No 136
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism]
Probab=25.61  E-value=26  Score=25.93  Aligned_cols=11  Identities=45%  Similarity=0.809  Sum_probs=8.6

Q ss_pred             HhhCccchhhh
Q 035343           30 LQYHPESSSQL   40 (67)
Q Consensus        30 l~yHPEsse~l   40 (67)
                      .|+|||=|...
T Consensus       181 ~QFHPEKSg~~  191 (204)
T COG0118         181 TQFHPEKSGKA  191 (204)
T ss_pred             EecCcccchHH
Confidence            48999988764


No 137
>PF10588 NADH-G_4Fe-4S_3:  NADH-ubiquinone oxidoreductase-G iron-sulfur binding region;  InterPro: IPR019574  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This entry describes the G subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This family does not contain related subunits from formate dehydrogenase complexes.  This entry represents the iron-sulphur binding domain of the G subunit.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3M9S_C 2FUG_L 3IAS_L 2YBB_3 3IAM_3 3I9V_3.
Probab=25.52  E-value=49  Score=18.11  Aligned_cols=14  Identities=43%  Similarity=0.553  Sum_probs=8.8

Q ss_pred             HHHHHHHHHhhCcc
Q 035343           22 RLIVINNLLQYHPE   35 (67)
Q Consensus        22 RlTIiNNll~yHPE   35 (67)
                      |-+++.=||.-||.
T Consensus         1 Rr~~lelll~~H~~   14 (41)
T PF10588_consen    1 RRTVLELLLANHPL   14 (41)
T ss_dssp             -HHHHHHHHTT---
T ss_pred             CHHHHHHHHhCCCC
Confidence            67888889999985


No 138
>cd06949 NR_LBD_ER Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen). The ligand binding domain (LBD) of Estrogen receptor (ER): Estrogen receptor, a member of nuclear receptor superfamily,  is activated by the hormone estrogen. Estrogen regulates many physiological processes including reproduction, bone integrity, cardiovascular health, and behavior. The main mechanism of action of the estrogen receptor is as a transcription factor by binding to the estrogen response element of target genes upon activation by estrogen and then recruiting coactivator proteins which are responsible for the transcription of target genes. Additionally some ERs may associate with other membrane proteins and can be rapidly activated by exposure of cells to estrogen.  Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ER has  a central well conserved DNA binding domain (DBD), a variable N-terminal doma
Probab=25.30  E-value=1.1e+02  Score=21.47  Aligned_cols=21  Identities=5%  Similarity=0.154  Sum_probs=19.2

Q ss_pred             cCCHHHHHHHHHHHHHHHHhh
Q 035343           12 VDDPEVLEAIRLIVINNLLQY   32 (67)
Q Consensus        12 V~~~e~LE~IRlTIiNNll~y   32 (67)
                      +.+++.+|++|..+++-|..|
T Consensus       157 l~~~~~Ve~lq~~~~~aL~~y  177 (235)
T cd06949         157 LESRRQVQRLLDKITDALVHA  177 (235)
T ss_pred             ccCHHHHHHHHHHHHHHHHHH
Confidence            779999999999999999876


No 139
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional
Probab=25.19  E-value=21  Score=28.31  Aligned_cols=8  Identities=63%  Similarity=1.132  Sum_probs=6.7

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|+|||+.
T Consensus       166 vQFHPE~~  173 (534)
T PRK14607        166 VQFHPESI  173 (534)
T ss_pred             EEeCCCCC
Confidence            69999974


No 140
>PRK00474 rps9p 30S ribosomal protein S9P; Reviewed
Probab=24.73  E-value=87  Score=21.39  Aligned_cols=29  Identities=14%  Similarity=0.138  Sum_probs=24.1

Q ss_pred             CHHHHHHHHHHHHHHHHhh--Cccchhhhhc
Q 035343           14 DPEVLEAIRLIVINNLLQY--HPESSSQLAM   42 (67)
Q Consensus        14 ~~e~LE~IRlTIiNNll~y--HPEsse~la~   42 (67)
                      -+.+-++||+.|-.-|+.|  .||....|-.
T Consensus        72 ~sgQa~Air~aIaraL~~~~~~~~~r~~lk~  102 (134)
T PRK00474         72 IMGQADAARTAIARGLVEWTGDMELKDAFLA  102 (134)
T ss_pred             hhHHHHHHHHHHHHHHHHhccCHHHHHHHHH
Confidence            4678899999999999999  7887776654


No 141
>TIGR03627 arch_S9P archaeal ribosomal protein S9P. This model describes exclusively the archaeal ribosomal protein S9P. Homologous eukaryotic and bacterial ribosomal proteins are excluded from this model.
Probab=24.71  E-value=88  Score=21.26  Aligned_cols=29  Identities=14%  Similarity=0.173  Sum_probs=24.2

Q ss_pred             CHHHHHHHHHHHHHHHHhh--Cccchhhhhc
Q 035343           14 DPEVLEAIRLIVINNLLQY--HPESSSQLAM   42 (67)
Q Consensus        14 ~~e~LE~IRlTIiNNll~y--HPEsse~la~   42 (67)
                      -+.+-++||+.|-.-|+++  .||....|-.
T Consensus        68 ~sgQa~Air~aIaraL~~~~~~~~~r~~lk~   98 (130)
T TIGR03627        68 IMGQADAARTAIARGLVEFTGDKELRDAFRA   98 (130)
T ss_pred             hhHHHHHHHHHHHHHHHHhccCHHHHHHHHH
Confidence            4678899999999999999  7787777654


No 142
>PF08557 Lipid_DES:  Sphingolipid Delta4-desaturase (DES);  InterPro: IPR013866  Sphingolipids are important membrane signalling molecules involved in many different cellular functions in eukaryotes. Sphingolipid delta 4-desaturase catalyses the formation of (E)-sphing-4-enine []. Some proteins in this entry have bifunctional delta 4-desaturase/C-4-hydroxylase activity. Delta 4-desaturated sphingolipids may play a role in early signalling required for entry into meiotic and spermatid differentiation pathways during Drosophila spermatogenesis []. This small protein associates with FA_desaturase IPR005804 from INTERPRO and appears to be specific to sphingolipid delta 4-desaturase. ; GO: 0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 0006633 fatty acid biosynthetic process, 0055114 oxidation-reduction process, 0016021 integral to membrane
Probab=24.63  E-value=31  Score=19.70  Aligned_cols=12  Identities=33%  Similarity=0.587  Sum_probs=9.3

Q ss_pred             HHHhhCccchhh
Q 035343           28 NLLQYHPESSSQ   39 (67)
Q Consensus        28 Nll~yHPEsse~   39 (67)
                      -||+.|||..+-
T Consensus        21 ~IL~k~PeIk~L   32 (39)
T PF08557_consen   21 EILKKHPEIKKL   32 (39)
T ss_pred             HHHHhChHHHHH
Confidence            368999998764


No 143
>PRK00074 guaA GMP synthase; Reviewed
Probab=24.63  E-value=22  Score=28.12  Aligned_cols=9  Identities=44%  Similarity=1.003  Sum_probs=7.5

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|+|||++.
T Consensus       166 vQFHPE~~~  174 (511)
T PRK00074        166 VQFHPEVTH  174 (511)
T ss_pred             EeCCCCcCC
Confidence            699999874


No 144
>PRK07860 NADH dehydrogenase subunit G; Validated
Probab=24.37  E-value=72  Score=26.53  Aligned_cols=32  Identities=25%  Similarity=0.253  Sum_probs=25.4

Q ss_pred             ecCCCCccCC---HHHHHHHHHHHHHHHHhhCccc
Q 035343            5 CSDTGRKVDD---PEVLEAIRLIVINNLLQYHPES   36 (67)
Q Consensus         5 ~a~Tg~KV~~---~e~LE~IRlTIiNNll~yHPEs   36 (67)
                      ...-|=+|..   ++++++.|..++.=||.-||-.
T Consensus        68 ~v~~gm~V~t~~~s~~v~~~r~~~le~ll~~hp~d  102 (797)
T PRK07860         68 TVTDGMVVKTQLTSPVADKAQHGVMELLLINHPLD  102 (797)
T ss_pred             CCCCCcEEEeCCCCHHHHHHHHHHHHHHHhcCCCC
Confidence            3344555553   8999999999999999999963


No 145
>PF15237 PTRF_SDPR:  PTRF/SDPR family
Probab=24.14  E-value=50  Score=25.32  Aligned_cols=16  Identities=38%  Similarity=0.528  Sum_probs=14.7

Q ss_pred             CCCccCCHHHHHHHHH
Q 035343            8 TGRKVDDPEVLEAIRL   23 (67)
Q Consensus         8 Tg~KV~~~e~LE~IRl   23 (67)
                      .|.||+.||++|.||.
T Consensus       206 ~gTriV~pERREKir~  221 (246)
T PF15237_consen  206 LGTRIVTPERREKIRQ  221 (246)
T ss_pred             cCCCcCChHHhhhHhh
Confidence            5889999999999997


No 146
>cd06942 NR_LBD_Sex_1_like The ligand binding domain of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein. The ligand binding domain (LBD) of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein like: Sex-1 protein of C. elegans is a transcription factor belonging to the nuclear receptor superfamily. Sex-1 plays pivotal role in sex fate of C. elegans by regulating the transcription of the sex-determination gene xol-1, which specifies male (XO) fate when active and hermaphrodite (XX) fate when inactive. The Sex-1 protein directly represses xol-1 transcription by binding to its promoter. However, the active ligand for Sex-1 protein has not yet been identified. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, Sex-1 like receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Probab=23.99  E-value=1.4e+02  Score=19.95  Aligned_cols=31  Identities=6%  Similarity=0.097  Sum_probs=24.8

Q ss_pred             CccCCHHHHHHHHHHHHHHHHhh----Cccchhhh
Q 035343           10 RKVDDPEVLEAIRLIVINNLLQY----HPESSSQL   40 (67)
Q Consensus        10 ~KV~~~e~LE~IRlTIiNNll~y----HPEsse~l   40 (67)
                      .-+.++...|++.-.+...|.+|    ||.+...+
T Consensus       120 ~~l~~~~~v~~~q~~l~~~L~~~~~~~~~~~~~rf  154 (191)
T cd06942         120 IQLEETAKSNLQLSVLFQFLKSVLFKDGEDTEQRL  154 (191)
T ss_pred             CCccchHHHHHHHHHHHHHHHHHHHhcCCChHHHH
Confidence            44678889999999999999888    88876544


No 147
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism]
Probab=23.97  E-value=19  Score=25.33  Aligned_cols=9  Identities=44%  Similarity=1.003  Sum_probs=7.9

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|+|||...
T Consensus       171 vQFHpEv~~  179 (198)
T COG0518         171 VQFHPEVTH  179 (198)
T ss_pred             EeeeeEEeH
Confidence            799999876


No 148
>PLN02617 imidazole glycerol phosphate synthase hisHF
Probab=23.83  E-value=23  Score=28.73  Aligned_cols=8  Identities=63%  Similarity=1.211  Sum_probs=7.0

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|+|||.+
T Consensus       188 VQFHPE~s  195 (538)
T PLN02617        188 VQFHPEKS  195 (538)
T ss_pred             EEcCCccC
Confidence            59999986


No 149
>PF09409 PUB:  PUB domain;  InterPro: IPR018997  The PUB (also known as PUG) domain is found in peptide N-glycanase where it functions as a AAA ATPase binding domain []. This domain is also found on other proteins linked to the ubiquitin-proteasome system. ; PDB: 2CM0_A 2CCQ_A 2D5U_A 2HPL_A 2HPJ_A.
Probab=23.77  E-value=1.1e+02  Score=18.26  Aligned_cols=19  Identities=26%  Similarity=0.651  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHhhCccchh
Q 035343           18 LEAIRLIVINNLLQYHPESSS   38 (67)
Q Consensus        18 LE~IRlTIiNNll~yHPEsse   38 (67)
                      ++.++ +|++|++. ||+-..
T Consensus        10 l~~L~-~il~NI~~-~P~~~k   28 (87)
T PF09409_consen   10 LETLE-KILSNILS-NPNEEK   28 (87)
T ss_dssp             HHHHH-HHHHHHHH-STT-CG
T ss_pred             HHHHH-HHHHHHcc-CCCccc
Confidence            44444 78899887 676543


No 150
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I. In some species, phosphoribosylformylglycinamidine synthase is composed of a single polypeptide chain. This model describes the PurQ protein of Bacillus subtilis (where PurL, PurQ, and PurS are required for phosphoribosylformylglycinamidine synthase activity) and functionally equivalent proteins from other bacteria and archaea.
Probab=23.64  E-value=23  Score=24.69  Aligned_cols=9  Identities=44%  Similarity=0.704  Sum_probs=7.4

Q ss_pred             HhhCccchh
Q 035343           30 LQYHPESSS   38 (67)
Q Consensus        30 l~yHPEsse   38 (67)
                      +|+|||+.-
T Consensus       199 ~~~HpE~~~  207 (227)
T TIGR01737       199 MMPHPERAS  207 (227)
T ss_pred             EecCchhhc
Confidence            689999974


No 151
>PTZ00100 DnaJ chaperone protein; Provisional
Probab=23.41  E-value=70  Score=21.54  Aligned_cols=22  Identities=27%  Similarity=0.347  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHHHhhCccc
Q 035343           15 PEVLEAIRLIVINNLLQYHPES   36 (67)
Q Consensus        15 ~e~LE~IRlTIiNNll~yHPEs   36 (67)
                      ....++||..-=.=++++||.-
T Consensus        76 ~As~~eIkkaYRrLa~~~HPDk   97 (116)
T PTZ00100         76 TASKERIREAHKQLMLRNHPDN   97 (116)
T ss_pred             CCCHHHHHHHHHHHHHHhCCCC
Confidence            3456888888778889999985


No 152
>cd06946 NR_LBD_ERR The ligand binding domain of estrogen receptor-related nuclear receptors. The ligand binding domain of estrogen receptor-related receptors (ERRs): The family of estrogen receptor-related receptors (ERRs), a subfamily of nuclear receptors, is closely related to the estrogen receptor (ER) family, but it lacks the ability to bind estrogen.  ERRs can interfere with the classic ER-mediated estrogen signaling pathway, positively or negatively. ERRs  share target genes, co-regulators and promoters with the estrogen receptor (ER) family. There are three subtypes of ERRs: alpha, beta and gamma. ERRs bind at least two types of DNA sequence, the estrogen response element and another site, originally characterized as SF-1 (steroidogenic factor 1) response element. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ERR has  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-
Probab=23.32  E-value=1.5e+02  Score=20.23  Aligned_cols=22  Identities=23%  Similarity=0.508  Sum_probs=18.8

Q ss_pred             ccCCHHHHHHHHHHHHHHHHhh
Q 035343           11 KVDDPEVLEAIRLIVINNLLQY   32 (67)
Q Consensus        11 KV~~~e~LE~IRlTIiNNll~y   32 (67)
                      -+.+.+.+|++|..+++-|.+|
T Consensus       145 ~l~~~~~v~~~q~~~~~aL~~y  166 (221)
T cd06946         145 HIEDVEAVRQLRDALLEALSDY  166 (221)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHH
Confidence            3467789999999999999886


No 153
>PF01011 PQQ:  PQQ enzyme repeat family.;  InterPro: IPR002372 Pyrrolo-quinoline quinone (PQQ) is a redox coenzyme, which serves as a cofactor for a number of enzymes (quinoproteins) and particularly for some bacterial dehydrogenases [, ]. A number of bacterial quinoproteins belong to this family. Enzymes in this group have repeats of a beta propeller.; PDB: 1H4I_C 1H4J_E 1W6S_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A 1G72_A ....
Probab=23.15  E-value=36  Score=17.49  Aligned_cols=11  Identities=18%  Similarity=0.326  Sum_probs=7.8

Q ss_pred             ceeecCCCCcc
Q 035343            2 MLVCSDTGRKV   12 (67)
Q Consensus         2 ~It~a~Tg~KV   12 (67)
                      |-.|++||+.+
T Consensus        13 ~AlD~~TG~~~   23 (38)
T PF01011_consen   13 YALDAKTGKVL   23 (38)
T ss_dssp             EEEETTTTSEE
T ss_pred             EEEECCCCCEE
Confidence            45688888764


No 154
>PRK03381 PII uridylyl-transferase; Provisional
Probab=23.12  E-value=61  Score=27.08  Aligned_cols=23  Identities=17%  Similarity=0.319  Sum_probs=17.6

Q ss_pred             CceeecCCCCccCCHHHHHHHHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLEAIRLIVI   26 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE~IRlTIi   26 (67)
                      |||++. .|.+++++  +++||..++
T Consensus       751 F~V~d~-~g~~~~~~--~~~l~~~L~  773 (774)
T PRK03381        751 FYVTGA-AGGPLADA--RAAVEQAVL  773 (774)
T ss_pred             EEEECC-CCCcCchH--HHHHHHHhh
Confidence            678764 57799886  899988765


No 155
>PF09365 DUF2461:  Conserved hypothetical protein (DUF2461);  InterPro: IPR012808 Members of this family are widely (though sparsely) distributed bacterial proteins, about 230 residues in length and in fungal proteins, which are around 400 residues in length. All members have a motif RxxRDxRFxxx[DN]KxxY. The function of this protein family is unknown.
Probab=22.81  E-value=70  Score=22.68  Aligned_cols=17  Identities=29%  Similarity=0.306  Sum_probs=14.4

Q ss_pred             CCHHHHHHHHHHHHHHH
Q 035343           13 DDPEVLEAIRLIVINNL   29 (67)
Q Consensus        13 ~~~e~LE~IRlTIiNNl   29 (67)
                      -.++.|..||..|.+|-
T Consensus       116 p~~~~L~~iR~~I~~~~  132 (212)
T PF09365_consen  116 PEKEQLKRIRQEIDDNP  132 (212)
T ss_pred             CCHHHHHHHHHHHHhCh
Confidence            36899999999998874


No 156
>cd01917 ACS_2 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA.  ACS forms a heterotetramer with carbon monoxide dehydrogenase (CODH) consisting of two ACS and two CODH subunits. CODH reduces carbon dioxide to carbon monoxide and ACS then synthesizes acetyl-CoA from carbon monoxide, CoA, and a methyl group donated by another protein (CoFeSP).  ACS has three structural domains, an N-terminal rossman fold domain with a helical region at its N-terminus which interacts with CODH, and two alpha + beta fold domains.  A Ni-Fe-S center referred to as the A-cluster is located in the C-terminal domain. A large cavity exists between the three domains which may bind CoA.
Probab=22.57  E-value=77  Score=24.74  Aligned_cols=42  Identities=14%  Similarity=0.121  Sum_probs=31.7

Q ss_pred             eeecCCCCccCCHHHHHHHHHHHHHHHHhhCccchhhhhcccc
Q 035343            3 LVCSDTGRKVDDPEVLEAIRLIVINNLLQYHPESSSQLAMGVT   45 (67)
Q Consensus         3 It~a~Tg~KV~~~e~LE~IRlTIiNNll~yHPEsse~la~G~~   45 (67)
                      |.-+-||.||++-..|+.+ +..+.+|+.-||.....|-.|.+
T Consensus        41 viy~~tG~kv~~l~dl~~~-l~~~r~~~~~~~~l~~al~aG~a   82 (287)
T cd01917          41 VIRCLSGEKVETLGDLKPL-LNRLRAQVEEVLTFENARLAGEA   82 (287)
T ss_pred             eeeeecCceeeeHHHHHHH-HHHHHHhcCcccchhHHHHhhHH
Confidence            4567899999998888886 45567778888877777666654


No 157
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms]
Probab=22.52  E-value=1.1e+02  Score=19.21  Aligned_cols=21  Identities=33%  Similarity=0.722  Sum_probs=19.3

Q ss_pred             CHHHHHHHHHHHHHHHHhhCc
Q 035343           14 DPEVLEAIRLIVINNLLQYHP   34 (67)
Q Consensus        14 ~~e~LE~IRlTIiNNll~yHP   34 (67)
                      +++.|+.+=..+|.|-++|.|
T Consensus       225 ~~~~l~~vl~nLi~NAi~~~~  245 (336)
T COG0642         225 DPERLRQVLVNLLSNAIKYTP  245 (336)
T ss_pred             CHHHHHHHHHHHHHHHhccCC
Confidence            478999999999999999998


No 158
>cd07348 NR_LBD_NGFI-B The ligand binding domain of  Nurr1, a member of  conserved family of nuclear receptors. The ligand binding domain of Nerve growth factor-induced-B (NGFI-B): NGFI-B is a member of the nuclear#steroid receptor superfamily. NGFI-B is classified as an orphan receptor because no ligand has yet been identified. NGFI-B is an early immediate gene product of the embryo development that is rapidly produced in response to a variety of cellular signals including nerve growth factor. It is involved in T-cell-mediated apoptosis, as well as neuronal differentiation and function. NGFI-B regulates transcription by binding to a specific DNA target upstream of its target genes and regulating the rate of transcriptional initiation. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, NGFI-B has  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LB
Probab=22.33  E-value=1.4e+02  Score=21.41  Aligned_cols=23  Identities=17%  Similarity=0.319  Sum_probs=19.9

Q ss_pred             CccCCHHHHHHHHHHHHHHHHhh
Q 035343           10 RKVDDPEVLEAIRLIVINNLLQY   32 (67)
Q Consensus        10 ~KV~~~e~LE~IRlTIiNNll~y   32 (67)
                      .-+.+++..|++|-.+++-|-.|
T Consensus       156 ~gL~~~~~Ve~lQe~~~~aL~~y  178 (238)
T cd07348         156 HGLKEPKRVEELQNRLISCLKEH  178 (238)
T ss_pred             cCCCCHHHHHHHHHHHHHHHHHH
Confidence            35789999999999999888766


No 159
>PF01415 IL7:  Interleukin 7/9 family;  InterPro: IPR000226 Interleukin-7 (IL-7) [] is a cytokine that serves as a growth factor for early lymphoid cells of both B- and T-cell lineages. Interleukin-9 (IL-9) [] is a cytokine that supports IL-2 independent and IL-4 independent growth of helper T-cells. Interleukin-7 and -9 seems to be evolutionary related [].; GO: 0005126 cytokine receptor binding, 0008083 growth factor activity, 0006955 immune response, 0005576 extracellular region; PDB: 3DI2_C 3DI3_A.
Probab=22.10  E-value=74  Score=22.39  Aligned_cols=23  Identities=30%  Similarity=0.507  Sum_probs=18.9

Q ss_pred             HHHHHHHHHHHHHHHhhCccchhh
Q 035343           16 EVLEAIRLIVINNLLQYHPESSSQ   39 (67)
Q Consensus        16 e~LE~IRlTIiNNll~yHPEsse~   39 (67)
                      ...+.||+.-|+|| +.+|++...
T Consensus         8 ~ty~gIl~vsId~L-~~~~~~~~n   30 (129)
T PF01415_consen    8 STYQGILMVSIDNL-DKMPESKCN   30 (129)
T ss_dssp             HHHHHTHHHHHHHH-HTTSSS-TT
T ss_pred             ccccceeeeeHHHh-hcCcccCCc
Confidence            45788999999999 999998654


No 160
>PF14098 SSPI:  Small, acid-soluble spore protein I
Probab=21.84  E-value=48  Score=20.75  Aligned_cols=16  Identities=25%  Similarity=0.345  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHhhCcc
Q 035343           20 AIRLIVINNLLQYHPE   35 (67)
Q Consensus        20 ~IRlTIiNNll~yHPE   35 (67)
                      +||..||.|+=-..+|
T Consensus         2 dlR~AI~~nv~g~s~~   17 (65)
T PF14098_consen    2 DLRQAIIHNVKGSSKE   17 (65)
T ss_pred             CHHHHHHHHccCCCHH
Confidence            4899999998554443


No 161
>cd07349 NR_LBD_SHP The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain. The ligand binding domain of the Small Heterodimer Partner (SHP): SHP is a member of the nuclear receptor superfamily. SHP has a ligand binding domain, but lacks the DNA binding domain, typical to almost all of the nuclear receptors. It functions as a transcriptional coregulator by directly interacting with other nuclear receptors through its AF-2 motif. The closest relative of SHP is DAX1 and they can form heterodimer. SHP is an orphan receptor, lacking an identified ligand.
Probab=21.70  E-value=1.5e+02  Score=20.90  Aligned_cols=31  Identities=10%  Similarity=0.170  Sum_probs=24.2

Q ss_pred             CccCCHHHHHHHHHHHHHHHHhh----Cccchhhh
Q 035343           10 RKVDDPEVLEAIRLIVINNLLQY----HPESSSQL   40 (67)
Q Consensus        10 ~KV~~~e~LE~IRlTIiNNll~y----HPEsse~l   40 (67)
                      .-+.+++.+|.+|-.+++-|-.|    ||.....+
T Consensus       148 ~gl~~~~~V~~lqe~~~~aL~~~~~~~~p~~~~r~  182 (222)
T cd07349         148 PGLTASSHVGHLQQEAQWALCEVLEPLHPQDQGRF  182 (222)
T ss_pred             ccCCCHHHHHHHHHHHHHHHHHHHHHHCCCcccHH
Confidence            34788999999999999888765    77765543


No 162
>KOG3009 consensus Predicted carbohydrate kinase, contains PfkB domain [General function prediction only]
Probab=21.64  E-value=28  Score=29.79  Aligned_cols=20  Identities=35%  Similarity=0.476  Sum_probs=17.7

Q ss_pred             HHHHhhCccchhhhhccccc
Q 035343           27 NNLLQYHPESSSQLAMGVTF   46 (67)
Q Consensus        27 NNll~yHPEsse~la~G~~f   46 (67)
                      ..+|+.|||.+|+|+.|++-
T Consensus        23 rs~l~ispqv~eal~~~epV   42 (614)
T KOG3009|consen   23 RSLLQISPQVKEALANGEPV   42 (614)
T ss_pred             ccceecCHHHHHHHhcCCCE
Confidence            38999999999999999863


No 163
>PF11943 DUF3460:  Protein of unknown function (DUF3460);  InterPro: IPR021853  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 70 amino acids in length. This protein has a conserved WDK sequence motif. 
Probab=21.60  E-value=56  Score=20.16  Aligned_cols=21  Identities=29%  Similarity=0.422  Sum_probs=16.3

Q ss_pred             HHHHHHhhCccchhhhhcccc
Q 035343           25 VINNLLQYHPESSSQLAMGVT   45 (67)
Q Consensus        25 IiNNll~yHPEsse~la~G~~   45 (67)
                      -||-|++.|||.-++=..|.+
T Consensus        10 Fl~~lk~~~Pele~~Q~~GRa   30 (60)
T PF11943_consen   10 FLNQLKAKHPELEEEQRAGRA   30 (60)
T ss_pred             HHHHHHHhCCchHHHHHHhhH
Confidence            589999999998776555544


No 164
>PF07879 PHB_acc_N:  PHB/PHA accumulation regulator DNA-binding domain;  InterPro: IPR012909 This domain is found at the N terminus of the polyhydroxyalkanoate (PHA) synthesis regulators. These regulators have been shown to directly bind DNA and PHA []. The invariant nature of this domain compared to the C-terminal IPR007897 from INTERPRO domain(s) suggests that it contains the DNA-binding function. 
Probab=21.48  E-value=58  Score=20.43  Aligned_cols=19  Identities=21%  Similarity=0.384  Sum_probs=14.6

Q ss_pred             CceeecCCCCccCCHHHHH
Q 035343            1 MMLVCSDTGRKVDDPEVLE   19 (67)
Q Consensus         1 ~~It~a~Tg~KV~~~e~LE   19 (67)
                      |-|.|+.||+-|+.+=++.
T Consensus        35 ~~V~D~ktgeDiT~~iL~Q   53 (64)
T PF07879_consen   35 FKVVDAKTGEDITRSILLQ   53 (64)
T ss_pred             EEEEECCCCcccHHHHHHH
Confidence            4588999999998765543


No 165
>PRK13566 anthranilate synthase; Provisional
Probab=21.12  E-value=28  Score=29.20  Aligned_cols=8  Identities=63%  Similarity=1.132  Sum_probs=6.6

Q ss_pred             HhhCccch
Q 035343           30 LQYHPESS   37 (67)
Q Consensus        30 l~yHPEss   37 (67)
                      +|||||+-
T Consensus       692 VQFHPE~i  699 (720)
T PRK13566        692 VQFHPESI  699 (720)
T ss_pred             EeccCeeC
Confidence            68999983


No 166
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional
Probab=21.04  E-value=96  Score=24.98  Aligned_cols=24  Identities=21%  Similarity=0.310  Sum_probs=21.2

Q ss_pred             CCHHHHHHHHHHHHHHHHhhCccc
Q 035343           13 DDPEVLEAIRLIVINNLLQYHPES   36 (67)
Q Consensus        13 ~~~e~LE~IRlTIiNNll~yHPEs   36 (67)
                      ++++.|+++|.+++.-||..|+-.
T Consensus        76 t~~~~~~~~r~~~le~l~~~~c~~   99 (652)
T PRK12814         76 TENAELHAMRRQSLERLIEQHCGD   99 (652)
T ss_pred             eCcHHHHHHHHHHHHHHHhhcccc
Confidence            478899999999999999999754


No 167
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade. This model represents a small clade of anthranilate synthases from alpha proteobacteria and Nostoc (a cyanobacterium). This enzyme is the first step in the pathway for the biosynthesis of tryprophan from chorismate.
Probab=21.02  E-value=28  Score=29.30  Aligned_cols=8  Identities=63%  Similarity=1.157  Sum_probs=6.8

Q ss_pred             HHhhCccc
Q 035343           29 LLQYHPES   36 (67)
Q Consensus        29 ll~yHPEs   36 (67)
                      =+|+|||+
T Consensus       681 GVQFHPEs  688 (717)
T TIGR01815       681 AVQFHPES  688 (717)
T ss_pred             EEEeCCee
Confidence            37999998


No 168
>PRK07567 glutamine amidotransferase; Provisional
Probab=20.85  E-value=31  Score=24.45  Aligned_cols=11  Identities=36%  Similarity=0.597  Sum_probs=8.9

Q ss_pred             HhhCccchhhh
Q 035343           30 LQYHPESSSQL   40 (67)
Q Consensus        30 l~yHPEsse~l   40 (67)
                      +|+|||.....
T Consensus       186 vQfHPE~~~~~  196 (242)
T PRK07567        186 TQFHPELDADG  196 (242)
T ss_pred             EEeCCcCCHHH
Confidence            79999987654


No 169
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD. This ACT domain family, ACT_UUR_ACR-like, includes the two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; including those enzymes similar to the GlnD found in enteric Escherichia coli and those found in photosynthetic, nitrogen-fixing bacterium Rhodospirillum rubrum. Also included in this CD are the four ACT domains of a novel protein composed almost entirely of ACT domain repeats (the ACR protein) and like proteins. These ACR proteins, found in Arabidopsis and Oryza, are proposed to function as novel regulatory or sensor proteins in plants. This CD also includes the first of the two ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein and related domains, as well as, the N-terminal ACT domain of a yet characterized Arabidopsis/Oryza predicted t
Probab=20.83  E-value=1.5e+02  Score=15.54  Aligned_cols=19  Identities=26%  Similarity=0.387  Sum_probs=12.9

Q ss_pred             CCCCccCCHHHHHHHHHHHH
Q 035343            7 DTGRKVDDPEVLEAIRLIVI   26 (67)
Q Consensus         7 ~Tg~KV~~~e~LE~IRlTIi   26 (67)
                      .+|.. .++++.+.||..+-
T Consensus        49 ~~~~~-~~~~~~~~l~~~l~   67 (70)
T cd04873          49 SDGRP-LDPERIARLEEALE   67 (70)
T ss_pred             CCCCc-CCHHHHHHHHHHHH
Confidence            34444 56689999888773


No 170
>PRK09130 NADH dehydrogenase subunit G; Validated
Probab=20.71  E-value=94  Score=25.63  Aligned_cols=23  Identities=26%  Similarity=0.317  Sum_probs=21.8

Q ss_pred             CCHHHHHHHHHHHHHHHHhhCcc
Q 035343           13 DDPEVLEAIRLIVINNLLQYHPE   35 (67)
Q Consensus        13 ~~~e~LE~IRlTIiNNll~yHPE   35 (67)
                      ++++++.+.|..++.=||.-||.
T Consensus        75 T~s~~v~~~r~~~le~ll~~Hp~   97 (687)
T PRK09130         75 TNTPMVKKAREGVMEFLLINHPL   97 (687)
T ss_pred             eCCHHHHHHHHHHHHHHHhcCCC
Confidence            58999999999999999999997


No 171
>smart00830 CM_2 Chorismate mutase type II. Chorismate mutase, catalyses the conversion of chorismate to prephenate in the pathway of tyrosine and phenylalanine biosynthesis. This enzyme is negatively regulated by tyrosine, tryptophan and phenylalanine PUBMED:9642265, PUBMED:9497350.
Probab=20.67  E-value=1e+02  Score=17.45  Aligned_cols=28  Identities=14%  Similarity=-0.002  Sum_probs=20.4

Q ss_pred             cCCCCccCCHHHHHHHHHHHHHHHHhhC
Q 035343            6 SDTGRKVDDPEVLEAIRLIVINNLLQYH   33 (67)
Q Consensus         6 a~Tg~KV~~~e~LE~IRlTIiNNll~yH   33 (67)
                      ..+|..|.||++-++|.-.+.+..-+++
T Consensus        30 ~~~~~~i~d~~Re~~vl~~~~~~a~~~~   57 (79)
T smart00830       30 AKNGLPIYDPEREAEVLERLRALAEGPG   57 (79)
T ss_pred             HHCCCCCCChHHHHHHHHHHHHHcccCC
Confidence            3568889999998888777766555443


No 172
>PHA02749 hypothetical protein; Provisional
Probab=20.12  E-value=43  Score=26.53  Aligned_cols=15  Identities=40%  Similarity=0.589  Sum_probs=11.6

Q ss_pred             HHHHHHhhCccchhh
Q 035343           25 VINNLLQYHPESSSQ   39 (67)
Q Consensus        25 IiNNll~yHPEsse~   39 (67)
                      +=-|++.||||.+.-
T Consensus       132 l~lnila~~pei~a~  146 (322)
T PHA02749        132 LGLNILAWHPEISAG  146 (322)
T ss_pred             hhhHHHHhchhhhcc
Confidence            335999999998753


No 173
>cd07071 NR_LBD_Nurr1 The ligand binding domain of  Nurr1, a member of  conserved family of nuclear receptors. The ligand binding domain of nuclear receptor Nurr1: Nurr1 belongs to the conserved family of nuclear receptors. It is a transcription factor that is expressed in the embryonic ventral midbrain and is critical for the development of dopamine (DA) neurons. Structural studies have shown that the ligand binding pocket of Nurr1 is filled by bulky hydrophobic residues, making it unable to bind to ligands. Therefore, it belongs to the class of orphan receptors. However, Nurr1 forms heterodimers with RXR and can promote signaling via its partner, RXR. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, Nurr1 has  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=20.09  E-value=1.7e+02  Score=20.92  Aligned_cols=24  Identities=17%  Similarity=0.331  Sum_probs=21.2

Q ss_pred             CCccCCHHHHHHHHHHHHHHHHhh
Q 035343            9 GRKVDDPEVLEAIRLIVINNLLQY   32 (67)
Q Consensus         9 g~KV~~~e~LE~IRlTIiNNll~y   32 (67)
                      ...+.+++..|++|-.|.+-|-.|
T Consensus       155 ~~gL~~~~~Ve~lQe~~~~aL~~y  178 (238)
T cd07071         155 RHGLKEPKRVEELQNKIVNCLKDH  178 (238)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHH
Confidence            356899999999999999998877


No 174
>CHL00044 rpl16 ribosomal protein L16
Probab=20.09  E-value=1.1e+02  Score=20.79  Aligned_cols=20  Identities=15%  Similarity=-0.024  Sum_probs=16.7

Q ss_pred             cCCHHHHHHHHHHHHHHHHh
Q 035343           12 VDDPEVLEAIRLIVINNLLQ   31 (67)
Q Consensus        12 V~~~e~LE~IRlTIiNNll~   31 (67)
                      -.....||++|.+|..+|-.
T Consensus        41 ~i~~~qiEaaR~~i~r~lkk   60 (135)
T CHL00044         41 WITSRQIEAGRRAITRYARR   60 (135)
T ss_pred             EECHHHHHHHHHHHHHhhhc
Confidence            45688999999999998853


Done!