BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035345
         (67 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q8GYN5|RIN4_ARATH RPM1-interacting protein 4 OS=Arabidopsis thaliana GN=RIN4 PE=1
           SV=1
          Length = 211

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 28/33 (84%)

Query: 8   LPKFGEWDVNDPASAEGFTVIFNKARDEKKTGG 40
           +PKFG+WD N+P+SA+G+T IFNK R+E+ +G 
Sbjct: 148 VPKFGDWDENNPSSADGYTHIFNKVREERSSGA 180


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.314    0.136    0.450 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 31,783,680
Number of Sequences: 539616
Number of extensions: 1174213
Number of successful extensions: 1452
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1450
Number of HSP's gapped (non-prelim): 3
length of query: 67
length of database: 191,569,459
effective HSP length: 39
effective length of query: 28
effective length of database: 170,524,435
effective search space: 4774684180
effective search space used: 4774684180
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 55 (25.8 bits)