Query         035373
Match_columns 66
No_of_seqs    18 out of 20
Neff          2.2 
Searched_HMMs 46136
Date          Fri Mar 29 02:32:40 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035373.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035373hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10138 vWA-TerF-like:  vWA fo  62.1     4.2 9.1E-05   29.5   1.1   31   28-58      5-35  (200)
  2 PRK12620 flgB flagellar basal   46.2      15 0.00034   23.6   1.7   17   47-63     23-39  (132)
  3 PRK07182 flgB flagellar basal   45.8      15 0.00033   24.5   1.7   17   47-63     23-39  (148)
  4 PRK12685 flgB flagellar basal   44.5      15 0.00032   23.7   1.4   17   47-63     23-39  (116)
  5 PF13820 Nucleic_acid_bd:  Puta  41.8      36 0.00079   23.7   3.1   38    7-44     16-55  (149)
  6 COG1710 Uncharacterized protei  34.4      27 0.00058   24.9   1.5   17   36-52      3-19  (139)
  7 PRK12622 flgB flagellar basal   32.8      33 0.00071   22.8   1.7   18   46-63     21-38  (135)
  8 PRK12621 flgB flagellar basal   30.8      36 0.00079   21.9   1.6   17   47-63     23-39  (136)
  9 PRK12624 flgB flagellar basal   28.5      43 0.00093   22.5   1.7   19   45-63     23-41  (143)
 10 PRK12627 flgB flagellar basal   28.1      44 0.00096   22.0   1.7   19   45-63     20-38  (128)
 11 PRK05680 flgB flagellar basal   27.3      46   0.001   21.7   1.6   18   46-63     22-39  (137)
 12 PF00673 Ribosomal_L5_C:  ribos  26.2      90  0.0019   19.5   2.8   22   36-57      3-24  (95)
 13 COG5503 Uncharacterized conser  26.2      58  0.0013   20.9   1.9   22   32-53     18-40  (69)
 14 PRK12625 flgB flagellar basal   25.0      55  0.0012   21.7   1.7   18   46-63     22-39  (132)
 15 PF07006 DUF1310:  Protein of u  24.9      51  0.0011   22.1   1.6   20   40-59     35-54  (122)
 16 COG1815 FlgB Flagellar basal b  24.7      49  0.0011   22.6   1.5   18   46-63     21-38  (133)
 17 PF11002 RDM:  RFPL defining mo  24.7      25 0.00053   20.6   0.0   12    4-15     12-23  (42)
 18 PRK12619 flgB flagellar basal   24.4      58  0.0013   21.2   1.7   18   46-63     22-39  (130)
 19 PRK06003 flgB flagellar basal   23.1      62  0.0013   21.0   1.7   19   46-64     20-38  (126)
 20 COG0186 RpsQ Ribosomal protein  23.1      44 0.00095   21.8   0.9   15   28-42     17-31  (87)
 21 TIGR01396 FlgB flagellar basal  22.6      64  0.0014   21.1   1.7   18   46-63     18-35  (131)
 22 PRK12623 flgB flagellar basal   22.6      52  0.0011   21.9   1.2   17   47-63     27-43  (131)

No 1  
>PF10138 vWA-TerF-like:  vWA found in TerF C terminus ;  InterPro: IPR019303 This entry represents the N-terminal domain of a family of proteins that confer resistance to the metalloid element tellurium and its salts. 
Probab=62.08  E-value=4.2  Score=29.48  Aligned_cols=31  Identities=19%  Similarity=0.454  Sum_probs=28.0

Q ss_pred             chhccCccceeeeeehHHHHHHHHHhhhhcc
Q 035373           28 YIKMDKSSSVKVEIRSRKAKKLIDKTLQVAD   58 (66)
Q Consensus        28 Y~Km~Ks~SmrVEIRSRkArkLI~ktL~~AD   58 (66)
                      |-=+|+|-||+=.-++...|.+.+.+|..|-
T Consensus         5 ~LVLD~SGSM~~~yk~G~vQ~~~Er~lalA~   35 (200)
T PF10138_consen    5 YLVLDISGSMRPLYKDGTVQRVVERILALAA   35 (200)
T ss_pred             EEEEeCCCCCchhhhCccHHHHHHHHHHHHh
Confidence            4558999999999999999999999999883


No 2  
>PRK12620 flgB flagellar basal body rod protein FlgB; Provisional
Probab=46.15  E-value=15  Score=23.61  Aligned_cols=17  Identities=41%  Similarity=0.618  Sum_probs=15.3

Q ss_pred             HHHHHHhhhhccCCCCc
Q 035373           47 KKLIDKTLQVADRPGKR   63 (66)
Q Consensus        47 rkLI~ktL~~ADs~~~r   63 (66)
                      +++|+.|++=||.||=+
T Consensus        23 q~via~NIANadTPgYk   39 (132)
T PRK12620         23 MKLIASNLSNVDTPGYK   39 (132)
T ss_pred             HHHHHHHHHhcCCCCcC
Confidence            68999999999999854


No 3  
>PRK07182 flgB flagellar basal body rod protein FlgB; Reviewed
Probab=45.77  E-value=15  Score=24.54  Aligned_cols=17  Identities=18%  Similarity=0.356  Sum_probs=15.4

Q ss_pred             HHHHHHhhhhccCCCCc
Q 035373           47 KKLIDKTLQVADRPGKR   63 (66)
Q Consensus        47 rkLI~ktL~~ADs~~~r   63 (66)
                      |++|+.|++=||.||=+
T Consensus        23 q~vIa~NIANadTPGYk   39 (148)
T PRK07182         23 AELLSANLANVNTPNFQ   39 (148)
T ss_pred             HHHHHHhHHhcCCCCCC
Confidence            78999999999999954


No 4  
>PRK12685 flgB flagellar basal body rod protein FlgB; Reviewed
Probab=44.54  E-value=15  Score=23.75  Aligned_cols=17  Identities=29%  Similarity=0.579  Sum_probs=15.4

Q ss_pred             HHHHHHhhhhccCCCCc
Q 035373           47 KKLIDKTLQVADRPGKR   63 (66)
Q Consensus        47 rkLI~ktL~~ADs~~~r   63 (66)
                      |++|+.|++-||-||=+
T Consensus        23 q~via~NIANadTPgYk   39 (116)
T PRK12685         23 SKVLASNLANAETPGYK   39 (116)
T ss_pred             HHHHHhhhhccCCCCcC
Confidence            78999999999999954


No 5  
>PF13820 Nucleic_acid_bd:  Putative nucleic acid-binding region
Probab=41.83  E-value=36  Score=23.74  Aligned_cols=38  Identities=21%  Similarity=0.218  Sum_probs=28.5

Q ss_pred             HHHHHHHHHHHHHhhhccCC--cchhccCccceeeeeehH
Q 035373            7 ENLVESIKSKVRALKKKKNK--PYIKMDKSSSVKVEIRSR   44 (66)
Q Consensus         7 g~lv~~iKsk~r~~~~k~kk--~Y~Km~Ks~SmrVEIRSR   44 (66)
                      +.=+|.||..|+.+-...++  -+.+.++-.|++||+-.-
T Consensus        16 ~~~ld~i~~~l~~L~~~~~~~l~~~~~~~~~sv~V~f~ip   55 (149)
T PF13820_consen   16 QYKLDDIKNWLASLYKPRISDLKVRKVEPWNSVRVTFSIP   55 (149)
T ss_pred             HHHHHHHHHHHHHHHhcccccceeeccccCceEEEEEech
Confidence            34467788888888654444  489999999999998764


No 6  
>COG1710 Uncharacterized protein conserved in archaea [Function unknown]
Probab=34.38  E-value=27  Score=24.91  Aligned_cols=17  Identities=29%  Similarity=0.714  Sum_probs=15.8

Q ss_pred             ceeeeeehHHHHHHHHH
Q 035373           36 SVKVEIRSRKAKKLIDK   52 (66)
Q Consensus        36 SmrVEIRSRkArkLI~k   52 (66)
                      -|+|||.+|.-+.|+++
T Consensus         3 ~m~v~l~ar~i~ELlek   19 (139)
T COG1710           3 KMRVELTARNIRELLEK   19 (139)
T ss_pred             ceeeehhhhhHHHHHHH
Confidence            58999999999999987


No 7  
>PRK12622 flgB flagellar basal body rod protein FlgB; Provisional
Probab=32.81  E-value=33  Score=22.81  Aligned_cols=18  Identities=17%  Similarity=0.370  Sum_probs=15.5

Q ss_pred             HHHHHHHhhhhccCCCCc
Q 035373           46 AKKLIDKTLQVADRPGKR   63 (66)
Q Consensus        46 ArkLI~ktL~~ADs~~~r   63 (66)
                      =+++|+.|++-||.||=+
T Consensus        21 r~~via~NiAN~~Tp~yk   38 (135)
T PRK12622         21 RQSVIADNIANVDTPNFK   38 (135)
T ss_pred             HHHHHHHHHHhcCCcccC
Confidence            378999999999999854


No 8  
>PRK12621 flgB flagellar basal body rod protein FlgB; Provisional
Probab=30.81  E-value=36  Score=21.92  Aligned_cols=17  Identities=18%  Similarity=0.458  Sum_probs=15.1

Q ss_pred             HHHHHHhhhhccCCCCc
Q 035373           47 KKLIDKTLQVADRPGKR   63 (66)
Q Consensus        47 rkLI~ktL~~ADs~~~r   63 (66)
                      ++.|+.|++-||.||=+
T Consensus        23 q~viA~NIAN~nTPgYk   39 (136)
T PRK12621         23 QNVVMSNLANVNTPGYK   39 (136)
T ss_pred             HHHHHHhhhhcCCCCCC
Confidence            68999999999999854


No 9  
>PRK12624 flgB flagellar basal body rod protein FlgB; Provisional
Probab=28.51  E-value=43  Score=22.54  Aligned_cols=19  Identities=26%  Similarity=0.447  Sum_probs=15.9

Q ss_pred             HHHHHHHHhhhhccCCCCc
Q 035373           45 KAKKLIDKTLQVADRPGKR   63 (66)
Q Consensus        45 kArkLI~ktL~~ADs~~~r   63 (66)
                      +=+++|+.|++-||.||=+
T Consensus        23 ~R~~via~NiANa~Tp~yk   41 (143)
T PRK12624         23 QKRKVISDNIANADVPHFK   41 (143)
T ss_pred             HHHHHHHHHHHhcCCCCCC
Confidence            3478999999999999854


No 10 
>PRK12627 flgB flagellar basal body rod protein FlgB; Provisional
Probab=28.06  E-value=44  Score=21.95  Aligned_cols=19  Identities=26%  Similarity=0.573  Sum_probs=16.1

Q ss_pred             HHHHHHHHhhhhccCCCCc
Q 035373           45 KAKKLIDKTLQVADRPGKR   63 (66)
Q Consensus        45 kArkLI~ktL~~ADs~~~r   63 (66)
                      .=+++|+.|++-||.||=+
T Consensus        20 ~r~~~ia~NiAN~~tp~y~   38 (128)
T PRK12627         20 ERQAVVARNVANADTPGYR   38 (128)
T ss_pred             HHHHHHHHHHHccCCCCCC
Confidence            3478999999999999855


No 11 
>PRK05680 flgB flagellar basal body rod protein FlgB; Reviewed
Probab=27.25  E-value=46  Score=21.73  Aligned_cols=18  Identities=28%  Similarity=0.562  Sum_probs=15.5

Q ss_pred             HHHHHHHhhhhccCCCCc
Q 035373           46 AKKLIDKTLQVADRPGKR   63 (66)
Q Consensus        46 ArkLI~ktL~~ADs~~~r   63 (66)
                      =+++|+.|++-||.||=+
T Consensus        22 r~~~ia~NiAN~~Tpgyk   39 (137)
T PRK05680         22 RQEVIASNIANADTPGYK   39 (137)
T ss_pred             HHHHHHHhHHhcCCCCcC
Confidence            478999999999999854


No 12 
>PF00673 Ribosomal_L5_C:  ribosomal L5P family C-terminus;  InterPro: IPR002132 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L5, ~180 amino acids in length, is one of the proteins from the large ribosomal subunit. In Escherichia coli, L5 is known to be involved in binding 5S RNA to the large ribosomal subunit. It belongs to a family of ribosomal proteins which, on the basis of sequence similarities [, , , ], groups:  Eubacterial L5. Algal chloroplast L5. Cyanelle L5. Archaebacterial L5. Mammalian L11.  Tetrahymena thermophila L21.  Dictyostelium discoideum (Slime mold) L5  Saccharomyces cerevisiae (Baker's yeast) L16 (39A). Plant mitochondrial L5. ; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1IQ4_B 2ZJR_D 2ZJP_D 3PIO_D 3CF5_D 2ZJQ_D 3DLL_D 3PIP_D 2WDL_G 3UZN_G ....
Probab=26.24  E-value=90  Score=19.55  Aligned_cols=22  Identities=27%  Similarity=0.554  Sum_probs=19.4

Q ss_pred             ceeeeeehHHHHHHHHHhhhhc
Q 035373           36 SVKVEIRSRKAKKLIDKTLQVA   57 (66)
Q Consensus        36 SmrVEIRSRkArkLI~ktL~~A   57 (66)
                      .++|.+|-.+|-..+++-+.++
T Consensus         3 G~kvTLRg~~m~~FL~kli~~v   24 (95)
T PF00673_consen    3 GCKVTLRGKKMYEFLDKLITIV   24 (95)
T ss_dssp             EEEEEEEHHHHHHHHHHHHHTT
T ss_pred             EEEEEEccHHHHHHHHHHHHHh
Confidence            3789999999999999988874


No 13 
>COG5503 Uncharacterized conserved small protein [Function unknown]
Probab=26.15  E-value=58  Score=20.87  Aligned_cols=22  Identities=23%  Similarity=0.448  Sum_probs=18.8

Q ss_pred             cCccceeeeeeh-HHHHHHHHHh
Q 035373           32 DKSSSVKVEIRS-RKAKKLIDKT   53 (66)
Q Consensus        32 ~Ks~SmrVEIRS-RkArkLI~kt   53 (66)
                      ++|+|.-||+-| .+||+|+.+|
T Consensus        18 E~T~sLYle~~se~~vR~ll~e~   40 (69)
T COG5503          18 ETTDSLYLEADSETKVRQLLKEN   40 (69)
T ss_pred             cccceEEEechhHHHHHHHHhcc
Confidence            688999999975 6899999876


No 14 
>PRK12625 flgB flagellar basal body rod protein FlgB; Provisional
Probab=24.96  E-value=55  Score=21.65  Aligned_cols=18  Identities=22%  Similarity=0.394  Sum_probs=15.5

Q ss_pred             HHHHHHHhhhhccCCCCc
Q 035373           46 AKKLIDKTLQVADRPGKR   63 (66)
Q Consensus        46 ArkLI~ktL~~ADs~~~r   63 (66)
                      =+++|+.||+-||.||=+
T Consensus        22 r~~~~a~NiAN~~tp~y~   39 (132)
T PRK12625         22 RAEVISSNIANADTPHYK   39 (132)
T ss_pred             HHHHHHHHHHhcCCCCcC
Confidence            378999999999999854


No 15 
>PF07006 DUF1310:  Protein of unknown function (DUF1310);  InterPro: IPR010738 This family consists of several hypothetical proteins of around 125 residues in length. Members of this family seem to be specific to Listeria and Streptococcus species. The function of this family is unknown.
Probab=24.93  E-value=51  Score=22.11  Aligned_cols=20  Identities=40%  Similarity=0.556  Sum_probs=17.8

Q ss_pred             eeehHHHHHHHHHhhhhccC
Q 035373           40 EIRSRKAKKLIDKTLQVADR   59 (66)
Q Consensus        40 EIRSRkArkLI~ktL~~ADs   59 (66)
                      -+.|..|+++|++.|+.-|+
T Consensus        35 Iv~S~E~k~~~E~~Lk~lD~   54 (122)
T PF07006_consen   35 IVKSEEAKKVIEKDLKNLDP   54 (122)
T ss_pred             HhcCHHHHHHHHHHHHHhCh
Confidence            35799999999999999886


No 16 
>COG1815 FlgB Flagellar basal body protein [Cell motility and secretion]
Probab=24.72  E-value=49  Score=22.61  Aligned_cols=18  Identities=28%  Similarity=0.575  Sum_probs=15.9

Q ss_pred             HHHHHHHhhhhccCCCCc
Q 035373           46 AKKLIDKTLQVADRPGKR   63 (66)
Q Consensus        46 ArkLI~ktL~~ADs~~~r   63 (66)
                      -|++|+-|++-||-||=+
T Consensus        21 Rq~via~NIANadTP~yK   38 (133)
T COG1815          21 RQEVIANNIANADTPGYK   38 (133)
T ss_pred             HHHHHHhhhccCCCCCCC
Confidence            478999999999999855


No 17 
>PF11002 RDM:  RFPL defining motif (RDM);  InterPro: IPR022723  The RFPL defining motif (RDM) is a domain found on RFPL (Ret finger protein like) proteins. In humans, RFPL transcripts can be detected at the onset of neurogenesis in differentiating human embryonic stem cells, and in the developing human neocortex []. The RDM domain is thought to have emerged from a neofunctionalisation event. It is found N-terminal to the SPRY domain (PF00622 from PFAM). ; PDB: 2FBE_B.
Probab=24.66  E-value=25  Score=20.63  Aligned_cols=12  Identities=50%  Similarity=0.520  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHH
Q 035373            4 NQLENLVESIKS   15 (66)
Q Consensus         4 ~qLg~lv~~iKs   15 (66)
                      -|||.||.-||.
T Consensus        12 ~qLg~Lvs~iKe   23 (42)
T PF11002_consen   12 FQLGKLVSKIKE   23 (42)
T ss_dssp             ------------
T ss_pred             HHHHHHHHHHHH
Confidence            489999987775


No 18 
>PRK12619 flgB flagellar basal body rod protein FlgB; Provisional
Probab=24.44  E-value=58  Score=21.19  Aligned_cols=18  Identities=6%  Similarity=0.272  Sum_probs=15.6

Q ss_pred             HHHHHHHhhhhccCCCCc
Q 035373           46 AKKLIDKTLQVADRPGKR   63 (66)
Q Consensus        46 ArkLI~ktL~~ADs~~~r   63 (66)
                      -++.|+.||+-+|.||=+
T Consensus        22 r~~via~NiAN~~Tpgyk   39 (130)
T PRK12619         22 RASVLANNIANVNTPNFK   39 (130)
T ss_pred             HHHHHHHHHHhcCCCCcC
Confidence            478999999999999854


No 19 
>PRK06003 flgB flagellar basal body rod protein FlgB; Reviewed
Probab=23.12  E-value=62  Score=21.01  Aligned_cols=19  Identities=21%  Similarity=0.424  Sum_probs=16.1

Q ss_pred             HHHHHHHhhhhccCCCCcc
Q 035373           46 AKKLIDKTLQVADRPGKRS   64 (66)
Q Consensus        46 ArkLI~ktL~~ADs~~~rt   64 (66)
                      =+++|+.|++=||-||=+.
T Consensus        20 rq~viA~NiAN~~TPgyk~   38 (126)
T PRK06003         20 RQATVAGNIANANTPGYRA   38 (126)
T ss_pred             HHHHHHHhHHhcCCCCccc
Confidence            3789999999999999653


No 20 
>COG0186 RpsQ Ribosomal protein S17 [Translation, ribosomal structure and biogenesis]
Probab=23.05  E-value=44  Score=21.79  Aligned_cols=15  Identities=47%  Similarity=0.470  Sum_probs=12.9

Q ss_pred             chhccCccceeeeee
Q 035373           28 YIKMDKSSSVKVEIR   42 (66)
Q Consensus        28 Y~Km~Ks~SmrVEIR   42 (66)
                      =|||+||-.|+||-+
T Consensus        17 S~Km~KTvvV~ve~~   31 (87)
T COG0186          17 SDKMDKTVVVEVERK   31 (87)
T ss_pred             EccCceeEEEEEEEE
Confidence            489999999999864


No 21 
>TIGR01396 FlgB flagellar basal-body rod protein FlgB. This model represents FlgB, one of several components of bacterial flagella that share a domain described by pfam model pfam00460. FlgB is part of the basal body.
Probab=22.62  E-value=64  Score=21.14  Aligned_cols=18  Identities=22%  Similarity=0.532  Sum_probs=15.4

Q ss_pred             HHHHHHHhhhhccCCCCc
Q 035373           46 AKKLIDKTLQVADRPGKR   63 (66)
Q Consensus        46 ArkLI~ktL~~ADs~~~r   63 (66)
                      -++.|+.|++-||.||=+
T Consensus        18 r~~~ia~NiAN~~Tpgyk   35 (131)
T TIGR01396        18 RQEVIANNIANVDTPGYK   35 (131)
T ss_pred             HHHHHHHHHHhcCCCccc
Confidence            367999999999999854


No 22 
>PRK12623 flgB flagellar basal body rod protein FlgB; Provisional
Probab=22.60  E-value=52  Score=21.87  Aligned_cols=17  Identities=18%  Similarity=0.370  Sum_probs=14.9

Q ss_pred             HHHHHHhhhhccCCCCc
Q 035373           47 KKLIDKTLQVADRPGKR   63 (66)
Q Consensus        47 rkLI~ktL~~ADs~~~r   63 (66)
                      ++.|+.|++-||.||=+
T Consensus        27 ~~via~NiAN~~Tpgyk   43 (131)
T PRK12623         27 GKVISNNIANVNTKGYK   43 (131)
T ss_pred             HHHHHhcchhcCCcccC
Confidence            67899999999999854


Done!