Citrus Sinensis ID: 035388


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60------
MQAFADELGIPFLETSAKDAINVEQAFLTMAGEIKKKMGNQPTANKSSGTVQMKGQPIQQNSNCCG
cHHHHHHHcccEEEccccccccHHHHHHHHHHHHHHHHccccccccccccEEcccccccccccccc
*QAFADELGIPFLETSAKDAINVEQAFLTMAG**********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQAFADELGIPFLETSAKDAINVEQAFLTMAGEIKKKMGNQPTANKSSGTVQMKGQPIQQNSNCCG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein RABD1 Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER).probableQ9ZRE2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BCG, chain Y
Confidence level:very confident
Coverage over the Query: 2-38
View the alignment between query and template
View the model in PyMOL
Template: 1UKV, chain Y
Confidence level:confident
Coverage over the Query: 2-58
View the alignment between query and template
View the model in PyMOL