BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035391
         (66 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1U96|A Chain A, Solution Structure Of Yeast Cox17 With Copper Bound
 pdb|1U97|A Chain A, Solution Structure Of Apo Yeast Cox17
 pdb|1Z2G|A Chain A, Solution Structure Of Apo, Oxidized Yeast Cox17
          Length = 69

 Score = 26.9 bits (58), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 31 CDLEKKDYIGCLKSSGHQSENCRIFSKKYLEC 62
          C  EK++   C+  +G  SE C+ F +KY EC
Sbjct: 26 CKPEKEERDTCILFNGQDSEKCKEFIEKYKEC 57


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.137    0.442 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,653,024
Number of Sequences: 62578
Number of extensions: 43292
Number of successful extensions: 72
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 71
Number of HSP's gapped (non-prelim): 3
length of query: 66
length of database: 14,973,337
effective HSP length: 37
effective length of query: 29
effective length of database: 12,657,951
effective search space: 367080579
effective search space used: 367080579
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)