Query         035393
Match_columns 57
No_of_seqs    17 out of 19
Neff          2.6 
Searched_HMMs 46136
Date          Fri Mar 29 02:41:23 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035393.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035393hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09796 QCR10:  Ubiquinol-cyto  94.8    0.02 4.2E-07   34.5   1.7   32   22-53     14-45  (64)
  2 PF08997 UCR_6-4kD:  Ubiquinol-  90.1    0.13 2.8E-06   30.6   0.7   22   20-41     16-37  (56)
  3 TIGR03063 srtB_target sortase   81.5    0.67 1.5E-05   24.5   0.6   24   17-40      2-25  (29)
  4 PF01552 Pico_P2B:  Picornaviru  71.9     3.6 7.8E-05   26.6   2.1   12   40-51     76-87  (99)
  5 COG4083 Predicted membrane pro  54.5     7.1 0.00015   29.0   1.2   33   17-49      8-40  (239)
  6 PF00153 Mito_carr:  Mitochondr  48.4     7.3 0.00016   21.7   0.4   23   29-51     11-33  (95)
  7 KOG0759 Mitochondrial oxogluta  30.0      23 0.00051   26.8   0.7   26   28-53      9-34  (286)
  8 TIGR03656 IsdC heme uptake pro  29.0      20 0.00044   25.9   0.2   26   15-40    185-210 (217)
  9 PTZ00169 ADP/ATP transporter o  27.2      41 0.00089   23.0   1.4   24   27-50     12-35  (300)
 10 PF08102 Antimicrobial_7:  Scor  25.6      42  0.0009   19.3   1.0    8   43-50      4-11  (43)
 11 COG4044 Uncharacterized protei  25.2      33 0.00071   25.7   0.7   14   41-54    109-122 (247)
 12 PF06803 DUF1232:  Protein of u  23.0      23  0.0005   19.1  -0.3   17   32-48      7-23  (40)
 13 COG1962 MtrH Tetrahydromethano  23.0      54  0.0012   25.3   1.5   36   21-56    215-250 (313)
 14 KOG0766 Predicted mitochondria  22.5      45 0.00097   25.5   1.0   24   29-52    220-243 (297)
 15 PF14965 BRI3BP:  Negative regu  22.4      76  0.0016   22.6   2.1   19   17-35     68-86  (177)
 16 COG3182 PiuB Uncharacterized i  21.4      74  0.0016   24.7   2.0   23   22-44    144-166 (442)
 17 PTZ00168 mitochondrial carrier  21.0      68  0.0015   21.7   1.6   26   24-49    181-206 (259)
 18 KOG0753 Mitochondrial fatty ac  21.0      27 0.00058   26.9  -0.4   33   18-50    120-152 (317)
 19 PF14464 Prok-JAB:  Prokaryotic  20.4      45 0.00098   19.0   0.5   14   16-29     74-87  (104)
 20 smart00535 RIBOc Ribonuclease   20.1      59  0.0013   19.2   1.0   25   29-53     97-125 (129)

No 1  
>PF09796 QCR10:  Ubiquinol-cytochrome-c reductase complex subunit (QCR10);  InterPro: IPR019182 This entry represents subunit 10 of the cytochrome b-c1 complex (also known as the ubiquinol-cytochrome c reductase complex or complex III). This complex is located on the inner mitochondrial membrane and it couples electron transfer from ubiquinol to cytochrome. Subunit 10 is required for stable association of the iron-sulphur protein with the complex []. 
Probab=94.80  E-value=0.02  Score=34.48  Aligned_cols=32  Identities=25%  Similarity=0.450  Sum_probs=28.6

Q ss_pred             HHHHHHhhhhhhhhheeeeechhHHHHHhhcc
Q 035393           22 VQAAAFWGVAAVSGALYLIQPFDWLKKTFLEK   53 (57)
Q Consensus        22 i~aaA~WGvaa~~~alwLVQPfDwikktf~ek   53 (57)
                      ...+|+||++++++++..+--+-=++++++.|
T Consensus        14 ~p~~a~wG~aa~~~v~~f~~~vPr~q~dil~K   45 (64)
T PF09796_consen   14 GPNLALWGGAAGAAVLFFTSGVPRFQRDILQK   45 (64)
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCcHHHHHHHHh
Confidence            45789999999999999999998888888877


No 2  
>PF08997 UCR_6-4kD:  Ubiquinol-cytochrome C reductase complex, 6.4kD protein;  InterPro: IPR015089 The ubiquinol-cytochrome C reductase complex (cytochrome bc1 complex) is an essential component of the mitochondrial cellular respiratory chain. This family represents the 6.4 kDa protein, which may be closely linked to the iron-sulphur protein in the complex and function as an iron-sulphur protein-binding factor []. ; GO: 0008121 ubiquinol-cytochrome-c reductase activity, 0009055 electron carrier activity; PDB: 1NTM_K 1SQV_K 1SQB_K 1NU1_K 1SQQ_K 1BE3_K 1BGY_W 2YBB_k 2FYU_K 1L0N_K ....
Probab=90.06  E-value=0.13  Score=30.62  Aligned_cols=22  Identities=27%  Similarity=0.436  Sum_probs=19.4

Q ss_pred             hhHHHHHHhhhhhhhhheeeee
Q 035393           20 VDVQAAAFWGVAAVSGALYLIQ   41 (57)
Q Consensus        20 tDi~aaA~WGvaa~~~alwLVQ   41 (57)
                      .=+.+++.||.+++++.+|+++
T Consensus        16 ~w~ps~~~~G~~~~l~lvy~TD   37 (56)
T PF08997_consen   16 NWIPSAAAWGAAGGLALVYFTD   37 (56)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HhchhHHHHhhhhhhheeeecc
Confidence            3467899999999999999997


No 3  
>TIGR03063 srtB_target sortase B cell surface sorting signal. Two different classes of sorting signal, both analogous to the sortase A signal LPXTG, may be recognized by the sortase SrtB. These are given as NXZTN and NPKXZ. Proteins sorted by this class of sortase are less common than the sortase A and LPXTG system. This model describes a number of cell surface protein C-terminal regions from Gram-positive bacteria that appear to be sortase B (SrtB) sorting signals.
Probab=81.48  E-value=0.67  Score=24.46  Aligned_cols=24  Identities=21%  Similarity=0.358  Sum_probs=21.4

Q ss_pred             CChhhHHHHHHhhhhhhhhheeee
Q 035393           17 LQPVDVQAAAFWGVAAVSGALYLI   40 (57)
Q Consensus        17 pQ~tDi~aaA~WGvaa~~~alwLV   40 (57)
                      ||+.|-..+++|++..+..+++|+
T Consensus         2 PkT~D~a~i~ly~~l~~~s~~~Li   25 (29)
T TIGR03063         2 PKTGDSAQIGLYAVLFLGSGLFLI   25 (29)
T ss_pred             CCCccchhHHHHHHHHHHHHHHHh
Confidence            899999999999999988888875


No 4  
>PF01552 Pico_P2B:  Picornavirus 2B protein;  InterPro: IPR002527 Poliovirus infection leads to drastic alterations in membrane permeability late during infection. Proteins 2B and 2BC enhance membrane permeability [, ].; GO: 0000166 nucleotide binding, 0003968 RNA-directed RNA polymerase activity, 0005198 structural molecule activity, 0008233 peptidase activity, 0008234 cysteine-type peptidase activity, 0016740 transferase activity, 0016779 nucleotidyltransferase activity, 0016787 hydrolase activity, 0018144 RNA-protein covalent cross-linking, 0019012 virion
Probab=71.93  E-value=3.6  Score=26.61  Aligned_cols=12  Identities=33%  Similarity=0.744  Sum_probs=10.7

Q ss_pred             eechhHHHHHhh
Q 035393           40 IQPFDWLKKTFL   51 (57)
Q Consensus        40 VQPfDwikktf~   51 (57)
                      .-||+|||+++-
T Consensus        76 ~sPw~~LK~Kvc   87 (99)
T PF01552_consen   76 GSPWRWLKSKVC   87 (99)
T ss_pred             CCHHHHHHHHHH
Confidence            899999999874


No 5  
>COG4083 Predicted membrane protein [Function unknown]
Probab=54.54  E-value=7.1  Score=29.04  Aligned_cols=33  Identities=21%  Similarity=0.000  Sum_probs=27.3

Q ss_pred             CChhhHHHHHHhhhhhhhhheeeeechhHHHHH
Q 035393           17 LQPVDVQAAAFWGVAAVSGALYLIQPFDWLKKT   49 (57)
Q Consensus        17 pQ~tDi~aaA~WGvaa~~~alwLVQPfDwikkt   49 (57)
                      |-..|+..-|+-|+-++-++.|..||+|+|..|
T Consensus         8 p~li~v~~~ag~~gWavFs~~wg~~i~hyl~vq   40 (239)
T COG4083           8 PALIDVARYAGVGGWAVFSLFWGLLIEHYLFVQ   40 (239)
T ss_pred             HHHHHHHHHhcchHHHHHHHHHhhhhHHHHHHH
Confidence            456778787877777888899999999999865


No 6  
>PF00153 Mito_carr:  Mitochondrial carrier protein;  InterPro: IPR018108 A variety of substrate carrier proteins that are involved in energy transfer are found in the inner mitochondrial membrane or integral to the membrane of other eukaryotic organelles such as the peroxisome [, , , , , ]. Such proteins include: ADP, ATP carrier protein (ADP/ATP translocase); 2-oxoglutarate/malate carrier protein; phosphate carrier protein; tricarboxylate transport protein (or citrate transport protein); Graves disease carrier protein; yeast mitochondrial proteins MRS3 and MRS4; yeast mitochondrial FAD carrier protein; and many others. Structurally, these proteins can consist of up to three tandem repeats of a domain of approximately 100 residues, each domain containing two transmembrane regions.; PDB: 2LCK_A 2C3E_A 1OKC_A.
Probab=48.38  E-value=7.3  Score=21.66  Aligned_cols=23  Identities=22%  Similarity=0.251  Sum_probs=16.5

Q ss_pred             hhhhhhhheeeeechhHHHHHhh
Q 035393           29 GVAAVSGALYLIQPFDWLKKTFL   51 (57)
Q Consensus        29 Gvaa~~~alwLVQPfDwikktf~   51 (57)
                      |.++++.+--++.|+|-||-..-
T Consensus        11 g~~ag~~~~~~~~Pld~ik~~~q   33 (95)
T PF00153_consen   11 GALAGAISTLVTYPLDTIKTRMQ   33 (95)
T ss_dssp             HHHHHHHHHHHCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhHHHHHhHhhc
Confidence            44555556667899999987765


No 7  
>KOG0759 consensus Mitochondrial oxoglutarate/malate carrier proteins [Energy production and conversion]
Probab=29.97  E-value=23  Score=26.78  Aligned_cols=26  Identities=27%  Similarity=0.365  Sum_probs=21.6

Q ss_pred             hhhhhhhhheeeeechhHHHHHhhcc
Q 035393           28 WGVAAVSGALYLIQPFDWLKKTFLEK   53 (57)
Q Consensus        28 WGvaa~~~alwLVQPfDwikktf~ek   53 (57)
                      -|+.++++|--++||-|-||.+.-.-
T Consensus         9 ~GGla~~~A~~~thPlDLvKvrmQ~~   34 (286)
T KOG0759|consen    9 FGGLAGMGATCVTHPLDLVKVRMQLQ   34 (286)
T ss_pred             eccHHHHHHHHHcCcHHHHHHHHHHc
Confidence            37888899999999999999876443


No 8  
>TIGR03656 IsdC heme uptake protein IsdC. Isd proteins are iron-regulated surface proteins found in Bacillus, Staphylococcus and Listeria species and are responsible for heme scavenging from hemoproteins. The IsdC protein consists of an N-terminal hydrophobic signal sequence, a central NEAT (NEAr Transporter, pfam05031) domain which confers the ability to bind heme and a C-terminal SrtB processing signal which targets the protein to the cell wall. IsdC is believed to make a direct contact with, and transfer heme to, the heme-binding component (IsdE) of an ABC transporter in the cytoplasmic membrane, and to receive heme from other NEAT-containing heme-binding proteins also localized in the cell wall.
Probab=28.97  E-value=20  Score=25.89  Aligned_cols=26  Identities=19%  Similarity=0.199  Sum_probs=22.7

Q ss_pred             cCCChhhHHHHHHhhhhhhhhheeee
Q 035393           15 SRLQPVDVQAAAFWGVAAVSGALYLI   40 (57)
Q Consensus        15 ~rpQ~tDi~aaA~WGvaa~~~alwLV   40 (57)
                      --||..|=+.+.+|++..+..+.+|+
T Consensus       185 ~np~t~d~~~~~l~~~~~~~~~~~l~  210 (217)
T TIGR03656       185 DNPQTGDGTPIYLYAIALLIAGALLI  210 (217)
T ss_pred             CCCCcCccchhHHHHHHHHHHHHHHH
Confidence            35999999999999999998888776


No 9  
>PTZ00169 ADP/ATP transporter on adenylate translocase; Provisional
Probab=27.18  E-value=41  Score=23.00  Aligned_cols=24  Identities=13%  Similarity=0.184  Sum_probs=18.7

Q ss_pred             HhhhhhhhhheeeeechhHHHHHh
Q 035393           27 FWGVAAVSGALYLIQPFDWLKKTF   50 (57)
Q Consensus        27 ~WGvaa~~~alwLVQPfDwikktf   50 (57)
                      +-|..+++.+--++.|+|-||-..
T Consensus        12 ~aG~~ag~~~~~~~~Pld~vKtrl   35 (300)
T PTZ00169         12 LMGGISAAISKTAVAPIERVKMLI   35 (300)
T ss_pred             HHHHHHHHHHHHhcCcHhHheeee
Confidence            457777777778889999998654


No 10 
>PF08102 Antimicrobial_7:  Scorpion antimicrobial peptide ;  InterPro: IPR012526 This family consists of antimicrobial peptides secreted by scorpions. Novel antimicrobial peptides have been isolated from scorpions, namely the opistoporin [] and the pandinin []. These peptides form essentially helical structures and demonstrate high antimicrobial activity against Gram-negative and Gram-positive bacteria respectively.; GO: 0005576 extracellular region
Probab=25.56  E-value=42  Score=19.30  Aligned_cols=8  Identities=50%  Similarity=1.199  Sum_probs=6.5

Q ss_pred             hhHHHHHh
Q 035393           43 FDWLKKTF   50 (57)
Q Consensus        43 fDwikktf   50 (57)
                      |||||.+.
T Consensus         4 wd~IK~~A   11 (43)
T PF08102_consen    4 WDWIKSTA   11 (43)
T ss_pred             HHHHHHHH
Confidence            89998764


No 11 
>COG4044 Uncharacterized protein conserved in archaea [Function unknown]
Probab=25.19  E-value=33  Score=25.69  Aligned_cols=14  Identities=50%  Similarity=0.553  Sum_probs=12.7

Q ss_pred             echhHHHHHhhccC
Q 035393           41 QPFDWLKKTFLEKS   54 (57)
Q Consensus        41 QPfDwikktf~ek~   54 (57)
                      -|--|||.||.|||
T Consensus       109 vply~Lk~~~gekp  122 (247)
T COG4044         109 VPLYELKRTFGEKP  122 (247)
T ss_pred             ccHHHHHhccCCCc
Confidence            48889999999999


No 12 
>PF06803 DUF1232:  Protein of unknown function (DUF1232);  InterPro: IPR010652 This family represents a conserved region of approximately 60 residues within a number of hypothetical bacterial and archaeal proteins of unknown function.
Probab=23.02  E-value=23  Score=19.09  Aligned_cols=17  Identities=24%  Similarity=0.579  Sum_probs=13.6

Q ss_pred             hhhhheeeeechhHHHH
Q 035393           32 AVSGALYLIQPFDWLKK   48 (57)
Q Consensus        32 a~~~alwLVQPfDwikk   48 (57)
                      .+.+.+|++-|+|-|-+
T Consensus         7 ~~~al~Y~isP~D~iPD   23 (40)
T PF06803_consen    7 ILAALAYFISPIDLIPD   23 (40)
T ss_pred             HHHHHHHHhchhhhCCC
Confidence            45678899999998765


No 13 
>COG1962 MtrH Tetrahydromethanopterin S-methyltransferase, subunit H [Coenzyme metabolism]
Probab=22.98  E-value=54  Score=25.28  Aligned_cols=36  Identities=22%  Similarity=0.315  Sum_probs=29.2

Q ss_pred             hHHHHHHhhhhhhhhheeeeechhHHHHHhhccCCC
Q 035393           21 DVQAAAFWGVAAVSGALYLIQPFDWLKKTFLEKSEE   56 (57)
Q Consensus        21 Di~aaA~WGvaa~~~alwLVQPfDwikktf~ek~e~   56 (57)
                      .++.=+-||.-.++|+==..--||||++.+-.-||+
T Consensus       215 ~~~vK~k~G~PvGsg~HN~psaWdwlr~~~kk~~e~  250 (313)
T COG1962         215 TIAVKAKLGLPVGSGIHNAPSAWDWLREFKKKLPEA  250 (313)
T ss_pred             hhhhHHhcCCccCcccccCchHHHHHHHHHhhCccc
Confidence            344557899999999999999999999977655664


No 14 
>KOG0766 consensus Predicted mitochondrial carrier protein [Energy production and conversion]
Probab=22.47  E-value=45  Score=25.51  Aligned_cols=24  Identities=29%  Similarity=0.332  Sum_probs=18.3

Q ss_pred             hhhhhhhheeeeechhHHHHHhhc
Q 035393           29 GVAAVSGALYLIQPFDWLKKTFLE   52 (57)
Q Consensus        29 Gvaa~~~alwLVQPfDwikktf~e   52 (57)
                      |+.++..|--.+||||=||-..-.
T Consensus       220 gi~sg~lAt~vT~Pfd~iKTrmQL  243 (297)
T KOG0766|consen  220 GIFSGILATLVTQPFDVIKTRMQL  243 (297)
T ss_pred             HHHHHHHHHHhcCchhhhhhhhcc
Confidence            566777777889999999875433


No 15 
>PF14965 BRI3BP:  Negative regulator of p53/TP53
Probab=22.37  E-value=76  Score=22.59  Aligned_cols=19  Identities=32%  Similarity=0.663  Sum_probs=16.1

Q ss_pred             CChhhHHHHHHhhhhhhhh
Q 035393           17 LQPVDVQAAAFWGVAAVSG   35 (57)
Q Consensus        17 pQ~tDi~aaA~WGvaa~~~   35 (57)
                      -+|..|+++..||.++..|
T Consensus        68 ~SP~~V~~~llw~~~aL~~   86 (177)
T PF14965_consen   68 FSPGGVQTVLLWGAVALLA   86 (177)
T ss_pred             cCHHHHHHHHHHHHHHHHH
Confidence            4678999999999988765


No 16 
>COG3182 PiuB Uncharacterized iron-regulated membrane protein [Function unknown]
Probab=21.39  E-value=74  Score=24.74  Aligned_cols=23  Identities=30%  Similarity=0.359  Sum_probs=20.6

Q ss_pred             HHHHHHhhhhhhhhheeeeechh
Q 035393           22 VQAAAFWGVAAVSGALYLIQPFD   44 (57)
Q Consensus        22 i~aaA~WGvaa~~~alwLVQPfD   44 (57)
                      |+.+|.|.+++.++++||.=|+.
T Consensus       144 ve~aa~~~i~~lVsG~~L~~pr~  166 (442)
T COG3182         144 VELAALLLIVLLVSGLYLWWPRR  166 (442)
T ss_pred             HHHHHHHHHHHHHhhheeeeecc
Confidence            67899999999999999988863


No 17 
>PTZ00168 mitochondrial carrier protein; Provisional
Probab=21.05  E-value=68  Score=21.73  Aligned_cols=26  Identities=31%  Similarity=0.301  Sum_probs=21.2

Q ss_pred             HHHHhhhhhhhhheeeeechhHHHHH
Q 035393           24 AAAFWGVAAVSGALYLIQPFDWLKKT   49 (57)
Q Consensus        24 aaA~WGvaa~~~alwLVQPfDwikkt   49 (57)
                      ...+-|..+++.+-.+++|+|=+|..
T Consensus       181 ~~~~aG~~ag~~a~~~t~P~DvvKtr  206 (259)
T PTZ00168        181 TSAICGGLAGGIAGFLTTPVDVIKSR  206 (259)
T ss_pred             HHHHHHHHHHHHHHHhCChHHHHHHH
Confidence            34567888888888999999999875


No 18 
>KOG0753 consensus Mitochondrial fatty acid anion carrier protein/Uncoupling protein [Energy production and conversion]
Probab=21.03  E-value=27  Score=26.90  Aligned_cols=33  Identities=24%  Similarity=0.265  Sum_probs=27.1

Q ss_pred             ChhhHHHHHHhhhhhhhhheeeeechhHHHHHh
Q 035393           18 QPVDVQAAAFWGVAAVSGALYLIQPFDWLKKTF   50 (57)
Q Consensus        18 Q~tDi~aaA~WGvaa~~~alwLVQPfDwikktf   50 (57)
                      ..--+-...+=|+++++.|.++-||.|-+|.++
T Consensus       120 ~~~~l~~~~l~G~taGaia~~~AnPtDlVKVrm  152 (317)
T KOG0753|consen  120 ESLPLWKSILCGVTAGAIAQALANPTDLVKVRM  152 (317)
T ss_pred             ccccHHHHHHHHHhhhHHHHHhcCccceEEEEe
Confidence            334466677789999999999999999999765


No 19 
>PF14464 Prok-JAB:  Prokaryotic homologs of the JAB domain; PDB: 1OI0_A 1R5X_B 2KKS_A 2KCQ_A.
Probab=20.38  E-value=45  Score=19.04  Aligned_cols=14  Identities=7%  Similarity=-0.009  Sum_probs=9.8

Q ss_pred             CCChhhHHHHHHhh
Q 035393           16 RLQPVDVQAAAFWG   29 (57)
Q Consensus        16 rpQ~tDi~aaA~WG   29 (57)
                      +|+.+|++.+.-++
T Consensus        74 ~pS~~D~~~~~~~~   87 (104)
T PF14464_consen   74 FPSSTDIRSMRDLA   87 (104)
T ss_dssp             S--HHHHHTHCCS-
T ss_pred             CCCHHHHHhhhccC
Confidence            79999999988875


No 20 
>smart00535 RIBOc Ribonuclease III family.
Probab=20.12  E-value=59  Score=19.20  Aligned_cols=25  Identities=20%  Similarity=0.337  Sum_probs=18.5

Q ss_pred             hhhhhhhheeeeec----hhHHHHHhhcc
Q 035393           29 GVAAVSGALYLIQP----FDWLKKTFLEK   53 (57)
Q Consensus        29 Gvaa~~~alwLVQP----fDwikktf~ek   53 (57)
                      .+=|.+||+|+-.-    .+||++-+.++
T Consensus        97 ~~eAliGAi~ld~g~~~~~~~i~~~~~~~  125 (129)
T smart00535       97 VFEALIGAIYLDSGLEAAREFIRDLLGPR  125 (129)
T ss_pred             HHHHHHHHHHHhCCHHHHHHHHHHHHHHH
Confidence            56788999999987    55666666544


Done!