BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035404
(53 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3L8A|A Chain A, Crystal Structure Of Metc From Streptococcus Mutans
pdb|3L8A|B Chain B, Crystal Structure Of Metc From Streptococcus Mutans
Length = 421
Score = 27.7 bits (60), Expect = 1.8, Method: Composition-based stats.
Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 9/43 (20%)
Query: 13 TLALVARASAFTFG---------VVYGNMKLKILKMKAKTHSK 46
T+ ++A +AF +G V+ GN+KL I +++AKT K
Sbjct: 305 TVGMIATQAAFQYGKPWLEELKTVIEGNIKLVIKELEAKTKIK 347
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.127 0.365
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,528,370
Number of Sequences: 62578
Number of extensions: 33740
Number of successful extensions: 47
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 46
Number of HSP's gapped (non-prelim): 2
length of query: 53
length of database: 14,973,337
effective HSP length: 25
effective length of query: 28
effective length of database: 13,408,887
effective search space: 375448836
effective search space used: 375448836
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)