BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035404
         (53 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3L8A|A Chain A, Crystal Structure Of Metc From Streptococcus Mutans
 pdb|3L8A|B Chain B, Crystal Structure Of Metc From Streptococcus Mutans
          Length = 421

 Score = 27.7 bits (60), Expect = 1.8,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 9/43 (20%)

Query: 13  TLALVARASAFTFG---------VVYGNMKLKILKMKAKTHSK 46
           T+ ++A  +AF +G         V+ GN+KL I +++AKT  K
Sbjct: 305 TVGMIATQAAFQYGKPWLEELKTVIEGNIKLVIKELEAKTKIK 347


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.127    0.365 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,528,370
Number of Sequences: 62578
Number of extensions: 33740
Number of successful extensions: 47
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 46
Number of HSP's gapped (non-prelim): 2
length of query: 53
length of database: 14,973,337
effective HSP length: 25
effective length of query: 28
effective length of database: 13,408,887
effective search space: 375448836
effective search space used: 375448836
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)