Citrus Sinensis ID: 035406


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50-------
MSNEYDYLFKLLLIGDSSVGKSCLLLRFADDSYVDSYISTIGVDFVSLSSIYMYICV
ccccccEEEEEEEEEcccccHHEEEEEEcccccccccEEEEEEEEEEEEEEEEEEEc
**NEYDYLFKLLLIGDSSVGKSCLLLRFADDSYVDSYISTIGVDFVSLSSIYMYICV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNEYDYLFKLLLIGDSSVGKSCLLLRFADDSYVDSYISTIGVDFVSLSSIYMYICV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein RABD1 Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER).probableQ9ZRE2
GTP-binding protein ypt1 Protein transport. Probably involved in vesicular traffic.probableP11620
Ras-related protein Rab-1B probableP34140

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TW8, chain B
Confidence level:very confident
Coverage over the Query: 5-51
View the alignment between query and template
View the model in PyMOL