BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035423
(35 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3H0G|L Chain L, Rna Polymerase Ii From Schizosaccharomyces Pombe
pdb|3H0G|X Chain X, Rna Polymerase Ii From Schizosaccharomyces Pombe
Length = 63
Score = 50.1 bits (118), Expect = 3e-07, Method: Compositional matrix adjust.
Identities = 20/33 (60%), Positives = 30/33 (90%)
Query: 3 NTLKPGDVIQCRECGYRILYKKRTRRIVQYEAR 35
NT++ +VI+CRECG+R++YK RT+R+VQ+EAR
Sbjct: 31 NTIQAKEVIRCRECGHRVMYKMRTKRMVQFEAR 63
>pdb|1I3Q|L Chain L, Rna Polymerase Ii Crystal Form I At 3.1 A Resolution
pdb|1I50|L Chain L, Rna Polymerase Ii Crystal Form Ii At 2.8 A Resolution
pdb|1I6H|L Chain L, Rna Polymerase Ii Elongation Complex
pdb|1K83|L Chain L, Crystal Structure Of Yeast Rna Polymerase Ii Complexed
With The Inhibitor Alpha Amanitin
pdb|1NIK|L Chain L, Wild Type Rna Polymerase Ii
pdb|1NT9|L Chain L, Complete 12-Subunit Rna Polymerase Ii
pdb|1PQV|L Chain L, Rna Polymerase Ii-Tfiis Complex
pdb|1R5U|L Chain L, Rna Polymerase Ii Tfiib Complex
pdb|1SFO|L Chain L, Rna Polymerase Ii Strand Separated Elongation Complex
pdb|1R9S|L Chain L, Rna Polymerase Ii Strand Separated Elongation Complex,
Matched Nucleotide
pdb|1R9T|L Chain L, Rna Polymerase Ii Strand Separated Elongation Complex,
Mismatched Nucleotide
pdb|1TWA|L Chain L, Rna Polymerase Ii Complexed With Atp
pdb|1TWC|L Chain L, Rna Polymerase Ii Complexed With Gtp
pdb|1TWF|L Chain L, Rna Polymerase Ii Complexed With Utp At 2.3 A Resolution
pdb|1TWG|L Chain L, Rna Polymerase Ii Complexed With Ctp
pdb|1TWH|L Chain L, Rna Polymerase Ii Complexed With 2'datp
pdb|1WCM|L Chain L, Complete 12-Subunit Rna Polymerase Ii At 3.8 Ang
pdb|1Y1W|L Chain L, Complete Rna Polymerase Ii Elongation Complex
pdb|1Y77|L Chain L, Complete Rna Polymerase Ii Elongation Complex With
Substrate Analogue Gmpcpp
pdb|1Y1V|L Chain L, Refined Rna Polymerase Ii-tfiis Complex
pdb|1Y1Y|L Chain L, Rna Polymerase Ii-Tfiis-DnaRNA COMPLEX
pdb|2B63|L Chain L, Complete Rna Polymerase Ii-Rna Inhibitor Complex
pdb|2B8K|L Chain L, 12-Subunit Rna Polymerase Ii
pdb|2E2H|L Chain L, Rna Polymerase Ii Elongation Complex At 5 Mm Mg2+ With
Gtp
pdb|2E2I|L Chain L, Rna Polymerase Ii Elongation Complex In 5 Mm Mg+2 With
2'- Dgtp
pdb|2E2J|L Chain L, Rna Polymerase Ii Elongation Complex In 5 Mm Mg+2 With
Gmpcpp
pdb|2NVQ|L Chain L, Rna Polymerase Ii Elongation Complex In 150 Mm Mg+2 With
2'dutp
pdb|2NVT|L Chain L, Rna Polymerase Ii Elongation Complex In 150 Mm Mg+2 With
Gmpcpp
pdb|2NVX|L Chain L, Rna Polymerase Ii Elongation Complex In 5 Mm Mg+2 With
2'- Dutp
pdb|2NVY|L Chain L, Rna Polymerase Ii Form Ii In 150 Mm Mn+2
pdb|2NVZ|L Chain L, Rna Polymerase Ii Elongation Complex With Utp, Updated
112006
pdb|2JA5|L Chain L, Cpd Lesion Containing Rna Polymerase Ii Elongation
Complex A
pdb|2JA6|L Chain L, Cpd Lesion Containing Rna Polymerase Ii Elongation
Complex B
pdb|2JA7|L Chain L, Cpd Lesion Containing Rna Polymerase Ii Elongation
Complex C
pdb|2JA7|X Chain X, Cpd Lesion Containing Rna Polymerase Ii Elongation
Complex C
pdb|2JA8|L Chain L, Cpd Lesion Containing Rna Polymerase Ii Elongation
Complex D
pdb|2YU9|L Chain L, Rna Polymerase Ii Elongation Complex In 150 Mm Mg+2 With
Utp
pdb|2R7Z|L Chain L, Cisplatin Lesion Containing Rna Polymerase Ii Elongation
Complex
pdb|2R92|L Chain L, Elongation Complex Of Rna Polymerase Ii With Artificial
Rdrp Scaffold
pdb|2R93|L Chain L, Elongation Complex Of Rna Polymerase Ii With A Hepatitis
Delta Virus-Derived Rna Stem Loop
pdb|3CQZ|L Chain L, Crystal Structure Of 10 Subunit Rna Polymerase Ii In
Complex With The Inhibitor Alpha-Amanitin
pdb|2VUM|L Chain L, Alpha-Amanitin Inhibited Complete Rna Polymerase Ii
Elongation Complex
pdb|3FKI|L Chain L, 12-Subunit Rna Polymerase Ii Refined With Zn-Sad Data
pdb|3GTG|L Chain L, Backtracked Rna Polymerase Ii Complex With 12mer Rna
pdb|3GTJ|L Chain L, Backtracked Rna Polymerase Ii Complex With 13mer Rna
pdb|3GTK|L Chain L, Backtracked Rna Polymerase Ii Complex With 18mer Rna
pdb|3GTL|L Chain L, Backtracked Rna Polymerase Ii Complex With 13mer With
G<>u Mismatch
pdb|3GTM|L Chain L, Co-Complex Of Backtracked Rna Polymerase Ii With Tfiis
pdb|3GTO|L Chain L, Backtracked Rna Polymerase Ii Complex With 15mer Rna
pdb|3GTP|L Chain L, Backtracked Rna Polymerase Ii Complex With 24mer Rna
pdb|3GTQ|L Chain L, Backtracked Rna Polymerase Ii Complex Induced By Damage
pdb|3H3V|M Chain M, Yeast Rnap Ii Containing Poly(A)-Signal Sequence In The
Active Site
pdb|3HOU|L Chain L, Complete Rna Polymerase Ii Elongation Complex I With A
T-U Mismatch
pdb|3HOU|X Chain X, Complete Rna Polymerase Ii Elongation Complex I With A
T-U Mismatch
pdb|3HOV|L Chain L, Complete Rna Polymerase Ii Elongation Complex Ii
pdb|3HOW|L Chain L, Complete Rna Polymerase Ii Elongation Complex Iii With A
T-U Mismatch And A Frayed Rna 3'-Uridine
pdb|3HOX|L Chain L, Complete Rna Polymerase Ii Elongation Complex V
pdb|3HOY|L Chain L, Complete Rna Polymerase Ii Elongation Complex Vi
pdb|3HOZ|L Chain L, Complete Rna Polymerase Ii Elongation Complex Iv With A
T-U Mismatch And A Frayed Rna 3'-Guanine
pdb|3I4M|L Chain L, 8-oxoguanine Containing Rna Polymerase Ii Elongation
Complex D
pdb|3I4N|L Chain L, 8-oxoguanine Containing Rna Polymerase Ii Elongation
Complex E
pdb|3K1F|L Chain L, Crystal Structure Of Rna Polymerase Ii In Complex With
Tfiib
pdb|3K7A|L Chain L, Crystal Structure Of An Rna Polymerase Ii-Tfiib Complex
pdb|3M3Y|L Chain L, Rna Polymerase Ii Elongation Complex C
pdb|3M4O|L Chain L, Rna Polymerase Ii Elongation Complex B
pdb|3PO2|L Chain L, Arrested Rna Polymerase Ii Elongation Complex
pdb|3PO3|L Chain L, Arrested Rna Polymerase Ii Reactivation Intermediate
pdb|3QT1|L Chain L, Rna Polymerase Ii Variant Containing A Chimeric Rpb9-C11
Subunit
pdb|3RZD|L Chain L, Rna Polymerase Ii Initiation Complex With A 5-Nt Rna
pdb|3RZO|L Chain L, Rna Polymerase Ii Initiation Complex With A 4-Nt Rna
pdb|3S14|L Chain L, Rna Polymerase Ii Initiation Complex With A 6-Nt Rna
pdb|3S15|L Chain L, Rna Polymerase Ii Initiation Complex With A 7-Nt Rna
pdb|3S16|L Chain L, Rna Polymerase Ii Initiation Complex With An 8-Nt Rna
pdb|3S17|L Chain L, Rna Polymerase Ii Initiation Complex With A 9-Nt Rna
pdb|3S1M|L Chain L, Rna Polymerase Ii Initiation Complex With A 5-Nt Rna
(Variant 1)
pdb|3S1N|L Chain L, Rna Polymerase Ii Initiation Complex With A 5-Nt Rna
(Variant 2)
pdb|3S1Q|L Chain L, Rna Polymerase Ii Initiation Complex With A 5-Nt
3'-Deoxy Rna Soaked With Atp
pdb|3S1R|L Chain L, Rna Polymerase Ii Initiation Complex With A 5-Nt
3'-Deoxy Rna Soaked With Gtp
pdb|3S2D|L Chain L, Rna Polymerase Ii Initiation Complex With A 5-Nt Rna
Containing A 5br- U
pdb|3S2H|L Chain L, Rna Polymerase Ii Initiation Complex With A 6-Nt Rna
Containing A 2[prime]-Iodo Atp
pdb|4A3C|L Chain L, Rna Polymerase Ii Initial Transcribing Complex With A
5nt Dna-Rna Hybrid
pdb|4A3B|L Chain L, Rna Polymerase Ii Initial Transcribing Complex With A
4nt Dna-Rna Hybrid
pdb|4A3D|L Chain L, Rna Polymerase Ii Initial Transcribing Complex With A
6nt Dna-Rna Hybrid
pdb|4A3E|L Chain L, Rna Polymerase Ii Initial Transcribing Complex With A
5nt Dna-Rna Hybrid And Soaked With Ampcpp
pdb|4A3F|L Chain L, Rna Polymerase Ii Initial Transcribing Complex With A
6nt Dna-Rna Hybrid And Soaked With Ampcpp
pdb|4A3J|L Chain L, Rna Polymerase Ii Initial Transcribing Complex With A
2nt Dna-Rna Hybrid And Soaked With Gmpcpp
pdb|4A3K|L Chain L, Rna Polymerase Ii Initial Transcribing Complex With A
7nt Dna-Rna Hybrid
pdb|4A3L|L Chain L, Rna Polymerase Ii Initial Transcribing Complex With A
7nt Dna-Rna Hybrid And Soaked With Ampcpp
pdb|4A3M|L Chain L, Rna Polymerase Ii Initial Transcribing Complex With A
4nt Dna-Rna Hybrid And Soaked With Ampcpp
pdb|4A3G|L Chain L, Rna Polymerase Ii Initial Transcribing Complex With A
2nt Dna-Rna Hybrid
pdb|4A3I|L Chain L, Rna Polymerase Ii Binary Complex With Dna
pdb|4A93|L Chain L, Rna Polymerase Ii Elongation Complex Containing A Cpd
Lesion
pdb|4BBR|L Chain L, Structure Of Rna Polymerase Ii-tfiib Complex
pdb|4BBS|L Chain L, Structure Of An Initially Transcribing Rna Polymerase
Ii- Tfiib Complex
Length = 70
Score = 44.7 bits (104), Expect = 1e-05, Method: Compositional matrix adjust.
Identities = 17/32 (53%), Positives = 26/32 (81%)
Query: 4 TLKPGDVIQCRECGYRILYKKRTRRIVQYEAR 35
+L D ++C++CG+RIL K RT+R+VQ+EAR
Sbjct: 39 SLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 70
>pdb|3J0K|L Chain L, Orientation Of Rna Polymerase Ii Within The Human
Vp16-Mediator-Pol Ii-Tfiif Assembly
Length = 46
Score = 44.3 bits (103), Expect = 2e-05, Method: Compositional matrix adjust.
Identities = 17/32 (53%), Positives = 26/32 (81%)
Query: 4 TLKPGDVIQCRECGYRILYKKRTRRIVQYEAR 35
+L D ++C++CG+RIL K RT+R+VQ+EAR
Sbjct: 15 SLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 46
>pdb|2RQA|A Chain A, Solution Structure Of Lgp2 Ctd
Length = 137
Score = 26.2 bits (56), Expect = 4.4, Method: Composition-based stats.
Identities = 9/12 (75%), Positives = 9/12 (75%)
Query: 6 KPGDVIQCRECG 17
KPG VI CR CG
Sbjct: 64 KPGGVISCRNCG 75
>pdb|3EQT|A Chain A, Crystal Structure Of Human Lgp2 C-Terminal Domain In
Complex With Dsrna
pdb|3EQT|B Chain B, Crystal Structure Of Human Lgp2 C-Terminal Domain In
Complex With Dsrna
Length = 145
Score = 26.2 bits (56), Expect = 4.4, Method: Composition-based stats.
Identities = 9/12 (75%), Positives = 9/12 (75%)
Query: 6 KPGDVIQCRECG 17
KPG VI CR CG
Sbjct: 65 KPGGVISCRNCG 76
>pdb|2W4R|A Chain A, Crystal Structure Of The Regulatory Domain Of Human Lgp2
pdb|2W4R|B Chain B, Crystal Structure Of The Regulatory Domain Of Human Lgp2
pdb|2W4R|C Chain C, Crystal Structure Of The Regulatory Domain Of Human Lgp2
pdb|2W4R|D Chain D, Crystal Structure Of The Regulatory Domain Of Human Lgp2
Length = 142
Score = 25.8 bits (55), Expect = 6.4, Method: Composition-based stats.
Identities = 9/12 (75%), Positives = 9/12 (75%)
Query: 6 KPGDVIQCRECG 17
KPG VI CR CG
Sbjct: 69 KPGGVISCRNCG 80
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.142 0.433
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 975,736
Number of Sequences: 62578
Number of extensions: 16769
Number of successful extensions: 62
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 56
Number of HSP's gapped (non-prelim): 6
length of query: 35
length of database: 14,973,337
effective HSP length: 9
effective length of query: 26
effective length of database: 14,410,135
effective search space: 374663510
effective search space used: 374663510
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)