Query         035423
Match_columns 35
No_of_seqs    100 out of 153
Neff          4.7 
Searched_HMMs 46136
Date          Fri Mar 29 02:53:56 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035423.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035423hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 smart00659 RPOLCX RNA polymera  99.8 3.6E-20 7.8E-25   90.9   4.1   34    2-35     11-44  (44)
  2 KOG3507 DNA-directed RNA polym  99.8 1.1E-20 2.4E-25   99.0  -1.5   35    1-35     28-62  (62)
  3 COG1996 RPC10 DNA-directed RNA  99.6 6.5E-16 1.4E-20   77.9   3.4   31    5-35     19-49  (49)
  4 PF03604 DNA_RNApol_7kD:  DNA d  99.6 3.6E-16 7.8E-21   72.9   1.5   25    1-25      8-32  (32)
  5 PRK00398 rpoP DNA-directed RNA  98.9 1.7E-09 3.7E-14   52.1   3.5   26   10-35     21-46  (46)
  6 COG1579 Zn-ribbon protein, pos  96.1  0.0013 2.8E-08   41.3  -0.2   18    6-24    217-234 (239)
  7 PF14255 Cys_rich_CPXG:  Cystei  93.4   0.037 8.1E-07   27.8   0.9   12   11-22      1-12  (52)
  8 PF13408 Zn_ribbon_recom:  Reco  92.2    0.29 6.3E-06   23.0   3.0   21    8-28      3-23  (58)
  9 TIGR02098 MJ0042_CXXC MJ0042 f  91.9    0.19 4.1E-06   22.6   2.0   14    8-21     23-36  (38)
 10 PF10571 UPF0547:  Uncharacteri  91.7   0.071 1.5E-06   23.4   0.5   12    8-19     12-23  (26)
 11 PF09538 FYDLN_acid:  Protein o  90.9    0.13 2.9E-06   28.8   1.1   14    5-19     22-35  (108)
 12 PF12760 Zn_Tnp_IS1595:  Transp  90.4    0.48   1E-05   22.4   2.8   22    5-26     13-34  (46)
 13 PF01215 COX5B:  Cytochrome c o  90.4    0.13 2.9E-06   30.1   0.9   15    5-19    107-121 (136)
 14 PF13719 zinc_ribbon_5:  zinc-r  90.3    0.26 5.7E-06   22.6   1.7   15    6-20     21-35  (37)
 15 cd00924 Cyt_c_Oxidase_Vb Cytoc  90.0    0.18 3.9E-06   27.9   1.2   19    5-23     74-92  (97)
 16 PF11672 DUF3268:  Protein of u  89.6    0.23 5.1E-06   27.8   1.4   13   10-22      2-14  (102)
 17 PF10276 zf-CHCC:  Zinc-finger   89.4    0.24 5.3E-06   23.7   1.2   11    9-19     28-38  (40)
 18 PF13248 zf-ribbon_3:  zinc-rib  89.3    0.15 3.3E-06   21.9   0.4   10   10-19      2-11  (26)
 19 PF13717 zinc_ribbon_4:  zinc-r  89.0    0.35 7.6E-06   22.2   1.6   14    7-20     22-35  (36)
 20 PF09855 DUF2082:  Nucleic-acid  88.9    0.34 7.3E-06   25.1   1.6   27    2-28     28-54  (64)
 21 COG4391 Uncharacterized protei  88.6    0.46   1E-05   24.9   2.1   16    4-19     42-57  (62)
 22 PF13240 zinc_ribbon_2:  zinc-r  88.2    0.17 3.6E-06   21.5   0.2   12    9-20     12-23  (23)
 23 smart00834 CxxC_CXXC_SSSS Puta  88.2    0.26 5.6E-06   22.1   0.8   12    8-19     24-35  (41)
 24 PF04606 Ogr_Delta:  Ogr/Delta-  87.9    0.47   1E-05   22.7   1.7   13   12-24      1-13  (47)
 25 PF09723 Zn-ribbon_8:  Zinc rib  87.7    0.39 8.4E-06   22.5   1.3   12    7-18     23-34  (42)
 26 PF08274 PhnA_Zn_Ribbon:  PhnA   87.2    0.36 7.7E-06   21.9   1.0   17    4-20     13-29  (30)
 27 COG4311 SoxD Sarcosine oxidase  87.1    0.28 6.1E-06   27.7   0.7   11    9-19      2-12  (97)
 28 PF02591 DUF164:  Putative zinc  87.0    0.26 5.6E-06   24.1   0.5   13    5-17     40-53  (56)
 29 PF03884 DUF329:  Domain of unk  86.9    0.43 9.3E-06   24.4   1.3   13   10-22      2-14  (57)
 30 KOG3352 Cytochrome c oxidase,   86.7     0.3 6.4E-06   29.4   0.7   18    5-24    128-145 (153)
 31 PF01396 zf-C4_Topoisom:  Topoi  86.6    0.61 1.3E-05   21.7   1.6   14   11-24      2-15  (39)
 32 PRK00464 nrdR transcriptional   86.0    0.32 6.9E-06   28.7   0.6    8   11-18      1-8   (154)
 33 PF01096 TFIIS_C:  Transcriptio  85.9    0.48   1E-05   22.0   1.1   12   11-22      1-12  (39)
 34 PF14690 zf-ISL3:  zinc-finger   85.6    0.47   1E-05   21.8   1.0   14   10-23      2-15  (47)
 35 PF14205 Cys_rich_KTR:  Cystein  85.5    0.87 1.9E-05   23.4   2.0   20   10-29      4-23  (55)
 36 PF08792 A2L_zn_ribbon:  A2L zi  85.4    0.92   2E-05   20.7   1.9   18    9-26      2-20  (33)
 37 COG2888 Predicted Zn-ribbon RN  85.1    0.53 1.1E-05   24.7   1.1   13    7-19     47-59  (61)
 38 TIGR00244 transcriptional regu  85.0    0.37 8.1E-06   28.6   0.6    8   11-18      1-8   (147)
 39 TIGR02605 CxxC_CxxC_SSSS putat  84.8    0.82 1.8E-05   21.6   1.6   11    8-18     24-34  (52)
 40 PF07754 DUF1610:  Domain of un  84.7    0.68 1.5E-05   20.2   1.2   12    7-18     13-24  (24)
 41 PF06107 DUF951:  Bacterial pro  84.7    0.84 1.8E-05   23.5   1.7   15    9-23     30-44  (57)
 42 PLN02294 cytochrome c oxidase   84.1     1.2 2.6E-05   27.3   2.5   19    5-23    136-154 (174)
 43 smart00531 TFIIE Transcription  83.4    0.57 1.2E-05   26.7   0.8   20    9-28    122-141 (147)
 44 cd00246 RabGEF Nucleotide exch  83.2    0.85 1.8E-05   25.8   1.5   13   10-22      2-14  (103)
 45 PRK14890 putative Zn-ribbon RN  83.2    0.75 1.6E-05   23.9   1.2   12    7-18     45-56  (59)
 46 COG4481 Uncharacterized protei  83.0    0.98 2.1E-05   23.6   1.6   13   10-22     34-46  (60)
 47 PF14353 CpXC:  CpXC protein     82.5    0.86 1.9E-05   25.0   1.3   11   10-20     38-48  (128)
 48 COG1439 Predicted nucleic acid  82.3    0.97 2.1E-05   27.6   1.6   17    8-24    151-167 (177)
 49 PF09986 DUF2225:  Uncharacteri  81.9    0.66 1.4E-05   28.0   0.8   15    7-21     45-59  (214)
 50 PF06054 CoiA:  Competence prot  81.9       2 4.3E-05   27.9   3.0   25    8-32     28-52  (375)
 51 PF03119 DNA_ligase_ZBD:  NAD-d  81.9       1 2.2E-05   19.8   1.2   11   12-22      1-11  (28)
 52 PRK09710 lar restriction allev  81.8     2.5 5.4E-05   22.2   2.8   21   12-32      8-28  (64)
 53 TIGR03831 YgiT_finger YgiT-typ  80.9     1.1 2.4E-05   20.2   1.2   17    5-21     27-43  (46)
 54 TIGR01374 soxD sarcosine oxida  80.7    0.73 1.6E-05   25.2   0.6    9   11-19      2-10  (84)
 55 smart00709 Zpr1 Duplicated dom  80.6    0.89 1.9E-05   26.8   1.0   10   10-19     29-38  (160)
 56 smart00238 BIR Baculoviral inh  80.2     1.1 2.4E-05   22.1   1.1   13    8-20     34-46  (71)
 57 KOG2691 RNA polymerase II subu  80.1    0.99 2.1E-05   26.1   1.0   26    2-27     65-92  (113)
 58 PF05605 zf-Di19:  Drought indu  80.0    0.84 1.8E-05   22.0   0.6    9   10-18      2-10  (54)
 59 TIGR00340 zpr1_rel ZPR1-relate  79.8    0.99 2.1E-05   26.8   1.0   10   10-19     28-37  (163)
 60 PF00653 BIR:  Inhibitor of Apo  79.2     1.3 2.9E-05   22.1   1.2   13    8-20     34-46  (70)
 61 smart00440 ZnF_C2C2 C2C2 Zinc   79.1    0.94   2E-05   21.2   0.6   11   12-22      2-12  (40)
 62 COG2051 RPS27A Ribosomal prote  79.1     1.1 2.4E-05   23.8   1.0   12   10-21     19-30  (67)
 63 PF03367 zf-ZPR1:  ZPR1 zinc-fi  78.9       1 2.2E-05   26.4   0.9   10   10-19     30-39  (161)
 64 PF08271 TF_Zn_Ribbon:  TFIIB z  78.3     1.8 3.8E-05   20.1   1.5   10   11-20      1-10  (43)
 65 PF14446 Prok-RING_1:  Prokaryo  78.0     1.6 3.5E-05   22.2   1.3   12    7-18     18-29  (54)
 66 PRK15103 paraquat-inducible me  78.0     1.4 3.1E-05   29.1   1.5   23    4-27     24-46  (419)
 67 TIGR02300 FYDLN_acid conserved  77.8     1.2 2.5E-05   26.2   0.9   12    9-20     25-36  (129)
 68 TIGR00310 ZPR1_znf ZPR1 zinc f  77.8     1.2 2.6E-05   27.0   1.0   10   10-19     30-39  (192)
 69 PRK09678 DNA-binding transcrip  77.6     1.1 2.5E-05   23.6   0.7   15   11-27      2-16  (72)
 70 PF11023 DUF2614:  Protein of u  77.6     1.3 2.7E-05   25.6   1.0   14    9-22     68-81  (114)
 71 PF04267 SoxD:  Sarcosine oxida  77.3    0.89 1.9E-05   24.8   0.3    9   11-19      2-10  (84)
 72 PF11781 RRN7:  RNA polymerase   77.2     2.3 5.1E-05   19.6   1.7   17    7-24      5-21  (36)
 73 PF04828 GFA:  Glutathione-depe  77.1       4 8.8E-05   20.1   2.7   24    9-32     47-71  (92)
 74 KOG4080 Mitochondrial ribosoma  76.9     1.1 2.5E-05   27.5   0.7   14    5-18     87-101 (176)
 75 TIGR00155 pqiA_fam integral me  76.5     1.6 3.6E-05   28.7   1.4   22    4-26     27-48  (403)
 76 PF10609 ParA:  ParA/MinD ATPas  76.4     1.6 3.4E-05   23.5   1.1   15    6-20     61-75  (81)
 77 PF01194 RNA_pol_N:  RNA polyme  75.6    0.91   2E-05   23.5   0.0   11   10-20      4-14  (60)
 78 PTZ00043 cytochrome c oxidase   75.5     1.6 3.4E-05   28.3   1.1   15    5-19    176-190 (268)
 79 COG3478 Predicted nucleic-acid  74.7    0.93   2E-05   24.2  -0.1   26    2-27     32-57  (68)
 80 COG1327 Predicted transcriptio  74.0     1.4   3E-05   26.6   0.6    7   12-18      2-8   (156)
 81 PF13878 zf-C2H2_3:  zinc-finge  73.7       2 4.3E-05   20.2   1.0   10    9-18     12-21  (41)
 82 cd00022 BIR Baculoviral inhibi  73.3     2.3 4.9E-05   20.8   1.2   13    8-20     32-44  (69)
 83 smart00714 LITAF Possible memb  73.3     2.9 6.3E-05   20.8   1.6   16   10-25      3-18  (67)
 84 PRK00418 DNA gyrase inhibitor;  72.8     2.3 4.9E-05   22.1   1.1   15    9-23      5-19  (62)
 85 PF14803 Nudix_N_2:  Nudix N-te  72.6     2.5 5.5E-05   19.4   1.1   12   13-24      3-14  (34)
 86 PF04810 zf-Sec23_Sec24:  Sec23  72.5     1.6 3.5E-05   20.2   0.5   10    9-18      1-10  (40)
 87 PHA00626 hypothetical protein   71.9     2.8 6.1E-05   21.8   1.3   12   12-23      2-13  (59)
 88 PF08772 NOB1_Zn_bind:  Nin one  71.4     2.3   5E-05   22.5   1.0   18    7-24     21-38  (73)
 89 TIGR02159 PA_CoA_Oxy4 phenylac  70.8     1.9 4.2E-05   25.0   0.7   10   10-19    105-114 (146)
 90 cd00729 rubredoxin_SM Rubredox  70.6     2.4 5.2E-05   19.2   0.8   11   11-21      3-13  (34)
 91 PRK00423 tfb transcription ini  70.6       3 6.4E-05   26.3   1.5   18    5-22      6-24  (310)
 92 PF13894 zf-C2H2_4:  C2H2-type   70.4       3 6.5E-05   15.8   1.0    9   12-20      2-10  (24)
 93 TIGR01206 lysW lysine biosynth  69.3     2.9 6.3E-05   21.0   1.0    9   12-20      4-12  (54)
 94 PRK12496 hypothetical protein;  69.2     1.6 3.4E-05   25.6   0.1   10   11-20    144-153 (164)
 95 PF07967 zf-C3HC:  C3HC zinc fi  69.1     5.2 0.00011   22.2   2.1   16    8-23     41-56  (133)
 96 PF13913 zf-C2HC_2:  zinc-finge  69.1     2.5 5.4E-05   17.9   0.6   10   10-19      2-11  (25)
 97 COG2956 Predicted N-acetylgluc  69.0     2.1 4.6E-05   29.0   0.6   17    4-20    348-364 (389)
 98 PF10058 DUF2296:  Predicted in  68.9     2.6 5.5E-05   21.0   0.8    9   10-18     44-52  (54)
 99 PRK00564 hypA hydrogenase nick  68.1       3 6.6E-05   23.2   1.0   10   10-19     88-97  (117)
100 PF14354 Lar_restr_allev:  Rest  68.0     4.1 8.8E-05   19.6   1.4   15   12-26      5-19  (61)
101 TIGR01384 TFS_arch transcripti  67.7       4 8.7E-05   21.6   1.4   13    9-21     61-73  (104)
102 cd00350 rubredoxin_like Rubred  67.5     3.1 6.7E-05   18.5   0.8    8   12-19      3-10  (33)
103 PF06750 DiS_P_DiS:  Bacterial   67.1     2.3 4.9E-05   22.9   0.4   10   10-19     33-42  (92)
104 PF14311 DUF4379:  Domain of un  67.1     3.1 6.6E-05   20.0   0.8   14   11-26     29-42  (55)
105 PF13465 zf-H2C2_2:  Zinc-finge  67.0     3.2   7E-05   17.4   0.8   11    9-19     13-23  (26)
106 COG1545 Predicted nucleic-acid  66.9     2.9 6.3E-05   23.9   0.8   12    8-19     27-38  (140)
107 COG3024 Uncharacterized protei  66.8     3.3 7.2E-05   21.9   1.0   16    7-22      4-19  (65)
108 TIGR00686 phnA alkylphosphonat  66.4     3.5 7.6E-05   23.6   1.1   14    6-19     15-28  (109)
109 PF04502 DUF572:  Family of unk  66.3     4.7  0.0001   25.7   1.7   17   11-27     78-94  (324)
110 smart00661 RPOL9 RNA polymeras  66.3     5.3 0.00012   18.5   1.6   10   10-19     20-29  (52)
111 PF08209 Sgf11:  Sgf11 (transcr  66.1     5.5 0.00012   18.3   1.5   13    8-20      2-14  (33)
112 PF12677 DUF3797:  Domain of un  66.1     3.6 7.7E-05   20.7   1.0   12   10-21     13-24  (49)
113 KOG2907 RNA polymerase I trans  66.1     2.7 5.8E-05   24.4   0.6    8   12-19     76-83  (116)
114 PF09237 GAGA:  GAGA factor;  I  66.0     5.7 0.00012   20.4   1.7   18    3-20     17-34  (54)
115 PF10122 Mu-like_Com:  Mu-like   65.7     3.4 7.4E-05   20.9   0.9   10   10-19     24-33  (51)
116 PF09297 zf-NADH-PPase:  NADH p  65.5     6.3 0.00014   17.2   1.6   15    6-20     17-31  (32)
117 PF14952 zf-tcix:  Putative tre  65.0     2.9 6.2E-05   20.7   0.5    9   10-18     11-19  (44)
118 PF13909 zf-H2C2_5:  C2H2-type   64.9     3.9 8.4E-05   16.4   0.8   10   11-20      1-10  (24)
119 PRK12286 rpmF 50S ribosomal pr  64.9     4.5 9.8E-05   20.3   1.2   16    5-20     22-37  (57)
120 PRK00415 rps27e 30S ribosomal   64.8     3.9 8.5E-05   21.1   1.0   12    9-20     10-21  (59)
121 PF13395 HNH_4:  HNH endonuclea  64.7     2.9 6.4E-05   20.2   0.5    9   13-21      1-9   (54)
122 PRK03824 hypA hydrogenase nick  64.5     2.8 6.1E-05   23.8   0.5   10   10-19    107-116 (135)
123 PF00096 zf-C2H2:  Zinc finger,  64.4     3.4 7.5E-05   16.2   0.6    8   12-19      2-9   (23)
124 COG1096 Predicted RNA-binding   63.7       4 8.7E-05   25.2   1.1   17    6-22    161-177 (188)
125 COG3357 Predicted transcriptio  63.7     2.7 5.8E-05   23.8   0.3   11    9-19     57-67  (97)
126 PF09158 MotCF:  Bacteriophage   63.4     8.4 0.00018   21.9   2.3   17   18-34     32-48  (103)
127 PF07503 zf-HYPF:  HypF finger;  63.0     4.1 8.8E-05   18.8   0.8   14    7-20     18-31  (35)
128 PF14369 zf-RING_3:  zinc-finge  62.4     6.7 0.00014   17.9   1.5   14    8-21     19-32  (35)
129 PRK00432 30S ribosomal protein  62.1     5.4 0.00012   19.5   1.2    8   12-19     22-29  (50)
130 PF01783 Ribosomal_L32p:  Ribos  62.0     5.5 0.00012   19.6   1.2   15    5-19     21-35  (56)
131 PF10825 DUF2752:  Protein of u  61.5     3.3 7.2E-05   20.2   0.3   13    6-18      5-17  (52)
132 COG1326 Uncharacterized archae  61.5     4.2 9.1E-05   25.4   0.9   11    9-19     29-39  (201)
133 COG1645 Uncharacterized Zn-fin  61.2       9 0.00019   22.4   2.2   15    7-21     41-55  (131)
134 KOG3404 G10 protein/predicted   61.0     3.5 7.6E-05   24.6   0.4   16    4-19    125-140 (145)
135 PF01485 IBR:  IBR domain;  Int  60.7     5.6 0.00012   18.6   1.1   10   11-20     41-50  (64)
136 PF04161 Arv1:  Arv1-like famil  60.7     5.3 0.00011   23.9   1.2   17   12-28      2-20  (208)
137 PF12773 DZR:  Double zinc ribb  60.7     4.5 9.7E-05   18.8   0.7   11    9-19     28-38  (50)
138 PF10601 zf-LITAF-like:  LITAF-  60.5     9.5 0.00021   19.1   2.0   17    9-25     57-73  (73)
139 TIGR03829 YokU_near_AblA uncha  60.4     4.2 9.1E-05   22.4   0.6   17    4-20     29-45  (89)
140 TIGR03655 anti_R_Lar restricti  60.3     4.3 9.4E-05   19.5   0.6   10   12-21      3-12  (53)
141 TIGR00375 conserved hypothetic  60.2     3.8 8.1E-05   27.1   0.5   10   10-20    259-268 (374)
142 PRK10220 hypothetical protein;  60.1     6.4 0.00014   22.6   1.4   14    6-19     16-29  (111)
143 PRK00807 50S ribosomal protein  59.8     5.3 0.00012   19.7   0.9   10   12-21      3-12  (52)
144 PF09082 DUF1922:  Domain of un  59.8     5.3 0.00012   21.2   1.0   16   10-26     20-35  (68)
145 COG1571 Predicted DNA-binding   59.7     4.3 9.2E-05   27.6   0.7   17   10-26    367-383 (421)
146 PF05876 Terminase_GpA:  Phage   59.4     4.1 8.9E-05   27.7   0.6   14   10-23    200-213 (557)
147 smart00647 IBR In Between Ring  59.3     9.2  0.0002   17.9   1.7   16    7-22     37-52  (64)
148 PF14447 Prok-RING_4:  Prokaryo  59.1     4.5 9.8E-05   20.6   0.6   10   11-20     40-49  (55)
149 PF07282 OrfB_Zn_ribbon:  Putat  58.7     8.1 0.00017   18.9   1.5   11    9-19     45-55  (69)
150 PRK14892 putative transcriptio  58.5     9.9 0.00022   21.1   2.0   16    6-21     17-32  (99)
151 PF01667 Ribosomal_S27e:  Ribos  58.0     5.7 0.00012   20.1   0.9   10   10-19      7-16  (55)
152 COG3364 Zn-ribbon containing p  57.9     3.9 8.5E-05   23.6   0.3    9   12-20     22-30  (112)
153 PF02176 zf-TRAF:  TRAF-type zi  57.7      10 0.00022   17.8   1.7   14    8-21      7-21  (60)
154 PF12172 DUF35_N:  Rubredoxin-l  57.7       5 0.00011   17.9   0.6   13   10-22     11-23  (37)
155 PF14206 Cys_rich_CPCC:  Cystei  57.5     6.6 0.00014   21.0   1.1   13   11-23      2-14  (78)
156 PF10263 SprT-like:  SprT-like   57.4      11 0.00024   20.7   2.0   20    7-26    120-139 (157)
157 TIGR01031 rpmF_bact ribosomal   57.3       8 0.00017   19.2   1.3   15    5-19     21-35  (55)
158 PF13005 zf-IS66:  zinc-finger   57.2     6.9 0.00015   17.9   1.0   12   10-21      2-13  (47)
159 COG1779 C4-type Zn-finger prot  56.8     5.5 0.00012   24.8   0.8   10   10-19     43-52  (201)
160 smart00746 TRASH metallochaper  56.8     5.7 0.00012   15.5   0.6    9   13-21      1-9   (39)
161 COG1592 Rubrerythrin [Energy p  56.5     6.2 0.00014   23.7   1.0   12    8-19    132-143 (166)
162 PF02892 zf-BED:  BED zinc fing  56.3     7.5 0.00016   17.5   1.1   17    7-23     13-29  (45)
163 COG4640 Predicted membrane pro  56.1       5 0.00011   27.7   0.6   15    6-20     11-25  (465)
164 COG0551 TopA Zn-finger domain   56.0      11 0.00024   20.9   1.9   17    8-24     15-31  (140)
165 PF02748 PyrI_C:  Aspartate car  55.9      10 0.00022   18.7   1.5   15    6-20     31-45  (52)
166 COG1379 PHP family phosphoeste  55.8     4.5 9.9E-05   27.5   0.3   11   10-20    265-275 (403)
167 PF01246 Ribosomal_L24e:  Ribos  55.7     6.5 0.00014   20.7   0.9   11   10-20      3-13  (71)
168 PF10955 DUF2757:  Protein of u  55.4     6.7 0.00014   21.1   0.9   10   11-20      5-14  (76)
169 PF04423 Rad50_zn_hook:  Rad50   54.8     6.3 0.00014   18.9   0.7   14    5-19     16-29  (54)
170 PF00471 Ribosomal_L33:  Riboso  54.6      12 0.00025   18.3   1.6   13   12-24     34-46  (48)
171 TIGR03830 CxxCG_CxxCG_HTH puta  54.5      14 0.00029   19.6   2.0   19   13-31      1-19  (127)
172 PF09889 DUF2116:  Uncharacteri  54.5     5.5 0.00012   20.3   0.5    9   12-20      5-13  (59)
173 COG0333 RpmF Ribosomal protein  54.3     7.8 0.00017   19.8   1.0   16    5-20     22-37  (57)
174 cd00472 Ribosomal_L24e_L24 Rib  54.3     6.5 0.00014   19.7   0.7   11   10-20      3-13  (54)
175 PHA02998 RNA polymerase subuni  54.2     7.2 0.00016   24.3   1.0   13    9-21    142-154 (195)
176 COG5132 BUD31 Cell cycle contr  54.0     3.7   8E-05   24.5  -0.3   15    5-19    126-140 (146)
177 COG1997 RPL43A Ribosomal prote  53.4     3.5 7.5E-05   23.0  -0.4   17    4-20     29-45  (89)
178 COG3091 SprT Zn-dependent meta  53.4      12 0.00026   22.6   1.9   20    5-24    135-154 (156)
179 PRK11866 2-oxoacid ferredoxin   53.3     2.3   5E-05   26.9  -1.3   15    8-22      5-19  (279)
180 PRK03681 hypA hydrogenase nick  53.2     7.2 0.00016   21.6   0.8    9   11-19     88-96  (114)
181 PHA00616 hypothetical protein   52.9     4.7  0.0001   19.6   0.1   11   11-21      2-12  (44)
182 PRK04860 hypothetical protein;  52.9      14  0.0003   21.8   2.0   17    8-24    141-157 (160)
183 PF02150 RNA_POL_M_15KD:  RNA p  52.8      15 0.00032   16.6   1.8   12   12-23      3-14  (35)
184 smart00614 ZnF_BED BED zinc fi  52.6      10 0.00022   17.8   1.2   16    9-24     17-32  (50)
185 PRK00595 rpmG 50S ribosomal pr  52.5      14 0.00029   18.3   1.7   12   13-24     40-51  (53)
186 PRK04136 rpl40e 50S ribosomal   52.1       8 0.00017   19.4   0.8   13    7-19     25-37  (48)
187 PF14122 YokU:  YokU-like prote  52.1     8.8 0.00019   21.3   1.1   15    4-18     29-43  (87)
188 COG4049 Uncharacterized protei  52.0     6.4 0.00014   20.7   0.5    9   10-18     17-25  (65)
189 PF06677 Auto_anti-p27:  Sjogre  51.8      20 0.00043   17.0   2.2   16   11-27     18-33  (41)
190 PF09845 DUF2072:  Zn-ribbon co  51.7     6.2 0.00013   23.1   0.4   10   12-21     21-30  (131)
191 PF07295 DUF1451:  Protein of u  51.6      12 0.00026   21.9   1.6   16    9-24    111-126 (146)
192 PRK09521 exosome complex RNA-b  51.4     9.9 0.00022   22.2   1.3   12    9-20    165-176 (189)
193 PF10533 Plant_zn_clust:  Plant  51.3      13 0.00029   18.5   1.5   25    7-34     16-40  (47)
194 PTZ00255 60S ribosomal protein  51.3     3.9 8.5E-05   22.6  -0.4   17    3-19     29-45  (90)
195 smart00731 SprT SprT homologue  51.2      15 0.00032   20.6   1.9   24    8-31    110-133 (146)
196 cd02772 MopB_NDH-1_NuoG2 MopB_  50.7      26 0.00057   22.0   3.1   23   12-34      3-27  (414)
197 PF03811 Zn_Tnp_IS1:  InsA N-te  50.5      11 0.00024   17.4   1.2   14   10-23      5-19  (36)
198 PRK08351 DNA-directed RNA poly  50.5     7.6 0.00016   20.0   0.6    9   12-20     17-25  (61)
199 COG1644 RPB10 DNA-directed RNA  50.4     6.5 0.00014   20.7   0.4   12    9-20      3-14  (63)
200 COG1631 RPL42A Ribosomal prote  50.4      12 0.00026   21.0   1.4   13   10-22     68-80  (94)
201 PRK01343 zinc-binding protein;  50.2     7.2 0.00016   20.0   0.5   18    8-25      7-24  (57)
202 PF04475 DUF555:  Protein of un  50.1     7.7 0.00017   22.1   0.7   16    4-20     42-57  (102)
203 TIGR00100 hypA hydrogenase nic  50.0       7 0.00015   21.6   0.5   10   10-19     86-95  (115)
204 TIGR01385 TFSII transcription   49.6     9.3  0.0002   24.5   1.0   15    6-20    254-268 (299)
205 PF05129 Elf1:  Transcription e  49.6     6.8 0.00015   20.7   0.4   11    9-19     21-31  (81)
206 TIGR01023 rpmG_bact ribosomal   49.4      16 0.00035   18.2   1.7   12   13-24     41-52  (54)
207 COG1743 Adenine-specific DNA m  49.0     8.6 0.00019   28.5   0.9   10   10-19    178-187 (875)
208 PF09151 DUF1936:  Domain of un  48.8     9.2  0.0002   18.0   0.7   11   12-22      3-13  (36)
209 PF15494 SRCR_2:  Scavenger rec  48.7     9.4  0.0002   20.0   0.8   10   10-19     88-97  (98)
210 PRK00420 hypothetical protein;  48.6      17 0.00036   20.6   1.9   16    8-23     38-53  (112)
211 PRK02935 hypothetical protein;  48.3      10 0.00022   21.8   1.0   11    9-19     69-79  (110)
212 COG1594 RPB9 DNA-directed RNA   48.2      11 0.00023   21.0   1.0   11   10-20     72-82  (113)
213 PRK00762 hypA hydrogenase nick  48.2     7.5 0.00016   21.8   0.4    8   11-18     93-100 (124)
214 PF03330 DPBB_1:  Rare lipoprot  48.1      13 0.00027   18.7   1.2   11   11-21     46-56  (78)
215 PF04216 FdhE:  Protein involve  48.0     6.2 0.00013   24.4   0.0   10   10-19    211-220 (290)
216 PF15288 zf-CCHC_6:  Zinc knuck  47.8     6.9 0.00015   18.8   0.2    8   11-18      2-9   (40)
217 PRK11788 tetratricopeptide rep  47.4      12 0.00026   22.5   1.2   16    4-19    348-363 (389)
218 TIGR00319 desulf_FeS4 desulfof  47.4      22 0.00048   15.5   1.9   16    8-23      5-20  (34)
219 PF10080 DUF2318:  Predicted me  47.3      11 0.00024   20.9   1.0   15    6-20     48-62  (102)
220 cd00974 DSRD Desulforedoxin (D  47.2      23 0.00049   15.5   1.9   16    9-24      3-18  (34)
221 cd02768 MopB_NADH-Q-OR-NuoG2 M  46.8      32  0.0007   21.2   3.1   23   12-34      3-27  (386)
222 COG5349 Uncharacterized protei  46.8     5.4 0.00012   23.4  -0.3   18    5-22     16-33  (126)
223 PRK11032 hypothetical protein;  46.3      17 0.00037   21.7   1.7   16    9-24    123-138 (160)
224 COG1656 Uncharacterized conser  46.2       6 0.00013   24.0  -0.2   18   10-27     97-114 (165)
225 PF06676 DUF1178:  Protein of u  46.2      11 0.00023   22.3   0.9   19    6-24     28-46  (148)
226 PRK04173 glycyl-tRNA synthetas  45.8      10 0.00022   25.3   0.8   15   10-24    125-148 (456)
227 PF09706 Cas_CXXC_CXXC:  CRISPR  45.7      14  0.0003   18.9   1.2   20    7-26      2-21  (69)
228 PF00301 Rubredoxin:  Rubredoxi  45.4      11 0.00023   18.4   0.6    8   11-18      2-9   (47)
229 cd02753 MopB_Formate-Dh-H Form  45.3      34 0.00073   22.2   3.1   23   12-34      3-27  (512)
230 PF00935 Ribosomal_L44:  Riboso  45.2      16 0.00034   19.6   1.4   14   10-23     53-66  (77)
231 KOG1088 Uncharacterized conser  45.2      12 0.00026   21.9   1.0   11    9-19     97-107 (124)
232 KOG2463 Predicted RNA-binding   45.1      14 0.00031   25.0   1.4   17    7-23    254-270 (376)
233 PF14577 SEO_C:  Sieve element   45.0      12 0.00027   23.6   1.1   13    7-19    211-223 (235)
234 cd02008 TPP_IOR_alpha Thiamine  44.9     4.4 9.6E-05   23.0  -0.9   17    8-24      2-18  (178)
235 TIGR00373 conserved hypothetic  44.8      16 0.00034   21.2   1.4   13   10-22    128-140 (158)
236 PF05265 DUF723:  Protein of un  44.7      10 0.00022   19.7   0.5    6   12-17     55-60  (60)
237 PF08996 zf-DNA_Pol:  DNA Polym  44.7      17 0.00037   21.4   1.6   15   10-24     18-32  (188)
238 PRK01103 formamidopyrimidine/5  44.7      26 0.00056   21.6   2.4   15   10-24    245-259 (274)
239 COG0846 SIR2 NAD-dependent pro  44.7      15 0.00032   23.1   1.3   14    6-19    142-155 (250)
240 PRK05978 hypothetical protein;  44.7      10 0.00022   22.4   0.6   15    9-23     32-46  (148)
241 cd04482 RPA2_OBF_like RPA2_OBF  44.6      10 0.00022   20.0   0.5    8   10-17     84-91  (91)
242 PRK11823 DNA repair protein Ra  44.6      15 0.00032   24.3   1.4   14    6-19      3-16  (446)
243 cd00368 Molybdopterin-Binding   44.4      39 0.00085   20.5   3.1   23   12-34      3-27  (374)
244 COG2093 DNA-directed RNA polym  44.2      14 0.00031   19.4   1.1   13    7-19     15-27  (64)
245 PRK10445 endonuclease VIII; Pr  43.7      27 0.00059   21.6   2.4   19   10-28    235-253 (263)
246 PRK14891 50S ribosomal protein  43.7      11 0.00024   22.2   0.6   10   11-20      5-14  (131)
247 PF14996 RMP:  Retinal Maintena  43.5      16 0.00034   21.8   1.3   16    7-22     65-80  (146)
248 cd02771 MopB_NDH-1_NuoG2-N7 Mo  43.1      35 0.00076   21.9   2.9   23   12-34      3-27  (472)
249 TIGR00416 sms DNA repair prote  43.1      16 0.00035   24.3   1.4   13    7-19      4-16  (454)
250 smart00355 ZnF_C2H2 zinc finge  42.9      12 0.00026   14.0   0.5    8   12-19      2-9   (26)
251 PRK06386 replication factor A;  42.6      11 0.00024   24.9   0.6   11   11-21    237-247 (358)
252 PF09332 Mcm10:  Mcm10 replicat  42.4      16 0.00035   24.1   1.3   12   11-22    286-297 (344)
253 PF06957 COPI_C:  Coatomer (COP  42.4      15 0.00032   24.9   1.2   13    8-20    378-390 (422)
254 PF06524 NOA36:  NOA36 protein;  42.3      14 0.00031   24.4   1.1   15    6-20    205-219 (314)
255 PRK01110 rpmF 50S ribosomal pr  42.2      22 0.00048   17.9   1.6   16    5-20     22-37  (60)
256 PF06906 DUF1272:  Protein of u  42.1      11 0.00025   19.4   0.5   11   10-20     41-51  (57)
257 PF08063 PADR1:  PADR1 (NUC008)  41.9      17 0.00037   18.0   1.1   17    8-24     12-29  (55)
258 PRK12380 hydrogenase nickel in  41.9      14  0.0003   20.4   0.8   11    9-19     69-79  (113)
259 PRK04016 DNA-directed RNA poly  41.8      13 0.00029   19.3   0.7   12    9-20      3-14  (62)
260 cd03375 TPP_OGFOR Thiamine pyr  41.7     3.4 7.4E-05   24.1  -1.7   11   13-23      2-12  (193)
261 PF01155 HypA:  Hydrogenase exp  41.6      13 0.00029   20.3   0.8    9   11-19     71-79  (113)
262 PF08882 Acetone_carb_G:  Aceto  41.2      14 0.00029   21.3   0.7    9   10-19     24-32  (112)
263 COG4530 Uncharacterized protei  41.2      13 0.00029   21.8   0.7   12    8-19     24-35  (129)
264 PRK06393 rpoE DNA-directed RNA  41.1      13 0.00028   19.4   0.6    9   11-19     18-26  (64)
265 KOG2703 C4-type Zn-finger prot  41.0      12 0.00025   26.0   0.5   10   10-19     68-77  (460)
266 TIGR00280 L37a ribosomal prote  40.9     6.6 0.00014   21.7  -0.5   17    3-19     28-44  (91)
267 PHA02768 hypothetical protein;  40.8      12 0.00025   19.0   0.4    9   11-19      6-14  (55)
268 COG2260 Predicted Zn-ribbon RN  40.8      13 0.00027   19.4   0.5    9   11-19     18-26  (59)
269 cd00730 rubredoxin Rubredoxin;  40.8      12 0.00027   18.3   0.5    8   11-18      2-9   (50)
270 COG2995 PqiA Uncharacterized p  40.6      17 0.00036   25.0   1.2   16    5-20     33-48  (418)
271 CHL00104 rpl33 ribosomal prote  40.5      24 0.00052   18.4   1.6   12   13-24     52-63  (66)
272 PRK08116 hypothetical protein;  40.3      18 0.00038   22.3   1.2   18    6-23     12-29  (268)
273 PRK03976 rpl37ae 50S ribosomal  40.2     7.3 0.00016   21.5  -0.4   17    3-19     29-45  (90)
274 PRK07218 replication factor A;  39.8      12 0.00026   25.2   0.4   10   11-20    298-307 (423)
275 TIGR00354 polC DNA polymerase,  39.8      16 0.00035   27.8   1.1   13   11-23   1029-1041(1095)
276 PF11682 DUF3279:  Protein of u  39.7      27 0.00059   20.2   1.9   18    6-23     24-41  (128)
277 PF09526 DUF2387:  Probable met  39.5      17 0.00036   19.0   0.9   12    8-19     28-39  (71)
278 PRK11869 2-oxoacid ferredoxin   39.4       5 0.00011   25.4  -1.3   18    6-23      4-21  (280)
279 TIGR00577 fpg formamidopyrimid  39.3      33 0.00071   21.2   2.3   15   10-24    245-259 (272)
280 COG1998 RPS31 Ribosomal protei  39.3      14  0.0003   18.7   0.5   10   11-20     20-29  (51)
281 COG0267 RpmG Ribosomal protein  39.2      25 0.00055   17.5   1.5   12   13-24     37-48  (50)
282 cd00085 HNHc HNH nucleases; HN  39.2      14  0.0003   16.3   0.5   10   11-20     12-21  (57)
283 PLN00209 ribosomal protein S27  39.2      18 0.00038   20.0   1.0   10   10-19     36-45  (86)
284 PF12013 DUF3505:  Protein of u  39.1      22 0.00047   18.9   1.3   15    5-19     75-93  (109)
285 PF02318 FYVE_2:  FYVE-type zin  39.1      21 0.00046   19.5   1.3   13    8-20     69-81  (118)
286 PF09696 Ctf8:  Ctf8;  InterPro  39.1      14  0.0003   20.7   0.6   12   16-27    109-120 (122)
287 PLN00032 DNA-directed RNA poly  38.9      17 0.00036   19.4   0.8   11   10-20      4-14  (71)
288 KOG2906 RNA polymerase III sub  38.9      51  0.0011   18.8   2.8   16   12-27      3-18  (105)
289 COG0675 Transposase and inacti  38.7      22 0.00048   20.8   1.4    8   10-17    309-316 (364)
290 PF13824 zf-Mss51:  Zinc-finger  38.7      15 0.00032   18.7   0.6   12    8-19     12-23  (55)
291 TIGR02820 formald_GSH S-(hydro  38.5      14 0.00031   22.3   0.6   13   12-24     91-103 (182)
292 KOG3497 DNA-directed RNA polym  38.5      14  0.0003   19.7   0.5   11   10-20      4-14  (69)
293 PRK05767 rpl44e 50S ribosomal   38.4      23 0.00051   19.6   1.4   14   10-23     67-80  (92)
294 PF01428 zf-AN1:  AN1-like Zinc  38.4      18 0.00039   16.7   0.8   12    9-20     12-23  (43)
295 TIGR02443 conserved hypothetic  38.4      17 0.00036   18.8   0.8   11    9-19     30-40  (59)
296 PRK06266 transcription initiat  38.3      16 0.00035   21.6   0.8   13   10-22    136-148 (178)
297 PRK09335 30S ribosomal protein  38.2      17 0.00037   20.4   0.8   13    8-20     18-30  (95)
298 PRK14810 formamidopyrimidine-D  38.1      18 0.00038   22.5   1.0   13   10-22    244-256 (272)
299 cd02759 MopB_Acetylene-hydrata  38.0      52  0.0011   21.4   3.1   23   12-34      3-27  (477)
300 PF06170 DUF983:  Protein of un  38.0      13 0.00027   20.0   0.3   10   10-19      8-17  (86)
301 PF05180 zf-DNL:  DNL zinc fing  37.8      25 0.00054   18.3   1.4   12   10-21     29-40  (66)
302 COG2126 RPL37A Ribosomal prote  37.7      11 0.00025   19.7   0.1   17    8-25     14-30  (61)
303 CHL00174 accD acetyl-CoA carbo  37.7      15 0.00033   23.8   0.6    7   12-18     59-65  (296)
304 PRK14714 DNA polymerase II lar  37.6      18 0.00039   28.0   1.1   13   11-23   1270-1282(1337)
305 TIGR02177 PorB_KorB 2-oxoacid:  37.6     4.8  0.0001   25.6  -1.6   12   11-22      2-13  (287)
306 PF11793 FANCL_C:  FANCL C-term  37.5      21 0.00045   18.1   1.1   12   11-22     56-67  (70)
307 COG1552 RPL40A Ribosomal prote  37.4     9.9 0.00021   19.2  -0.2   16    6-21     24-39  (50)
308 PF01283 Ribosomal_S26e:  Ribos  37.2      20 0.00042   20.6   1.0   13    8-20     18-30  (113)
309 PF00130 C1_1:  Phorbol esters/  37.1      31 0.00067   15.8   1.6   14    7-20     25-38  (53)
310 COG4888 Uncharacterized Zn rib  37.0      15 0.00034   20.9   0.6   13   10-22     22-34  (104)
311 COG4896 Uncharacterized protei  36.8      11 0.00023   20.1  -0.1   15    9-23     30-44  (68)
312 PRK14811 formamidopyrimidine-D  36.8      18 0.00039   22.5   0.9   15   10-24    235-249 (269)
313 PF12230 PRP21_like_P:  Pre-mRN  36.6      12 0.00025   22.4   0.0   12    9-20    167-178 (229)
314 PF13575 DUF4135:  Domain of un  36.6      23 0.00049   22.5   1.3   12   16-27     69-80  (370)
315 COG1885 Uncharacterized protei  36.5      16 0.00034   21.2   0.5    9   11-19     50-58  (115)
316 PRK05320 rhodanese superfamily  36.4      23 0.00049   21.9   1.2   18    3-20    237-254 (257)
317 PF01125 G10:  G10 protein;  In  36.1      17 0.00037   21.6   0.7   16    4-19    126-141 (145)
318 PF10005 DUF2248:  Uncharacteri  36.0      19 0.00041   24.0   0.9   11   12-22      1-11  (343)
319 PRK04023 DNA polymerase II lar  36.0      23 0.00049   27.1   1.4   13   11-23   1054-1066(1121)
320 PRK13130 H/ACA RNA-protein com  35.6      17 0.00036   18.4   0.5   10   10-19     17-26  (56)
321 COG5525 Bacteriophage tail ass  35.5      19 0.00041   25.8   0.9    9   11-19    228-236 (611)
322 PF06397 Desulfoferrod_N:  Desu  35.4      43 0.00093   15.6   1.9   17    7-23      3-19  (36)
323 COG1468 CRISPR-associated prot  35.2      31 0.00067   20.7   1.7   19    5-23    169-187 (190)
324 PLN03166 60S ribosomal protein  35.2      23 0.00049   19.7   1.0   15    6-20     37-51  (96)
325 cd00029 C1 Protein kinase C co  34.8      24 0.00053   15.6   1.0   12    8-19     26-37  (50)
326 PTZ00172 40S ribosomal protein  34.5      21 0.00045   20.4   0.8   13    8-20     18-30  (108)
327 PTZ00083 40S ribosomal protein  34.4      23 0.00051   19.5   1.0   10   10-19     35-44  (85)
328 smart00778 Prim_Zn_Ribbon Zinc  34.4      20 0.00043   16.7   0.6    9   10-18      3-11  (37)
329 PF06827 zf-FPG_IleRS:  Zinc fi  34.4      44 0.00096   14.0   2.5   11   12-22      3-13  (30)
330 PF03691 UPF0167:  Uncharacteri  34.2      30 0.00065   20.9   1.5   13   10-22    160-172 (176)
331 TIGR01562 FdhE formate dehydro  34.0      19 0.00041   23.3   0.7   10   10-19    224-233 (305)
332 COG1773 Rubredoxin [Energy pro  33.9      18  0.0004   18.3   0.5    8   11-18      4-11  (55)
333 PF11648 RIG-I_C-RD:  C-termina  33.9      16 0.00034   20.5   0.2   15    5-19     55-69  (123)
334 PF10367 Vps39_2:  Vacuolar sor  33.8      16 0.00035   18.6   0.3   16    7-22     75-90  (109)
335 PF14319 Zn_Tnp_IS91:  Transpos  33.5      24 0.00053   19.4   1.0   15    7-21     39-53  (111)
336 TIGR02652 conserved hypothetic  33.5      14 0.00031   22.4   0.1   14    7-20      6-19  (163)
337 PF08295 Sin3_corepress:  Sin3   33.5      13 0.00027   20.6  -0.2   14   12-25      1-16  (101)
338 PF08273 Prim_Zn_Ribbon:  Zinc-  33.4      19 0.00042   17.0   0.5    8   11-18      4-11  (40)
339 PLN00186 ribosomal protein S26  33.2      23 0.00049   20.3   0.8   13    8-20     18-30  (109)
340 smart00734 ZnF_Rad18 Rad18-lik  33.2      21 0.00046   15.1   0.6   10   11-20      2-11  (26)
341 PF10083 DUF2321:  Uncharacteri  33.0      18 0.00039   21.9   0.4   10   11-20     40-49  (158)
342 PRK04059 rpl34e 50S ribosomal   33.0      26 0.00056   19.2   1.0   15    6-20     30-44  (88)
343 PF09862 DUF2089:  Protein of u  32.9      36 0.00078   19.3   1.6    9   13-21      1-9   (113)
344 PRK14715 DNA polymerase II lar  32.7      27 0.00058   27.7   1.3   13   11-23   1558-1570(1627)
345 COG3791 Uncharacterized conser  32.5      31 0.00066   19.3   1.3   16   11-26     70-85  (133)
346 PF02146 SIR2:  Sir2 family;  I  32.4      26 0.00057   19.9   1.0   12    8-19    127-138 (178)
347 PRK00504 rpmG 50S ribosomal pr  32.3      41 0.00089   16.5   1.6   12   13-24     37-48  (50)
348 PF08394 Arc_trans_TRASH:  Arch  32.2      21 0.00046   16.7   0.5    8   13-20      1-8   (37)
349 PF01780 Ribosomal_L37ae:  Ribo  32.2     6.9 0.00015   21.6  -1.3   17    4-20     29-45  (90)
350 COG4830 RPS26B Ribosomal prote  32.2      22 0.00047   20.4   0.6   12    9-20     19-30  (108)
351 cd00162 RING RING-finger (Real  32.0      22 0.00047   14.8   0.5   10   10-19     35-44  (45)
352 PF14149 YhfH:  YhfH-like prote  31.7     6.1 0.00013   18.8  -1.4   15    6-20      9-23  (37)
353 PF11290 DUF3090:  Protein of u  31.7      21 0.00045   21.8   0.5    9   12-20    156-164 (171)
354 PHA02942 putative transposase;  31.6      28  0.0006   22.8   1.1   10   10-19    342-351 (383)
355 PF12322 T4_baseplate:  T4 bact  31.5      23  0.0005   21.5   0.7   12    7-19    181-192 (205)
356 TIGR00269 conserved hypothetic  31.5      23 0.00049   19.0   0.6   11    9-19     79-89  (104)
357 PRK03954 ribonuclease P protei  31.5      26 0.00057   20.0   0.9   11    9-19     92-102 (121)
358 PRK08665 ribonucleotide-diphos  31.2      25 0.00054   25.1   0.9   13   11-23    725-737 (752)
359 TIGR01054 rgy reverse gyrase.   31.2      21 0.00045   26.7   0.6   12    9-20      6-17  (1171)
360 PTZ00157 60S ribosomal protein  31.1      34 0.00073   18.7   1.3   13   10-22     69-81  (84)
361 PF09814 HECT_2:  HECT-like Ubi  31.0      30 0.00064   21.5   1.2   17    5-21    100-117 (354)
362 PF06769 Plasmid_Txe:  Plasmid   30.9      74  0.0016   16.8   2.5   19   17-35     59-77  (80)
363 TIGR00598 rad14 DNA repair pro  30.9      37  0.0008   20.7   1.5   12   11-22    158-169 (172)
364 PRK11867 2-oxoglutarate ferred  30.9     6.8 0.00015   24.7  -1.7   15    8-22     15-29  (286)
365 cd02750 MopB_Nitrate-R-NarG-li  30.6      82  0.0018   20.4   3.2   24   11-34      7-32  (461)
366 PF13453 zf-TFIIB:  Transcripti  30.6      23 0.00051   16.0   0.5    8   12-19      1-8   (41)
367 COG1060 ThiH Thiamine biosynth  30.6      20 0.00043   23.6   0.4   11   10-20     70-80  (370)
368 PF09654 DUF2396:  Protein of u  30.6      17 0.00038   22.0   0.1   13    8-20      4-16  (161)
369 COG1198 PriA Primosomal protei  30.5      31 0.00067   24.9   1.3   10   10-19    475-484 (730)
370 TIGR03847 conserved hypothetic  30.5      22 0.00048   21.9   0.5    9   12-20    158-166 (177)
371 PF12653 DUF3785:  Protein of u  30.5      43 0.00094   19.9   1.7   13   10-22    120-132 (138)
372 PF03243 MerB:  Alkylmercury ly  30.5   1E+02  0.0022   17.1   3.2   21   11-31     40-60  (127)
373 COG0635 HemN Coproporphyrinoge  30.5      29 0.00063   22.9   1.1   17   10-26     45-61  (416)
374 TIGR00595 priA primosomal prot  30.5      50  0.0011   22.2   2.2    8   12-19    224-231 (505)
375 PF09963 DUF2197:  Uncharacteri  30.2      13 0.00029   18.9  -0.4   16    6-21     27-42  (56)
376 COG5415 Predicted integral mem  30.0      22 0.00047   23.0   0.4   15    4-18    186-200 (251)
377 PF06044 DRP:  Dam-replacing fa  29.8      21 0.00045   23.1   0.3   14   10-23     31-44  (254)
378 smart00109 C1 Protein kinase C  29.8      18  0.0004   15.8   0.1   11    9-19     26-36  (49)
379 smart00507 HNHc HNH nucleases.  29.7      22 0.00047   15.3   0.3   11   11-21     11-21  (52)
380 cd02018 TPP_PFOR Thiamine pyro  29.5     7.1 0.00015   23.6  -1.7   14   11-24      6-19  (237)
381 PF01844 HNH:  HNH endonuclease  29.5      24 0.00052   15.6   0.5   10   13-22      1-10  (47)
382 COG4647 AcxC Acetone carboxyla  29.4      23 0.00049   21.5   0.4    8   11-18    121-128 (165)
383 PF15616 TerY-C:  TerY-C metal   29.4      57  0.0012   19.0   2.1   16    8-23    103-118 (131)
384 TIGR02646 conserved hypothetic  29.4      22 0.00048   20.0   0.4   12    9-20     23-34  (144)
385 PRK14873 primosome assembly pr  29.4      60  0.0013   23.0   2.5   10   10-19    410-419 (665)
386 TIGR01053 LSD1 zinc finger dom  29.2      39 0.00084   15.1   1.1   13   11-23      2-14  (31)
387 PF06467 zf-FCS:  MYM-type Zinc  29.2      40 0.00087   14.8   1.2   15    7-21      3-17  (43)
388 TIGR03129 one_C_dehyd_B formyl  29.1      83  0.0018   19.5   2.9   22   11-32      2-26  (421)
389 cd02754 MopB_Nitrate-R-NapA-li  29.1      88  0.0019   20.6   3.1   23   12-34      3-27  (565)
390 COG2331 Uncharacterized protei  29.1      27 0.00057   19.2   0.6   12    8-19     31-42  (82)
391 PF04032 Rpr2:  RNAse P Rpr2/Rp  29.0      27 0.00058   17.4   0.6    9   10-18     77-85  (85)
392 PF02701 zf-Dof:  Dof domain, z  29.0      32 0.00069   18.1   0.9   13    6-18      1-13  (63)
393 PRK03988 translation initiatio  28.9      32  0.0007   19.9   1.0   10   10-19    102-111 (138)
394 cd04511 Nudix_Hydrolase_4 Memb  28.8      27 0.00058   18.5   0.6    7   13-19      1-7   (130)
395 PF14599 zinc_ribbon_6:  Zinc-r  28.8      25 0.00054   17.9   0.5    8   11-18     49-56  (61)
396 PRK13945 formamidopyrimidine-D  28.7      29 0.00064   21.6   0.9   14   10-23    254-267 (282)
397 PF03966 Trm112p:  Trm112p-like  28.4      30 0.00066   17.2   0.7   11    9-19     52-62  (68)
398 PRK03922 hypothetical protein;  28.4      27 0.00058   20.2   0.6   10   10-19     49-58  (113)
399 PF01199 Ribosomal_L34e:  Ribos  28.2      28 0.00061   19.2   0.6   15    6-20     37-51  (94)
400 COG2023 RPR2 RNase P subunit R  28.1      48   0.001   18.8   1.6   14    9-22     81-94  (105)
401 cd02752 MopB_Formate-Dh-Na-lik  27.8      91   0.002   21.9   3.2   22   12-33      3-26  (649)
402 PRK07726 DNA topoisomerase III  27.8      32 0.00069   23.9   1.0   14   10-23    610-623 (658)
403 PF14634 zf-RING_5:  zinc-RING   27.7      31 0.00067   15.6   0.7   10    8-17     34-43  (44)
404 TIGR00320 dfx_rbo desulfoferro  27.7      44 0.00096   18.9   1.4   15    8-22      5-19  (125)
405 TIGR03336 IOR_alpha indolepyru  27.5      14 0.00031   25.0  -0.7   18    5-22    351-368 (595)
406 TIGR01591 Fdh-alpha formate de  27.5      95  0.0021   20.9   3.1   22   13-34      3-26  (671)
407 PF10891 DUF2719:  Protein of u  27.5      37 0.00081   18.6   1.0   12    7-18     19-30  (81)
408 PF06221 zf-C2HC5:  Putative zi  27.4      28  0.0006   17.6   0.5   12   10-21     35-46  (57)
409 PRK03564 formate dehydrogenase  27.4      29 0.00062   22.6   0.7    9   10-18    226-234 (309)
410 cd02762 MopB_1 The MopB_1 CD i  27.4      90   0.002   20.6   3.0   23   12-34      3-27  (539)
411 PRK09401 reverse gyrase; Revie  27.3      27 0.00058   26.2   0.6   11   10-20      7-17  (1176)
412 PRK11865 pyruvate ferredoxin o  27.1     8.4 0.00018   24.7  -1.8   14   10-23     18-31  (299)
413 PRK05654 acetyl-CoA carboxylas  27.0      21 0.00046   22.8   0.0   17    7-24     24-40  (292)
414 TIGR02116 toxin_Txe_YoeB toxin  26.9      95  0.0021   15.5   2.8   24   11-34     52-76  (80)
415 cd02755 MopB_Thiosulfate-R-lik  26.7      90   0.002   20.2   2.8   22   12-33      4-27  (454)
416 PRK05417 glutathione-dependent  26.7      29 0.00063   21.1   0.6   12   12-23     95-106 (191)
417 TIGR02174 CXXU_selWTH selT/sel  26.6      30 0.00064   17.5   0.5    9   11-19      4-12  (72)
418 PF01907 Ribosomal_L37e:  Ribos  26.6      57  0.0012   16.6   1.6   13    9-21     14-26  (55)
419 PF01930 Cas_Cas4:  Domain of u  26.6      40 0.00088   18.6   1.1   12    8-19    146-157 (162)
420 PF00098 zf-CCHC:  Zinc knuckle  26.5      32 0.00069   13.5   0.5    7   12-18      2-8   (18)
421 smart00653 eIF2B_5 domain pres  26.4      39 0.00084   18.8   1.0   10   10-19     80-89  (110)
422 cd04792 LanM-like LanM-like pr  26.3      36 0.00078   23.6   1.0   12   17-28    113-124 (825)
423 PF04438 zf-HIT:  HIT zinc fing  25.9      50  0.0011   14.5   1.2   11    9-19     12-22  (30)
424 PF13912 zf-C2H2_6:  C2H2-type   25.8      42 0.00091   13.3   0.8    9   11-19      2-10  (27)
425 PF10164 DUF2367:  Uncharacteri  25.8      32 0.00068   19.4   0.6   10   10-19     88-97  (98)
426 COG3813 Uncharacterized protei  25.5      32 0.00068   18.9   0.5   13   12-24     43-55  (84)
427 cd01412 SIRT5_Af1_CobB SIRT5_A  25.3      33 0.00072   20.2   0.6   11    9-19    129-139 (224)
428 COG1856 Uncharacterized homolo  25.3     8.1 0.00018   25.2  -2.1   13   10-22     22-34  (275)
429 cd01675 RNR_III Class III ribo  25.1      31 0.00067   23.6   0.5   12    8-19    530-541 (555)
430 COG5216 Uncharacterized conser  25.0      34 0.00074   18.1   0.6   10    9-18     43-52  (67)
431 TIGR00515 accD acetyl-CoA carb  25.0      27 0.00058   22.3   0.2   12    9-20     25-36  (285)
432 smart00154 ZnF_AN1 AN1-like Zi  24.7      46   0.001   15.2   0.9   11   10-20     12-22  (39)
433 PF05191 ADK_lid:  Adenylate ki  24.6      33 0.00072   15.6   0.4    7   12-18      3-9   (36)
434 PF01873 eIF-5_eIF-2B:  Domain   24.5      33 0.00071   19.4   0.5    9   11-19     94-102 (125)
435 KOG3456 NADH:ubiquinone oxidor  24.3      35 0.00076   19.9   0.6   13    7-19    101-113 (120)
436 PF01258 zf-dskA_traR:  Prokary  24.2      56  0.0012   14.3   1.2   10   13-22      6-15  (36)
437 PRK00893 aspartate carbamoyltr  24.1      57  0.0012   19.4   1.5   14    7-20    131-144 (152)
438 PRK02048 4-hydroxy-3-methylbut  24.0      46   0.001   23.9   1.2   18    4-22    512-529 (611)
439 COG4307 Uncharacterized protei  23.8      48  0.0011   22.2   1.2   15   11-25      4-18  (349)
440 PF11789 zf-Nse:  Zinc-finger o  23.8      43 0.00093   16.5   0.8   12    7-18     21-32  (57)
441 COG1405 SUA7 Transcription ini  23.5      35 0.00075   21.8   0.5   10   11-20      2-11  (285)
442 COG5319 Uncharacterized protei  23.5      42 0.00091   20.1   0.8   12    8-19     30-41  (142)
443 cd01411 SIR2H SIR2H: Uncharact  23.4      43 0.00093   20.1   0.9   10   10-19    136-145 (225)
444 COG5533 UBP5 Ubiquitin C-termi  23.4      31 0.00067   23.6   0.3   17    3-19    277-293 (415)
445 PTZ00033 60S ribosomal protein  23.4      36 0.00078   19.9   0.5   11   10-20      3-13  (125)
446 COG0375 HybF Zn finger protein  23.3 1.1E+02  0.0023   17.5   2.5    9   11-19     87-95  (115)
447 PF01927 Mut7-C:  Mut7-C RNAse   23.3      66  0.0014   18.1   1.6   15   10-25     91-105 (147)
448 KOG2817 Predicted E3 ubiquitin  23.2      32 0.00068   23.5   0.3   14    5-18    367-382 (394)
449 cd01121 Sms Sms (bacterial rad  23.2      37  0.0008   22.1   0.6    8   11-18     15-22  (372)
450 PF00645 zf-PARP:  Poly(ADP-rib  23.2      62  0.0013   16.2   1.4   15    7-21      4-18  (82)
451 PRK05776 DNA topoisomerase I;   23.1      58  0.0013   22.9   1.5   11   10-20    596-606 (670)
452 PRK00241 nudC NADH pyrophospha  23.1      34 0.00073   21.1   0.4   11   12-22    101-111 (256)
453 PTZ00074 60S ribosomal protein  23.1      48   0.001   19.5   1.0   15    6-20     37-51  (135)
454 PHA02325 hypothetical protein   23.0      63  0.0014   17.3   1.4   13    9-21      2-14  (72)
455 PF11331 DUF3133:  Protein of u  22.9      84  0.0018   15.3   1.7   18    8-25     29-46  (46)
456 PRK07219 DNA topoisomerase I;   22.9      52  0.0011   23.6   1.3   16   10-25    602-617 (822)
457 cd01407 SIR2-fam SIR2 family o  22.8      47   0.001   19.6   1.0   11    9-19    132-142 (218)
458 KOG0320 Predicted E3 ubiquitin  22.8      36 0.00079   21.1   0.5   12   10-21    167-178 (187)
459 TIGR00433 bioB biotin syntheta  22.7      31 0.00066   20.7   0.1   16    8-23     38-53  (296)
460 PF10238 Eapp_C:  E2F-associate  22.6      54  0.0012   19.1   1.2   20    6-25    105-124 (136)
461 TIGR01051 topA_bact DNA topois  22.5      64  0.0014   22.3   1.7   14   11-24    575-588 (610)
462 PRK07220 DNA topoisomerase I;   22.5      62  0.0013   23.0   1.6   15   10-24    589-603 (740)
463 PF10235 Cript:  Microtubule-as  22.4      42  0.0009   18.5   0.6   11   11-21     70-80  (90)
464 TIGR00311 aIF-2beta translatio  22.4      51  0.0011   18.9   1.0   10   10-19     97-106 (133)
465 COG0777 AccD Acetyl-CoA carbox  22.3      35 0.00077   22.5   0.4   16    7-23     25-40  (294)
466 PF13451 zf-trcl:  Probable zin  22.3      78  0.0017   15.6   1.5   13   10-22      4-16  (49)
467 PF01430 HSP33:  Hsp33 protein;  22.2      63  0.0014   20.0   1.5   14    9-22    265-278 (280)
468 PF04135 Nop10p:  Nucleolar RNA  22.1      44 0.00095   16.7   0.6    8   12-19     19-26  (53)
469 PF04060 FeS:  Putative Fe-S cl  22.0      42  0.0009   15.1   0.5   11    9-19      3-13  (35)
470 PRK12495 hypothetical protein;  21.9      34 0.00074   21.8   0.2   12   10-21     42-53  (226)
471 KOG3125 Thymidine kinase [Nucl  21.8      56  0.0012   20.9   1.2   24   10-33    165-188 (234)
472 COG4469 CoiA Competence protei  21.8      52  0.0011   22.1   1.1   20   10-29     25-44  (342)
473 cd00296 SIR2 SIR2 superfamily   21.7      41  0.0009   19.4   0.6   11    9-19    133-143 (222)
474 PRK04351 hypothetical protein;  21.7 1.1E+02  0.0024   17.7   2.4   15    9-23    111-125 (149)
475 smart00132 LIM Zinc-binding do  21.6      42 0.00091   13.7   0.5   10   12-21      1-10  (39)
476 TIGR02487 NrdD anaerobic ribon  21.4      42  0.0009   23.2   0.6    9   11-19    539-547 (579)
477 TIGR00143 hypF [NiFe] hydrogen  21.2      68  0.0015   22.9   1.6   17    8-24    138-154 (711)
478 COG1601 GCD7 Translation initi  21.0      47   0.001   19.6   0.7    9   10-18    105-113 (151)
479 cd01413 SIR2_Af2 SIR2_Af2: Arc  21.0      46 0.00099   19.9   0.6   11    9-19    135-145 (222)
480 PF03470 zf-XS:  XS zinc finger  20.9      43 0.00093   16.2   0.4    7   13-19      1-7   (43)
481 PF05502 Dynactin_p62:  Dynacti  20.9      44 0.00096   22.7   0.6   19    5-24    293-311 (483)
482 PRK08780 DNA topoisomerase I;   20.7      77  0.0017   22.7   1.8   14   11-24    592-605 (780)
483 PF08421 Methyltransf_13:  Puta  20.6      83  0.0018   15.4   1.5   10   13-22      1-10  (62)
484 cd02757 MopB_Arsenate-R This C  20.6 1.5E+02  0.0033   19.7   3.1   23   12-34      5-29  (523)
485 PRK14704 anaerobic ribonucleos  20.6      43 0.00094   23.5   0.5    9   11-19    573-581 (618)
486 COG1655 Uncharacterized protei  20.6      34 0.00073   22.3   0.0   14    6-19     58-71  (267)
487 KOG3940 Uncharacterized conser  20.5      58  0.0013   22.0   1.1   11    9-19    321-331 (351)
488 PRK12336 translation initiatio  20.4      57  0.0012   19.6   1.0   10   10-19     98-107 (201)
489 PRK09129 NADH dehydrogenase su  20.3 1.5E+02  0.0032   20.7   3.1   24   11-34    220-245 (776)
490 COG4357 Zinc finger domain con  20.2      45 0.00097   19.1   0.5   12    8-19     78-89  (105)
491 PF13597 NRDD:  Anaerobic ribon  20.2      74  0.0016   21.8   1.6   13   10-22    504-517 (546)
492 cd02763 MopB_2 The MopB_2 CD i  20.0 1.4E+02  0.0031   21.1   3.0   23   12-34      3-27  (679)
493 smart00532 LIGANc Ligase N fam  20.0      61  0.0013   21.9   1.1   14    9-22    398-411 (441)

No 1  
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=99.81  E-value=3.6e-20  Score=90.92  Aligned_cols=34  Identities=68%  Similarity=1.249  Sum_probs=32.5

Q ss_pred             ccccCCCCceecCCCCCeEEEeecCCceEEEEeC
Q 035423            2 ENTLKPGDVIQCRECGYRILYKKRTRRIVQYEAR   35 (35)
Q Consensus         2 ~~~lk~~~~irC~~CG~RIlyK~R~~~~~~~~Ar   35 (35)
                      +++++.+++|+||+||||||||+||+++++|+||
T Consensus        11 ~~~~~~~~~irC~~CG~rIlyK~R~~~~~~~~Ar   44 (44)
T smart00659       11 ENEIKSKDVVRCRECGYRILYKKRTKRLVEVKAR   44 (44)
T ss_pred             EeecCCCCceECCCCCceEEEEeCCCceEEEEcC
Confidence            6788999999999999999999999999999997


No 2  
>KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7.0 [Transcription]
Probab=99.77  E-value=1.1e-20  Score=99.03  Aligned_cols=35  Identities=83%  Similarity=1.401  Sum_probs=33.7

Q ss_pred             CccccCCCCceecCCCCCeEEEeecCCceEEEEeC
Q 035423            1 MENTLKPGDVIQCRECGYRILYKKRTRRIVQYEAR   35 (35)
Q Consensus         1 ~~~~lk~~~~irC~~CG~RIlyK~R~~~~~~~~Ar   35 (35)
                      .+|+|+.+|+|||++||||||||+|+++++||+||
T Consensus        28 ~en~lk~~D~irCReCG~RIlyKkRtkrlvqfear   62 (62)
T KOG3507|consen   28 QENTLKRGDVIRCRECGYRILYKKRTKRLVQFEAR   62 (62)
T ss_pred             ccccccCCCcEehhhcchHHHHHHHHhhhheeecC
Confidence            47999999999999999999999999999999997


No 3  
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=99.61  E-value=6.5e-16  Score=77.89  Aligned_cols=31  Identities=35%  Similarity=0.515  Sum_probs=29.7

Q ss_pred             cCCCCceecCCCCCeEEEeecCCceEEEEeC
Q 035423            5 LKPGDVIQCRECGYRILYKKRTRRIVQYEAR   35 (35)
Q Consensus         5 lk~~~~irC~~CG~RIlyK~R~~~~~~~~Ar   35 (35)
                      ++.++.||||+||||||||.||+.+++|+|+
T Consensus        19 ~~~~~~irCp~Cg~rIl~K~R~~~~krvkA~   49 (49)
T COG1996          19 DQETRGIRCPYCGSRILVKERPKVPKRVKAR   49 (49)
T ss_pred             hhccCceeCCCCCcEEEEeccCCccEEEecC
Confidence            6789999999999999999999999999997


No 4  
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=99.59  E-value=3.6e-16  Score=72.93  Aligned_cols=25  Identities=72%  Similarity=1.226  Sum_probs=19.8

Q ss_pred             CccccCCCCceecCCCCCeEEEeec
Q 035423            1 MENTLKPGDVIQCRECGYRILYKKR   25 (35)
Q Consensus         1 ~~~~lk~~~~irC~~CG~RIlyK~R   25 (35)
                      ++|+|+.+|+|||++||||||||+|
T Consensus         8 ~~~~~~~~~~irC~~CG~RIlyK~R   32 (32)
T PF03604_consen    8 AEVELKPGDPIRCPECGHRILYKKR   32 (32)
T ss_dssp             SSE-BSTSSTSSBSSSS-SEEBE--
T ss_pred             CeeEcCCCCcEECCcCCCeEEEecC
Confidence            3688999999999999999999998


No 5  
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=98.92  E-value=1.7e-09  Score=52.15  Aligned_cols=26  Identities=42%  Similarity=0.888  Sum_probs=25.0

Q ss_pred             ceecCCCCCeEEEeecCCceEEEEeC
Q 035423           10 VIQCRECGYRILYKKRTRRIVQYEAR   35 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R~~~~~~~~Ar   35 (35)
                      .++||+||++++||.|++.++.++|+
T Consensus        21 ~~~Cp~CG~~~~~~~~~~~v~~~~~~   46 (46)
T PRK00398         21 GVRCPYCGYRILFKERPPVVKRVKAR   46 (46)
T ss_pred             ceECCCCCCeEEEccCCCcceEeecC
Confidence            89999999999999999999999986


No 6  
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=96.13  E-value=0.0013  Score=41.26  Aligned_cols=18  Identities=44%  Similarity=0.997  Sum_probs=14.5

Q ss_pred             CCCCceecCCCCCeEEEee
Q 035423            6 KPGDVIQCRECGYRILYKK   24 (35)
Q Consensus         6 k~~~~irC~~CG~RIlyK~   24 (35)
                      +..+.|.||+|| ||||..
T Consensus       217 ~~d~iv~CP~Cg-RILy~~  234 (239)
T COG1579         217 KKDEIVFCPYCG-RILYYD  234 (239)
T ss_pred             cCCCCccCCccc-hHHHhh
Confidence            467889999999 678754


No 7  
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=93.44  E-value=0.037  Score=27.77  Aligned_cols=12  Identities=50%  Similarity=0.822  Sum_probs=9.8

Q ss_pred             eecCCCCCeEEE
Q 035423           11 IQCRECGYRILY   22 (35)
Q Consensus        11 irC~~CG~RIly   22 (35)
                      |.||+||+.|-.
T Consensus         1 i~CPyCge~~~~   12 (52)
T PF14255_consen    1 IQCPYCGEPIEI   12 (52)
T ss_pred             CCCCCCCCeeEE
Confidence            579999998754


No 8  
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=92.19  E-value=0.29  Score=23.04  Aligned_cols=21  Identities=24%  Similarity=0.765  Sum_probs=16.4

Q ss_pred             CCceecCCCCCeEEEeecCCc
Q 035423            8 GDVIQCRECGYRILYKKRTRR   28 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK~R~~~   28 (35)
                      ...++|.+||++...+.++..
T Consensus         3 ~g~l~C~~CG~~m~~~~~~~~   23 (58)
T PF13408_consen    3 SGLLRCGHCGSKMTRRKRKGK   23 (58)
T ss_pred             CCcEEcccCCcEeEEEECCCC
Confidence            356899999999888776643


No 9  
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=91.89  E-value=0.19  Score=22.65  Aligned_cols=14  Identities=29%  Similarity=0.795  Sum_probs=10.9

Q ss_pred             CCceecCCCCCeEE
Q 035423            8 GDVIQCRECGYRIL   21 (35)
Q Consensus         8 ~~~irC~~CG~RIl   21 (35)
                      +..++|++||+.+.
T Consensus        23 ~~~v~C~~C~~~~~   36 (38)
T TIGR02098        23 GGKVRCGKCGHVWY   36 (38)
T ss_pred             CCEEECCCCCCEEE
Confidence            34699999999753


No 10 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=91.70  E-value=0.071  Score=23.41  Aligned_cols=12  Identities=33%  Similarity=0.880  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      .....||+|||-
T Consensus        12 ~~~~~Cp~CG~~   23 (26)
T PF10571_consen   12 ESAKFCPHCGYD   23 (26)
T ss_pred             hhcCcCCCCCCC
Confidence            456789999985


No 11 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.89  E-value=0.13  Score=28.81  Aligned_cols=14  Identities=43%  Similarity=0.904  Sum_probs=11.2

Q ss_pred             cCCCCceecCCCCCe
Q 035423            5 LKPGDVIQCRECGYR   19 (35)
Q Consensus         5 lk~~~~irC~~CG~R   19 (35)
                      |+. ++|.||+||.-
T Consensus        22 Lnk-~PivCP~CG~~   35 (108)
T PF09538_consen   22 LNK-DPIVCPKCGTE   35 (108)
T ss_pred             CCC-CCccCCCCCCc
Confidence            455 78999999974


No 12 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=90.45  E-value=0.48  Score=22.41  Aligned_cols=22  Identities=27%  Similarity=0.552  Sum_probs=16.9

Q ss_pred             cCCCCceecCCCCCeEEEeecC
Q 035423            5 LKPGDVIQCRECGYRILYKKRT   26 (35)
Q Consensus         5 lk~~~~irC~~CG~RIlyK~R~   26 (35)
                      +.=.+++.||.||+.-.|..++
T Consensus        13 ~RW~~g~~CP~Cg~~~~~~~~~   34 (46)
T PF12760_consen   13 IRWPDGFVCPHCGSTKHYRLKT   34 (46)
T ss_pred             hcCCCCCCCCCCCCeeeEEeCC
Confidence            3445668899999987887776


No 13 
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=90.37  E-value=0.13  Score=30.06  Aligned_cols=15  Identities=40%  Similarity=0.833  Sum_probs=12.6

Q ss_pred             cCCCCceecCCCCCe
Q 035423            5 LKPGDVIQCRECGYR   19 (35)
Q Consensus         5 lk~~~~irC~~CG~R   19 (35)
                      |..+.+-||++||+=
T Consensus       107 l~~g~~~RCpeCG~~  121 (136)
T PF01215_consen  107 LHKGKPQRCPECGQV  121 (136)
T ss_dssp             EETTSEEEETTTEEE
T ss_pred             EeCCCccCCCCCCeE
Confidence            567889999999983


No 14 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=90.30  E-value=0.26  Score=22.64  Aligned_cols=15  Identities=27%  Similarity=0.753  Sum_probs=11.8

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      ..+..+||+.||+..
T Consensus        21 ~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen   21 AGGRKVRCPKCGHVF   35 (37)
T ss_pred             cCCcEEECCCCCcEe
Confidence            346689999999864


No 15 
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=89.97  E-value=0.18  Score=27.91  Aligned_cols=19  Identities=32%  Similarity=0.607  Sum_probs=14.6

Q ss_pred             cCCCCceecCCCCCeEEEe
Q 035423            5 LKPGDVIQCRECGYRILYK   23 (35)
Q Consensus         5 lk~~~~irC~~CG~RIlyK   23 (35)
                      |..+.+-||++||+=...+
T Consensus        74 l~~g~~~rC~eCG~~fkL~   92 (97)
T cd00924          74 LEKGKPKRCPECGHVFKLV   92 (97)
T ss_pred             EeCCCceeCCCCCcEEEEE
Confidence            5677899999999954433


No 16 
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=89.59  E-value=0.23  Score=27.79  Aligned_cols=13  Identities=31%  Similarity=0.457  Sum_probs=11.5

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      +++||+||-.+.+
T Consensus         2 p~~CpYCg~~~~l   14 (102)
T PF11672_consen    2 PIICPYCGGPAEL   14 (102)
T ss_pred             CcccCCCCCeeEE
Confidence            6899999998876


No 17 
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=89.37  E-value=0.24  Score=23.68  Aligned_cols=11  Identities=36%  Similarity=0.869  Sum_probs=9.3

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..+.|||||-+
T Consensus        28 ~~~~CpYCg~~   38 (40)
T PF10276_consen   28 GPVVCPYCGTR   38 (40)
T ss_dssp             CEEEETTTTEE
T ss_pred             CeEECCCCCCE
Confidence            46999999976


No 18 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=89.27  E-value=0.15  Score=21.87  Aligned_cols=10  Identities=30%  Similarity=0.860  Sum_probs=7.0

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .+.||+||..
T Consensus         2 ~~~Cp~Cg~~   11 (26)
T PF13248_consen    2 EMFCPNCGAE   11 (26)
T ss_pred             cCCCcccCCc
Confidence            4678888874


No 19 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=89.02  E-value=0.35  Score=22.22  Aligned_cols=14  Identities=29%  Similarity=0.857  Sum_probs=11.0

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      .+..++|+.||+.+
T Consensus        22 ~g~~v~C~~C~~~f   35 (36)
T PF13717_consen   22 KGRKVRCSKCGHVF   35 (36)
T ss_pred             CCcEEECCCCCCEe
Confidence            45679999999864


No 20 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=88.86  E-value=0.34  Score=25.13  Aligned_cols=27  Identities=30%  Similarity=0.634  Sum_probs=21.5

Q ss_pred             ccccCCCCceecCCCCCeEEEeecCCc
Q 035423            2 ENTLKPGDVIQCRECGYRILYKKRTRR   28 (35)
Q Consensus         2 ~~~lk~~~~irC~~CG~RIlyK~R~~~   28 (35)
                      +++.+....+-|++|||-=||+.-+..
T Consensus        28 dvq~~~f~~v~C~~CGYTE~Y~~~~~~   54 (64)
T PF09855_consen   28 DVQNKKFTTVSCTNCGYTEFYKAKTSN   54 (64)
T ss_pred             EecCcEEEEEECCCCCCEEEEeecCcc
Confidence            445566778999999999999976654


No 21 
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=88.63  E-value=0.46  Score=24.95  Aligned_cols=16  Identities=19%  Similarity=0.472  Sum_probs=13.1

Q ss_pred             ccCCCCceecCCCCCe
Q 035423            4 TLKPGDVIQCRECGYR   19 (35)
Q Consensus         4 ~lk~~~~irC~~CG~R   19 (35)
                      ++.....+.|||||-+
T Consensus        42 ~mg~~gev~CPYC~t~   57 (62)
T COG4391          42 DMGDEGEVVCPYCSTR   57 (62)
T ss_pred             EcCCCCcEecCccccE
Confidence            4567778999999986


No 22 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=88.24  E-value=0.17  Score=21.52  Aligned_cols=12  Identities=33%  Similarity=0.825  Sum_probs=8.2

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      +..-|++||+.|
T Consensus        12 ~~~fC~~CG~~l   23 (23)
T PF13240_consen   12 DAKFCPNCGTPL   23 (23)
T ss_pred             cCcchhhhCCcC
Confidence            455688888764


No 23 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=88.16  E-value=0.26  Score=22.09  Aligned_cols=12  Identities=33%  Similarity=0.789  Sum_probs=10.1

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      .+.+.||+||..
T Consensus        24 ~~~~~CP~Cg~~   35 (41)
T smart00834       24 DPLATCPECGGD   35 (41)
T ss_pred             CCCCCCCCCCCc
Confidence            678899999984


No 24 
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=87.87  E-value=0.47  Score=22.67  Aligned_cols=13  Identities=23%  Similarity=0.782  Sum_probs=9.8

Q ss_pred             ecCCCCCeEEEee
Q 035423           12 QCRECGYRILYKK   24 (35)
Q Consensus        12 rC~~CG~RIlyK~   24 (35)
                      +||+||.+-....
T Consensus         1 ~CP~Cg~~a~ir~   13 (47)
T PF04606_consen    1 RCPHCGSKARIRT   13 (47)
T ss_pred             CcCCCCCeeEEEE
Confidence            5999999865544


No 25 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=87.74  E-value=0.39  Score=22.53  Aligned_cols=12  Identities=42%  Similarity=0.994  Sum_probs=9.6

Q ss_pred             CCCceecCCCCC
Q 035423            7 PGDVIQCRECGY   18 (35)
Q Consensus         7 ~~~~irC~~CG~   18 (35)
                      ..+.+.||.||.
T Consensus        23 ~~~~~~CP~Cg~   34 (42)
T PF09723_consen   23 EDDPVPCPECGS   34 (42)
T ss_pred             CCCCCcCCCCCC
Confidence            356888999998


No 26 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=87.19  E-value=0.36  Score=21.89  Aligned_cols=17  Identities=35%  Similarity=0.864  Sum_probs=11.7

Q ss_pred             ccCCCCceecCCCCCeE
Q 035423            4 TLKPGDVIQCRECGYRI   20 (35)
Q Consensus         4 ~lk~~~~irC~~CG~RI   20 (35)
                      .+..+...-||+|||-|
T Consensus        13 ~y~D~~~~vCp~C~~ew   29 (30)
T PF08274_consen   13 TYEDGELLVCPECGHEW   29 (30)
T ss_dssp             -EE-SSSEEETTTTEEE
T ss_pred             eeccCCEEeCCcccccC
Confidence            34567778899999864


No 27 
>COG4311 SoxD Sarcosine oxidase delta subunit [Amino acid transport and metabolism]
Probab=87.14  E-value=0.28  Score=27.67  Aligned_cols=11  Identities=45%  Similarity=0.896  Sum_probs=9.1

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..|.||+||-|
T Consensus         2 lLI~CP~Cg~R   12 (97)
T COG4311           2 LLIPCPYCGER   12 (97)
T ss_pred             ceecCCCCCCC
Confidence            35899999976


No 28 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=87.03  E-value=0.26  Score=24.06  Aligned_cols=13  Identities=31%  Similarity=1.214  Sum_probs=9.8

Q ss_pred             cCCC-CceecCCCC
Q 035423            5 LKPG-DVIQCRECG   17 (35)
Q Consensus         5 lk~~-~~irC~~CG   17 (35)
                      ++.. ..+.||+||
T Consensus        40 i~~~~~i~~Cp~Cg   53 (56)
T PF02591_consen   40 IRKGDEIVFCPNCG   53 (56)
T ss_pred             HHcCCCeEECcCCC
Confidence            4344 679999998


No 29 
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=86.87  E-value=0.43  Score=24.39  Aligned_cols=13  Identities=23%  Similarity=0.820  Sum_probs=8.1

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      .++||.||..+.+
T Consensus         2 ~v~CP~C~k~~~~   14 (57)
T PF03884_consen    2 TVKCPICGKPVEW   14 (57)
T ss_dssp             EEE-TTT--EEE-
T ss_pred             cccCCCCCCeecc
Confidence            5899999999988


No 30 
>KOG3352 consensus Cytochrome c oxidase, subunit Vb/COX4 [Energy production and conversion]
Probab=86.68  E-value=0.3  Score=29.39  Aligned_cols=18  Identities=39%  Similarity=0.888  Sum_probs=14.3

Q ss_pred             cCCCCceecCCCCCeEEEee
Q 035423            5 LKPGDVIQCRECGYRILYKK   24 (35)
Q Consensus         5 lk~~~~irC~~CG~RIlyK~   24 (35)
                      |..++.-||++|||-  ||.
T Consensus       128 l~Kge~~rc~eCG~~--fkL  145 (153)
T KOG3352|consen  128 LEKGETQRCPECGHY--FKL  145 (153)
T ss_pred             EEcCCcccCCcccce--EEe
Confidence            567888999999995  553


No 31 
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=86.60  E-value=0.61  Score=21.70  Aligned_cols=14  Identities=21%  Similarity=0.804  Sum_probs=10.2

Q ss_pred             eecCCCCCeEEEee
Q 035423           11 IQCRECGYRILYKK   24 (35)
Q Consensus        11 irC~~CG~RIlyK~   24 (35)
                      ..||.||..++.|.
T Consensus         2 ~~CP~Cg~~lv~r~   15 (39)
T PF01396_consen    2 EKCPKCGGPLVLRR   15 (39)
T ss_pred             cCCCCCCceeEEEE
Confidence            57999997755544


No 32 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=86.02  E-value=0.32  Score=28.68  Aligned_cols=8  Identities=38%  Similarity=1.107  Sum_probs=6.1

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      .+||+||+
T Consensus         1 m~cp~c~~    8 (154)
T PRK00464          1 MRCPFCGH    8 (154)
T ss_pred             CcCCCCCC
Confidence            37888886


No 33 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=85.90  E-value=0.48  Score=22.01  Aligned_cols=12  Identities=33%  Similarity=0.791  Sum_probs=6.4

Q ss_pred             eecCCCCCeEEE
Q 035423           11 IQCRECGYRILY   22 (35)
Q Consensus        11 irC~~CG~RIly   22 (35)
                      |.||.||++-.+
T Consensus         1 ~~Cp~Cg~~~a~   12 (39)
T PF01096_consen    1 IKCPKCGHNEAV   12 (39)
T ss_dssp             S--SSS-SSEEE
T ss_pred             CCCcCCCCCeEE
Confidence            579999987543


No 34 
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=85.61  E-value=0.47  Score=21.85  Aligned_cols=14  Identities=21%  Similarity=0.570  Sum_probs=11.1

Q ss_pred             ceecCCCCCeEEEe
Q 035423           10 VIQCRECGYRILYK   23 (35)
Q Consensus        10 ~irC~~CG~RIlyK   23 (35)
                      +..||.||..-+++
T Consensus         2 ~~~Cp~Cg~~~~~~   15 (47)
T PF14690_consen    2 PPRCPHCGSPSVHR   15 (47)
T ss_pred             CccCCCcCCCceEC
Confidence            56899999887554


No 35 
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=85.46  E-value=0.87  Score=23.41  Aligned_cols=20  Identities=30%  Similarity=0.544  Sum_probs=16.6

Q ss_pred             ceecCCCCCeEEEeecCCce
Q 035423           10 VIQCRECGYRILYKKRTRRI   29 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R~~~~   29 (35)
                      =+.||.||.+-..|.|.+.+
T Consensus         4 Wi~CP~CgnKTR~kir~DT~   23 (55)
T PF14205_consen    4 WILCPICGNKTRLKIREDTV   23 (55)
T ss_pred             EEECCCCCCccceeeecCce
Confidence            47899999998888888754


No 36 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=85.44  E-value=0.92  Score=20.71  Aligned_cols=18  Identities=22%  Similarity=0.586  Sum_probs=13.8

Q ss_pred             CceecCCCCCeEEE-eecC
Q 035423            9 DVIQCRECGYRILY-KKRT   26 (35)
Q Consensus         9 ~~irC~~CG~RIly-K~R~   26 (35)
                      +..+|..||+..++ ++..
T Consensus         2 ~~~~C~~C~~~~i~~~~~~   20 (33)
T PF08792_consen    2 NLKKCSKCGGNGIVNKEDD   20 (33)
T ss_pred             CceEcCCCCCCeEEEecCC
Confidence            45789999999888 6544


No 37 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=85.07  E-value=0.53  Score=24.67  Aligned_cols=13  Identities=31%  Similarity=1.048  Sum_probs=9.1

Q ss_pred             CCCceecCCCCCe
Q 035423            7 PGDVIQCRECGYR   19 (35)
Q Consensus         7 ~~~~irC~~CG~R   19 (35)
                      .+.+.+||+||+.
T Consensus        47 ~g~~Y~Cp~CGF~   59 (61)
T COG2888          47 LGNPYRCPKCGFE   59 (61)
T ss_pred             cCCceECCCcCcc
Confidence            4566778888863


No 38 
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=84.96  E-value=0.37  Score=28.65  Aligned_cols=8  Identities=25%  Similarity=0.779  Sum_probs=5.9

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      ++||+|||
T Consensus         1 M~CP~C~~    8 (147)
T TIGR00244         1 MHCPFCQH    8 (147)
T ss_pred             CCCCCCCC
Confidence            36888877


No 39 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=84.77  E-value=0.82  Score=21.59  Aligned_cols=11  Identities=36%  Similarity=0.869  Sum_probs=9.2

Q ss_pred             CCceecCCCCC
Q 035423            8 GDVIQCRECGY   18 (35)
Q Consensus         8 ~~~irC~~CG~   18 (35)
                      .+.+.||.||.
T Consensus        24 ~~~~~CP~Cg~   34 (52)
T TIGR02605        24 DPLATCPECGG   34 (52)
T ss_pred             CCCCCCCCCCC
Confidence            45788999998


No 40 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=84.72  E-value=0.68  Score=20.16  Aligned_cols=12  Identities=25%  Similarity=0.863  Sum_probs=9.3

Q ss_pred             CCCceecCCCCC
Q 035423            7 PGDVIQCRECGY   18 (35)
Q Consensus         7 ~~~~irC~~CG~   18 (35)
                      .+-...||+||.
T Consensus        13 ~~v~f~CPnCG~   24 (24)
T PF07754_consen   13 QAVPFPCPNCGF   24 (24)
T ss_pred             cCceEeCCCCCC
Confidence            355788999995


No 41 
>PF06107 DUF951:  Bacterial protein of unknown function (DUF951);  InterPro: IPR009296 This family consists of several short hypothetical bacterial proteins of unknown function.
Probab=84.68  E-value=0.84  Score=23.52  Aligned_cols=15  Identities=33%  Similarity=0.722  Sum_probs=12.5

Q ss_pred             CceecCCCCCeEEEe
Q 035423            9 DVIQCRECGYRILYK   23 (35)
Q Consensus         9 ~~irC~~CG~RIlyK   23 (35)
                      -.++|..||+.||.-
T Consensus        30 ikikC~gCg~~imlp   44 (57)
T PF06107_consen   30 IKIKCLGCGRQIMLP   44 (57)
T ss_pred             EEEEECCCCCEEEEe
Confidence            358999999998864


No 42 
>PLN02294 cytochrome c oxidase subunit Vb
Probab=84.09  E-value=1.2  Score=27.26  Aligned_cols=19  Identities=21%  Similarity=0.499  Sum_probs=15.3

Q ss_pred             cCCCCceecCCCCCeEEEe
Q 035423            5 LKPGDVIQCRECGYRILYK   23 (35)
Q Consensus         5 lk~~~~irC~~CG~RIlyK   23 (35)
                      |..+.+.||++||+-...|
T Consensus       136 L~kGkp~RCpeCG~~fkL~  154 (174)
T PLN02294        136 LEKGKSFECPVCTQYFELE  154 (174)
T ss_pred             ecCCCceeCCCCCCEEEEE
Confidence            5678899999999965544


No 43 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=83.37  E-value=0.57  Score=26.65  Aligned_cols=20  Identities=15%  Similarity=0.459  Sum_probs=15.4

Q ss_pred             CceecCCCCCeEEEeecCCc
Q 035423            9 DVIQCRECGYRILYKKRTRR   28 (35)
Q Consensus         9 ~~irC~~CG~RIlyK~R~~~   28 (35)
                      ....||+||..+.+...+..
T Consensus       122 ~~f~Cp~Cg~~l~~~dn~~~  141 (147)
T smart00531      122 GTFTCPRCGEELEEDDNSEP  141 (147)
T ss_pred             CcEECCCCCCEEEEcCchhh
Confidence            34899999999888766554


No 44 
>cd00246 RabGEF Nucleotide exchange factor for Rab-like small GTPases (RabGEF), Mss4 type; RabGEF positely regulates the function of  Rab GTPase by promoting exchange of GDP for GTP; members of the Rab subfamily of Ras GTPases are important in vesicular transport;
Probab=83.22  E-value=0.85  Score=25.84  Aligned_cols=13  Identities=38%  Similarity=1.053  Sum_probs=11.4

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      .|+|+.||..||=
T Consensus         2 ~v~C~~C~S~VL~   14 (103)
T cd00246           2 AVLCQRCGSRVLT   14 (103)
T ss_pred             ceECCCCCCEEEe
Confidence            4899999999983


No 45 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=83.21  E-value=0.75  Score=23.86  Aligned_cols=12  Identities=25%  Similarity=0.969  Sum_probs=7.5

Q ss_pred             CCCceecCCCCC
Q 035423            7 PGDVIQCRECGY   18 (35)
Q Consensus         7 ~~~~irC~~CG~   18 (35)
                      .+.+.+||+||+
T Consensus        45 ~~~~Y~CP~CGF   56 (59)
T PRK14890         45 QSNPYTCPKCGF   56 (59)
T ss_pred             cCCceECCCCCC
Confidence            345567777775


No 46 
>COG4481 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=82.98  E-value=0.98  Score=23.58  Aligned_cols=13  Identities=31%  Similarity=0.973  Sum_probs=11.4

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      .|+|.+|||-||.
T Consensus        34 kikC~nC~h~vm~   46 (60)
T COG4481          34 KIKCENCGHSVMM   46 (60)
T ss_pred             EEEecCCCcEEEe
Confidence            5789999999886


No 47 
>PF14353 CpXC:  CpXC protein
Probab=82.46  E-value=0.86  Score=24.97  Aligned_cols=11  Identities=27%  Similarity=0.921  Sum_probs=8.8

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      ...||+||+..
T Consensus        38 ~~~CP~Cg~~~   48 (128)
T PF14353_consen   38 SFTCPSCGHKF   48 (128)
T ss_pred             EEECCCCCCce
Confidence            57899999764


No 48 
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=82.31  E-value=0.97  Score=27.57  Aligned_cols=17  Identities=24%  Similarity=0.362  Sum_probs=12.5

Q ss_pred             CCceecCCCCCeEEEee
Q 035423            8 GDVIQCRECGYRILYKK   24 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK~   24 (35)
                      .+.-.||.||++++-|.
T Consensus       151 ~~~~~Cp~CG~~~~~~~  167 (177)
T COG1439         151 EPKDFCPICGSPLKRKR  167 (177)
T ss_pred             CCCCcCCCCCCceEEee
Confidence            45567999999955543


No 49 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=81.91  E-value=0.66  Score=28.00  Aligned_cols=15  Identities=33%  Similarity=0.722  Sum_probs=11.7

Q ss_pred             CCCceecCCCCCeEE
Q 035423            7 PGDVIQCRECGYRIL   21 (35)
Q Consensus         7 ~~~~irC~~CG~RIl   21 (35)
                      .++.+-||+|||--+
T Consensus        45 ~Y~V~vCP~CgyA~~   59 (214)
T PF09986_consen   45 FYEVWVCPHCGYAAF   59 (214)
T ss_pred             eeeEEECCCCCCccc
Confidence            467889999998643


No 50 
>PF06054 CoiA:  Competence protein CoiA-like family;  InterPro: IPR010330 Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation. It is widespread among bacteria and is probably an important mechanism for the horizontal transfer of genes. Cells that take up DNA inevitably acquire the nucleotides the DNA consists of, and, because nucleotides are needed for DNA and RNA synthesis and are expensive to synthesise, these may make a significant contribution to the cell's energy budget []. The lateral gene transfer caused by competence also contributes to the genetic diversity that makes evolution possible.  DNA usually becomes available by the death and lysis of other cells. Competent bacteria use components of extracellular filaments called type 4 pili to create pores in their membranes and pull DNA through the pores into the cytoplasm. This process, including the development of competence and the expression of the uptake machinery, is regulated in response to cell-cell signalling and/or nutritional conditions []. Many of the members of this family are described as transcription factors. CoiA falls within a competence-specific operon in Streptococcus. CoiA is an uncharacterised protein.
Probab=81.90  E-value=2  Score=27.88  Aligned_cols=25  Identities=24%  Similarity=0.582  Sum_probs=21.3

Q ss_pred             CCceecCCCCCeEEEeecCCceEEE
Q 035423            8 GDVIQCRECGYRILYKKRTRRIVQY   32 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK~R~~~~~~~   32 (35)
                      .....||.||..++.|.-..+.-.|
T Consensus        28 ~~~~~CP~C~~~v~lk~G~~k~~HF   52 (375)
T PF06054_consen   28 KGKYFCPGCGEPVILKKGKKKIPHF   52 (375)
T ss_pred             CCcEECCCCCCeeEEEEcCccccee
Confidence            7789999999999999877766655


No 51 
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=81.87  E-value=1  Score=19.80  Aligned_cols=11  Identities=27%  Similarity=0.920  Sum_probs=6.3

Q ss_pred             ecCCCCCeEEE
Q 035423           12 QCRECGYRILY   22 (35)
Q Consensus        12 rC~~CG~RIly   22 (35)
                      .||.||..++.
T Consensus         1 ~CP~C~s~l~~   11 (28)
T PF03119_consen    1 TCPVCGSKLVR   11 (28)
T ss_dssp             B-TTT--BEEE
T ss_pred             CcCCCCCEeEc
Confidence            49999999773


No 52 
>PRK09710 lar restriction alleviation and modification protein; Reviewed
Probab=81.76  E-value=2.5  Score=22.21  Aligned_cols=21  Identities=19%  Similarity=0.286  Sum_probs=15.6

Q ss_pred             ecCCCCCeEEEeecCCceEEE
Q 035423           12 QCRECGYRILYKKRTRRIVQY   32 (35)
Q Consensus        12 rC~~CG~RIlyK~R~~~~~~~   32 (35)
                      -||.||+.++.-+.+...-++
T Consensus         8 PCPFCG~~~~~v~~~~g~~~v   28 (64)
T PRK09710          8 PCPFCGCPSVTVKAISGYYRA   28 (64)
T ss_pred             CCCCCCCceeEEEecCceEEE
Confidence            399999999887776554443


No 53 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=80.92  E-value=1.1  Score=20.15  Aligned_cols=17  Identities=24%  Similarity=0.626  Sum_probs=12.8

Q ss_pred             cCCCCceecCCCCCeEE
Q 035423            5 LKPGDVIQCRECGYRIL   21 (35)
Q Consensus         5 lk~~~~irC~~CG~RIl   21 (35)
                      ++..+...|+.||-.++
T Consensus        27 i~~vp~~~C~~CGE~~~   43 (46)
T TIGR03831        27 IENVPALVCPQCGEEYL   43 (46)
T ss_pred             EeCCCccccccCCCEee
Confidence            45566778999998764


No 54 
>TIGR01374 soxD sarcosine oxidase, delta subunit family, heterotetrameric form. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) form
Probab=80.66  E-value=0.73  Score=25.18  Aligned_cols=9  Identities=56%  Similarity=1.161  Sum_probs=7.8

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      |.||.||-|
T Consensus         2 I~CP~CG~R   10 (84)
T TIGR01374         2 IPCPYCGPR   10 (84)
T ss_pred             ccCCCCCCc
Confidence            789999976


No 55 
>smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1. Also present in archaeal proteins.
Probab=80.60  E-value=0.89  Score=26.77  Aligned_cols=10  Identities=50%  Similarity=1.484  Sum_probs=8.7

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ...|++||||
T Consensus        29 sf~C~~CGyk   38 (160)
T smart00709       29 SFECEHCGYR   38 (160)
T ss_pred             EEECCCCCCc
Confidence            5689999998


No 56 
>smart00238 BIR Baculoviral inhibition of apoptosis protein repeat. Domain found in inhibitor of apoptosis proteins (IAPs) and other proteins. Acts as a direct inhibitor of caspase enzymes.
Probab=80.17  E-value=1.1  Score=22.09  Aligned_cols=13  Identities=38%  Similarity=0.915  Sum_probs=11.4

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      +|.++|.+||..+
T Consensus        34 ~d~v~C~~C~~~l   46 (71)
T smart00238       34 GDEVKCFFCGGEL   46 (71)
T ss_pred             CCEEEeCCCCCCc
Confidence            6789999999875


No 57 
>KOG2691 consensus RNA polymerase II subunit 9 [Transcription]
Probab=80.14  E-value=0.99  Score=26.08  Aligned_cols=26  Identities=31%  Similarity=0.703  Sum_probs=18.8

Q ss_pred             ccccCCCCceecCCCCCe--EEEeecCC
Q 035423            2 ENTLKPGDVIQCRECGYR--ILYKKRTR   27 (35)
Q Consensus         2 ~~~lk~~~~irC~~CG~R--IlyK~R~~   27 (35)
                      |+.|+......||.||++  ++|-.++.
T Consensus        65 DPTLPrts~~~C~~C~~~eavffQ~~~~   92 (113)
T KOG2691|consen   65 DPTLPRTSDKHCPKCGHREAVFFQAQTR   92 (113)
T ss_pred             CCCcCccccccCCccCCcceEEEecccc
Confidence            455677678899999997  55655544


No 58 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=80.02  E-value=0.84  Score=21.99  Aligned_cols=9  Identities=33%  Similarity=0.885  Sum_probs=6.0

Q ss_pred             ceecCCCCC
Q 035423           10 VIQCRECGY   18 (35)
Q Consensus        10 ~irC~~CG~   18 (35)
                      ...||+||.
T Consensus         2 ~f~CP~C~~   10 (54)
T PF05605_consen    2 SFTCPYCGK   10 (54)
T ss_pred             CcCCCCCCC
Confidence            456777775


No 59 
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=79.78  E-value=0.99  Score=26.77  Aligned_cols=10  Identities=50%  Similarity=1.368  Sum_probs=8.8

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ...|++||||
T Consensus        28 sf~C~~CGyr   37 (163)
T TIGR00340        28 TYICEKCGYR   37 (163)
T ss_pred             EEECCCCCCc
Confidence            5789999998


No 60 
>PF00653 BIR:  Inhibitor of Apoptosis domain;  InterPro: IPR001370 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.   The baculovirus inhibitor of apoptosis protein repeat (BIR) is a domain of tandem repeats separated by a variable length linker that seems to confer cell death-preventing activity [, ]. The BIR domains characterise the Inhibitor of Apoptosis (IAP) family of proteins (MEROPS proteinase inhibitor family I32, clan IV) that suppress apoptosis by interacting with and inhibiting the enzymatic activity of both initiator and effector caspases (MEROPS peptidase family C14, IPR002398 from INTERPRO). Several distinct mammalian IAPs including XIAP, c-IAP1, c-IAP2, and ML-IAP, have been identified, and they all exhibit antiapoptotic activity in cell culture. The functional unit in each IAP protein is the baculoviral IAP repeat (BIR), which contains approximately 80 amino acids folded around a zinc atom. Most mammalian IAPs have more than one BIR domain, with the different BIR domains performing distinct functions. For example, in XIAP, the third BIR domain (BIR3) potently inhibits the catalytic activity of caspase-9, whereas the linker sequences immediately preceding the second BIR domain (BIR2) selectively targets caspase-3 or -7.  The first-recognised members of family MEROPS inhibitor family I32 were viral proteins that inhibited the apoptosis of infected cells: Cp-IAP from Cydia pomonella granulosis virus (CpGV) [] and Op-IAP from Orgyia pseudotsugata multicapsid polyhedrosis virus(OpMNPV) []. The discovery of homologous proteins in mammals followed soon after with the recognition that mutations in the gene for neuronal apoptosis inhibitory protein (NIAP) underlie spinal muscular atrophy []. The inhibitors in family I32 all possess one or more 80-residue domains known as BIR (baculovirus inhibitor repeat) domains and have accordingly been termed 'BIR-containing' or 'BIRC' proteins as well as IAP proteins.  The mechanism of inhibition of caspases by the IAP proteins is complex, and reactive site residues cannot yet be identified with any confidence. Despite the conservation of the BIR or IAP (inhibitor of apoptosis) domains throughout the family it seems clear that other parts of the molecules also make essential contributions to inhibitory activity.  Homologs of most components in the mammalian apoptotic pathway have been identified in fruit flies. The Drosophila Apaf-1, known as Dapaf-1, HAC-1 or Dark, shares significant sequence similarity with its mammalian counterpart, and is critically important for the activation of the Drosophila initiator caspase Dronc. Dronc, in turn, cleaves and activates the effector caspase DrICE. The Drosophila IAP, DIAP1, binds to and in-activates both DrICE and Dronc through its BIR1 and BIR2 domains. During apoptosis, the anti-death function of DIAP1 is countered by at least four pro-apoptotic proteins, Reaper, Hid, Grim, and sickle, through direct physical interactions. These four proteins represent the functional homologs of the mammalian protein Smac, and they all share a conserved IAP-binding motif at their N termini. The three proteins Reaper, Hid, and Grim are collectively referred to as the RHG proteins [, ].  Both XIAP and DIAP1 contain a RING domain at their C termini, and can act as an E3 ubiquitin ligase. Indeed, both XIAP and DIAP1 have been shown to promote self-ubiquitination and degradation as well as to negatively regulate the target caspases. Nonetheless, important differences exist between XIAP and DIAP1. The primary function of XIAP is thought to inhibit the catalytic activities of caspases; to what extent the ubiquitinating activity of XIAP contributes to its function remains unclear. For DIAP1, however, the ubiquitinating activity appears to be essential for its function.  Recently a Drosophila p53 protein has been identified that mediates apoptosis via a novel pathway involving the activation of the Reaper gene and subsequent inhibition of the inhibitors of apoptosis (IAPs). CIAP1, a major mammalian homologue of Drosophila IAPs, is irreversibly inhibited (cleaved) during p53-dependent apoptosis and this cleavage is mediated by a serine protease. Serine protease inhibitors that block CIAP1 cleavage inhibit p53-dependent apoptosis. Furthermore, activation of the p53 protein increases the transcription of the HTRA2 gene, which encodes a serine protease that interacts with CIAP1 and potentiates apoptosis. Therefore mammalian p53 protein activates apoptosis through a novel pathway functionally similar to that in Drosophila, which involves HTRA2 and subsequent inhibition of CIAP1 by cleavage [].; GO: 0005622 intracellular; PDB: 3HL5_B 3UW5_A 3CM7_A 1G3F_A 1G73_C 3G76_G 3CM2_C 2VSL_A 2OPZ_B 3CLX_A ....
Probab=79.23  E-value=1.3  Score=22.11  Aligned_cols=13  Identities=38%  Similarity=1.045  Sum_probs=11.7

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      .+.++|-+||..|
T Consensus        34 ~d~v~C~~C~~~l   46 (70)
T PF00653_consen   34 GDRVRCFYCGLEL   46 (70)
T ss_dssp             TTEEEETTTTEEE
T ss_pred             CCEEEEeccCCEE
Confidence            6899999999886


No 61 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=79.13  E-value=0.94  Score=21.15  Aligned_cols=11  Identities=36%  Similarity=0.824  Sum_probs=8.1

Q ss_pred             ecCCCCCeEEE
Q 035423           12 QCRECGYRILY   22 (35)
Q Consensus        12 rC~~CG~RIly   22 (35)
                      .||.||++=.+
T Consensus         2 ~Cp~C~~~~a~   12 (40)
T smart00440        2 PCPKCGNREAT   12 (40)
T ss_pred             cCCCCCCCeEE
Confidence            69999987443


No 62 
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=79.11  E-value=1.1  Score=23.79  Aligned_cols=12  Identities=25%  Similarity=0.913  Sum_probs=9.4

Q ss_pred             ceecCCCCCeEE
Q 035423           10 VIQCRECGYRIL   21 (35)
Q Consensus        10 ~irC~~CG~RIl   21 (35)
                      -|+||.||+.=.
T Consensus        19 ~VkCpdC~N~q~   30 (67)
T COG2051          19 RVKCPDCGNEQV   30 (67)
T ss_pred             EEECCCCCCEEE
Confidence            489999998643


No 63 
>PF03367 zf-ZPR1:  ZPR1 zinc-finger domain;  InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZPR1-type zinc finger domains. An orthologous protein found once in each of the completed archaeal genomes corresponds to a zinc finger-containing domain repeated as the N-terminal and C-terminal halves of the mouse protein ZPR1. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus. By analogy, other proteins with the ZPR1 zinc finger domain may be regulatory proteins that sense protein phosphorylation state and/or participate in signal transduction (see also IPR004470 from INTERPRO). Deficiencies in ZPR1 may contribute to neurodegenerative disorders. ZPR1 appears to be down-regulated in patients with spinal muscular atrophy (SMA), a disease characterised by degeneration of the alpha-motor neurons in the spinal cord that can arise from mutations affecting the expression of Survival Motor Neurons (SMN) []. ZPR1 interacts with complexes formed by SMN [], and may act as a modifier that effects the severity of SMA. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2QKD_A.
Probab=78.86  E-value=1  Score=26.40  Aligned_cols=10  Identities=40%  Similarity=1.418  Sum_probs=5.7

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ...|++||||
T Consensus        30 sf~C~~CGyk   39 (161)
T PF03367_consen   30 SFECEHCGYK   39 (161)
T ss_dssp             EEE-TTT--E
T ss_pred             EeECCCCCCE
Confidence            4689999998


No 64 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=78.28  E-value=1.8  Score=20.06  Aligned_cols=10  Identities=30%  Similarity=1.055  Sum_probs=7.7

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      .+||+||..-
T Consensus         1 m~Cp~Cg~~~   10 (43)
T PF08271_consen    1 MKCPNCGSKE   10 (43)
T ss_dssp             ESBTTTSSSE
T ss_pred             CCCcCCcCCc
Confidence            3699999874


No 65 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=77.98  E-value=1.6  Score=22.17  Aligned_cols=12  Identities=42%  Similarity=1.055  Sum_probs=10.5

Q ss_pred             CCCceecCCCCC
Q 035423            7 PGDVIQCRECGY   18 (35)
Q Consensus         7 ~~~~irC~~CG~   18 (35)
                      ..|.|.||.||-
T Consensus        18 ~dDiVvCp~Cga   29 (54)
T PF14446_consen   18 GDDIVVCPECGA   29 (54)
T ss_pred             CCCEEECCCCCC
Confidence            678999999994


No 66 
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=77.97  E-value=1.4  Score=29.10  Aligned_cols=23  Identities=26%  Similarity=0.546  Sum_probs=17.2

Q ss_pred             ccCCCCceecCCCCCeEEEeecCC
Q 035423            4 TLKPGDVIQCRECGYRILYKKRTR   27 (35)
Q Consensus         4 ~lk~~~~irC~~CG~RIlyK~R~~   27 (35)
                      .+.++...+||.||+. ||..++.
T Consensus        24 ~l~~g~~a~CpRCg~~-L~~~~~~   46 (419)
T PRK15103         24 RLEHGQKAACPRCGTT-LTVRWDE   46 (419)
T ss_pred             CCCCCCeeECCCCCCC-CcCCCCC
Confidence            4567888999999999 4655543


No 67 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=77.84  E-value=1.2  Score=26.21  Aligned_cols=12  Identities=8%  Similarity=-0.053  Sum_probs=10.4

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      ++|.||+||.-.
T Consensus        25 ~p~vcP~cg~~~   36 (129)
T TIGR02300        25 RPAVSPYTGEQF   36 (129)
T ss_pred             CCccCCCcCCcc
Confidence            789999999863


No 68 
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=77.81  E-value=1.2  Score=26.96  Aligned_cols=10  Identities=50%  Similarity=1.311  Sum_probs=8.7

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ...|++||||
T Consensus        30 sf~C~~CGyr   39 (192)
T TIGR00310        30 STICEHCGYR   39 (192)
T ss_pred             EEECCCCCCc
Confidence            5689999998


No 69 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=77.59  E-value=1.1  Score=23.65  Aligned_cols=15  Identities=27%  Similarity=0.536  Sum_probs=10.3

Q ss_pred             eecCCCCCeEEEeecCC
Q 035423           11 IQCRECGYRILYKKRTR   27 (35)
Q Consensus        11 irC~~CG~RIlyK~R~~   27 (35)
                      ++||.||+.-  +.|+.
T Consensus         2 m~CP~Cg~~a--~irtS   16 (72)
T PRK09678          2 FHCPLCQHAA--HARTS   16 (72)
T ss_pred             ccCCCCCCcc--EEEEC
Confidence            5789999886  44443


No 70 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=77.58  E-value=1.3  Score=25.63  Aligned_cols=14  Identities=21%  Similarity=0.631  Sum_probs=10.5

Q ss_pred             CceecCCCCCeEEE
Q 035423            9 DVIQCRECGYRILY   22 (35)
Q Consensus         9 ~~irC~~CG~RIly   22 (35)
                      -.|.||+||+....
T Consensus        68 v~V~CP~C~K~TKm   81 (114)
T PF11023_consen   68 VQVECPNCGKQTKM   81 (114)
T ss_pred             eeeECCCCCChHhh
Confidence            46899999986533


No 71 
>PF04267 SoxD:  Sarcosine oxidase, delta subunit family ;  InterPro: IPR006279 These sequences represent the delta subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Rhizobium loti (Mesorhizobium loti) and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members share the same function. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate [].  Bacterial sarcosine oxidases have been isolated from over a dozen different organisms and fall into two major classes (1) monomeric form that contains only covalent flavin and (2) heterotetrameric (alpha, beta, gamma, delta) form that contain a covalent and noncovalent flavin, this entry represents the heterotetrameric form.; GO: 0008115 sarcosine oxidase activity, 0046653 tetrahydrofolate metabolic process; PDB: 3AD7_D 1X31_D 1VRQ_D 3AD8_D 3ADA_D 3AD9_D 2GAG_D 2GAH_D.
Probab=77.27  E-value=0.89  Score=24.78  Aligned_cols=9  Identities=56%  Similarity=1.276  Sum_probs=7.8

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      |.||.||-|
T Consensus         2 I~CP~CG~R   10 (84)
T PF04267_consen    2 IPCPHCGPR   10 (84)
T ss_dssp             EEETTTEEE
T ss_pred             ccCCCCCcc
Confidence            789999976


No 72 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=77.23  E-value=2.3  Score=19.60  Aligned_cols=17  Identities=29%  Similarity=0.626  Sum_probs=12.9

Q ss_pred             CCCceecCCCCCeEEEee
Q 035423            7 PGDVIQCRECGYRILYKK   24 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK~   24 (35)
                      .++.+.|+.||.+ +|..
T Consensus         5 ~~~~~~C~~C~~~-~~~~   21 (36)
T PF11781_consen    5 RGPNEPCPVCGSR-WFYS   21 (36)
T ss_pred             ccCCCcCCCCCCe-EeEc
Confidence            4566789999999 6654


No 73 
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=77.11  E-value=4  Score=20.11  Aligned_cols=24  Identities=21%  Similarity=0.502  Sum_probs=13.8

Q ss_pred             CceecCCCCCeEEEe-ecCCceEEE
Q 035423            9 DVIQCRECGYRILYK-KRTRRIVQY   32 (35)
Q Consensus         9 ~~irC~~CG~RIlyK-~R~~~~~~~   32 (35)
                      .-..|+.||..|++- ...+....+
T Consensus        47 ~r~FC~~CGs~l~~~~~~~~~~~~V   71 (92)
T PF04828_consen   47 ERYFCPTCGSPLFSEDERDPDLVGV   71 (92)
T ss_dssp             EEEEETTT--EEEEEESSTTTEEEE
T ss_pred             cCcccCCCCCeeecccCCCCCEEEE
Confidence            457899999999863 333344443


No 74 
>KOG4080 consensus Mitochondrial ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=76.93  E-value=1.1  Score=27.47  Aligned_cols=14  Identities=50%  Similarity=1.044  Sum_probs=10.7

Q ss_pred             cCCCC-ceecCCCCC
Q 035423            5 LKPGD-VIQCRECGY   18 (35)
Q Consensus         5 lk~~~-~irC~~CG~   18 (35)
                      |+..+ ..+||.|||
T Consensus        87 Lk~k~nl~~CP~CGh  101 (176)
T KOG4080|consen   87 LKPKDNLNTCPACGH  101 (176)
T ss_pred             ccchhccccCcccCc
Confidence            45555 678999998


No 75 
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=76.49  E-value=1.6  Score=28.67  Aligned_cols=22  Identities=23%  Similarity=0.512  Sum_probs=16.3

Q ss_pred             ccCCCCceecCCCCCeEEEeecC
Q 035423            4 TLKPGDVIQCRECGYRILYKKRT   26 (35)
Q Consensus         4 ~lk~~~~irC~~CG~RIlyK~R~   26 (35)
                      .+++++..+||.||+. ||..++
T Consensus        27 ~l~~g~~a~CpRCg~~-L~~~~~   48 (403)
T TIGR00155        27 RIESGQKAACPRCGTT-LTVGWD   48 (403)
T ss_pred             CCCCCCeeECCCCCCC-CcCCCC
Confidence            4567888999999998 565443


No 76 
>PF10609 ParA:  ParA/MinD ATPase like;  InterPro: IPR019591  This entry represents ATPases involved in plasmid partitioning []. It also contains cytosolic Fe-S cluster assembling factors, NBP35 and CFD1 which are required for biogenesis and export of both ribosomal subunits probably through assembling the ISCs in RLI1, a protein which performs rRNA processing and ribosome export [, , ].; PDB: 2PH1_A 3KB1_B.
Probab=76.42  E-value=1.6  Score=23.52  Aligned_cols=15  Identities=33%  Similarity=0.685  Sum_probs=8.4

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      +......||.||+++
T Consensus        61 ENMs~~~Cp~Cg~~~   75 (81)
T PF10609_consen   61 ENMSYFVCPHCGERI   75 (81)
T ss_dssp             ECT-EEE-TTT--EE
T ss_pred             ECCCccCCCCCCCee
Confidence            445678999999985


No 77 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=75.57  E-value=0.91  Score=23.51  Aligned_cols=11  Identities=36%  Similarity=0.878  Sum_probs=8.5

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      ||||..||.-|
T Consensus         4 PVRCFTCGkvi   14 (60)
T PF01194_consen    4 PVRCFTCGKVI   14 (60)
T ss_dssp             SSS-STTTSBT
T ss_pred             ceecCCCCCCh
Confidence            79999999765


No 78 
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=75.51  E-value=1.6  Score=28.30  Aligned_cols=15  Identities=27%  Similarity=0.600  Sum_probs=12.6

Q ss_pred             cCCCCceecCCCCCe
Q 035423            5 LKPGDVIQCRECGYR   19 (35)
Q Consensus         5 lk~~~~irC~~CG~R   19 (35)
                      +..+.+-||++||+=
T Consensus       176 LrEGkpqRCpECGqV  190 (268)
T PTZ00043        176 CREGFLYRCGECDQI  190 (268)
T ss_pred             ecCCCCccCCCCCcE
Confidence            567889999999984


No 79 
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=74.68  E-value=0.93  Score=24.19  Aligned_cols=26  Identities=27%  Similarity=0.585  Sum_probs=20.6

Q ss_pred             ccccCCCCceecCCCCCeEEEeecCC
Q 035423            2 ENTLKPGDVIQCRECGYRILYKKRTR   27 (35)
Q Consensus         2 ~~~lk~~~~irC~~CG~RIlyK~R~~   27 (35)
                      |++.+..-.|-|..|||-=+|+.-+-
T Consensus        32 dvq~n~f~~itCk~CgYtEfY~a~~s   57 (68)
T COG3478          32 DVQNNKFIVITCKNCGYTEFYSAKIS   57 (68)
T ss_pred             EecccEEEEEEeccCCchhheecccc
Confidence            45667777899999999999987543


No 80 
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=73.99  E-value=1.4  Score=26.60  Aligned_cols=7  Identities=43%  Similarity=1.146  Sum_probs=4.4

Q ss_pred             ecCCCCC
Q 035423           12 QCRECGY   18 (35)
Q Consensus        12 rC~~CG~   18 (35)
                      +||+|||
T Consensus         2 ~CPfC~~    8 (156)
T COG1327           2 KCPFCGH    8 (156)
T ss_pred             CCCCCCC
Confidence            5666665


No 81 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=73.69  E-value=2  Score=20.15  Aligned_cols=10  Identities=30%  Similarity=0.933  Sum_probs=8.2

Q ss_pred             CceecCCCCC
Q 035423            9 DVIQCRECGY   18 (35)
Q Consensus         9 ~~irC~~CG~   18 (35)
                      ..+.|+.||-
T Consensus        12 ~~~~C~~CgM   21 (41)
T PF13878_consen   12 GATTCPTCGM   21 (41)
T ss_pred             CCcCCCCCCC
Confidence            3689999993


No 82 
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins. In higher eukaryotes, BIR domains inhibit apoptosis by acting as direct inhibitors of the caspase family of protease enzymes. In yeast, BIR domains are involved in regulating cytokinesis. This novel fold is stabilized by zinc tetrahedrally coordinated by one histidine and three cysteine residues and resembles a classical zinc finger.
Probab=73.27  E-value=2.3  Score=20.83  Aligned_cols=13  Identities=38%  Similarity=1.017  Sum_probs=11.1

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      .+.++|.+||..+
T Consensus        32 ~d~v~C~~C~~~~   44 (69)
T cd00022          32 GDEVKCFFCGLEL   44 (69)
T ss_pred             CCEEEeCCCCCCc
Confidence            5789999999875


No 83 
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins.
Probab=73.25  E-value=2.9  Score=20.80  Aligned_cols=16  Identities=13%  Similarity=0.426  Sum_probs=12.7

Q ss_pred             ceecCCCCCeEEEeec
Q 035423           10 VIQCRECGYRILYKKR   25 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R   25 (35)
                      .+.||.|+.++.=..+
T Consensus         3 ~i~Cp~C~~~~~T~v~   18 (67)
T smart00714        3 QLFCPRCQNNVTTRVE   18 (67)
T ss_pred             ceECCCCCCEEEEEEE
Confidence            5899999999875544


No 84 
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=72.80  E-value=2.3  Score=22.14  Aligned_cols=15  Identities=20%  Similarity=0.643  Sum_probs=12.6

Q ss_pred             CceecCCCCCeEEEe
Q 035423            9 DVIQCRECGYRILYK   23 (35)
Q Consensus         9 ~~irC~~CG~RIlyK   23 (35)
                      ..++||.||..+.|.
T Consensus         5 ~~v~CP~C~k~~~w~   19 (62)
T PRK00418          5 ITVNCPTCGKPVEWG   19 (62)
T ss_pred             ccccCCCCCCccccc
Confidence            468999999998764


No 85 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=72.60  E-value=2.5  Score=19.40  Aligned_cols=12  Identities=25%  Similarity=0.675  Sum_probs=5.5

Q ss_pred             cCCCCCeEEEee
Q 035423           13 CRECGYRILYKK   24 (35)
Q Consensus        13 C~~CG~RIlyK~   24 (35)
                      ||.||..+-++.
T Consensus         3 C~~CG~~l~~~i   14 (34)
T PF14803_consen    3 CPQCGGPLERRI   14 (34)
T ss_dssp             -TTT--B-EEE-
T ss_pred             cccccChhhhhc
Confidence            999999965553


No 86 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=72.54  E-value=1.6  Score=20.20  Aligned_cols=10  Identities=30%  Similarity=0.926  Sum_probs=3.7

Q ss_pred             CceecCCCCC
Q 035423            9 DVIQCRECGY   18 (35)
Q Consensus         9 ~~irC~~CG~   18 (35)
                      +++||..|+.
T Consensus         1 ~p~rC~~C~a   10 (40)
T PF04810_consen    1 GPVRCRRCRA   10 (40)
T ss_dssp             -S-B-TTT--
T ss_pred             CccccCCCCC
Confidence            3577777764


No 87 
>PHA00626 hypothetical protein
Probab=71.91  E-value=2.8  Score=21.82  Aligned_cols=12  Identities=33%  Similarity=0.783  Sum_probs=8.9

Q ss_pred             ecCCCCCeEEEe
Q 035423           12 QCRECGYRILYK   23 (35)
Q Consensus        12 rC~~CG~RIlyK   23 (35)
                      .||.||+.=++|
T Consensus         2 ~CP~CGS~~Ivr   13 (59)
T PHA00626          2 SCPKCGSGNIAK   13 (59)
T ss_pred             CCCCCCCceeee
Confidence            599999974554


No 88 
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=71.43  E-value=2.3  Score=22.51  Aligned_cols=18  Identities=22%  Similarity=0.368  Sum_probs=7.6

Q ss_pred             CCCceecCCCCCeEEEee
Q 035423            7 PGDVIQCRECGYRILYKK   24 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK~   24 (35)
                      ..+..-||.||+.-|.|.
T Consensus        21 ~~~k~FCp~CGn~TL~rv   38 (73)
T PF08772_consen   21 DMTKQFCPKCGNATLKRV   38 (73)
T ss_dssp             -SS--S-SSS--S--EEE
T ss_pred             CCCceeCcccCCCcceEE
Confidence            456678999999877664


No 89 
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=70.80  E-value=1.9  Score=24.99  Aligned_cols=10  Identities=40%  Similarity=1.046  Sum_probs=8.8

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .+.||+||..
T Consensus       105 ~~~cp~c~s~  114 (146)
T TIGR02159       105 SVQCPRCGSA  114 (146)
T ss_pred             CCcCCCCCCC
Confidence            5999999975


No 90 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=70.63  E-value=2.4  Score=19.17  Aligned_cols=11  Identities=36%  Similarity=0.724  Sum_probs=8.2

Q ss_pred             eecCCCCCeEE
Q 035423           11 IQCRECGYRIL   21 (35)
Q Consensus        11 irC~~CG~RIl   21 (35)
                      -+|+.|||-.-
T Consensus         3 ~~C~~CG~i~~   13 (34)
T cd00729           3 WVCPVCGYIHE   13 (34)
T ss_pred             EECCCCCCEeE
Confidence            57999998644


No 91 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=70.60  E-value=3  Score=26.26  Aligned_cols=18  Identities=33%  Similarity=0.975  Sum_probs=12.2

Q ss_pred             cCCCCceecCCCCC-eEEE
Q 035423            5 LKPGDVIQCRECGY-RILY   22 (35)
Q Consensus         5 lk~~~~irC~~CG~-RIly   22 (35)
                      +......+||+||. .|++
T Consensus         6 ~~~~~~~~Cp~Cg~~~iv~   24 (310)
T PRK00423          6 LEEEEKLVCPECGSDKLIY   24 (310)
T ss_pred             hhcccCCcCcCCCCCCeeE
Confidence            34556678999997 4444


No 92 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=70.37  E-value=3  Score=15.83  Aligned_cols=9  Identities=44%  Similarity=1.014  Sum_probs=5.4

Q ss_pred             ecCCCCCeE
Q 035423           12 QCRECGYRI   20 (35)
Q Consensus        12 rC~~CG~RI   20 (35)
                      .|+.||...
T Consensus         2 ~C~~C~~~~   10 (24)
T PF13894_consen    2 QCPICGKSF   10 (24)
T ss_dssp             E-SSTS-EE
T ss_pred             CCcCCCCcC
Confidence            699999863


No 93 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=69.33  E-value=2.9  Score=20.97  Aligned_cols=9  Identities=44%  Similarity=1.306  Sum_probs=5.4

Q ss_pred             ecCCCCCeE
Q 035423           12 QCRECGYRI   20 (35)
Q Consensus        12 rC~~CG~RI   20 (35)
                      .||.||.-|
T Consensus         4 ~CP~CG~~i   12 (54)
T TIGR01206         4 ECPDCGAEI   12 (54)
T ss_pred             CCCCCCCEE
Confidence            566666654


No 94 
>PRK12496 hypothetical protein; Provisional
Probab=69.20  E-value=1.6  Score=25.56  Aligned_cols=10  Identities=30%  Similarity=0.743  Sum_probs=8.3

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      -.||.||+.+
T Consensus       144 ~~C~~CG~~~  153 (164)
T PRK12496        144 DVCEICGSPV  153 (164)
T ss_pred             CcCCCCCChh
Confidence            4699999985


No 95 
>PF07967 zf-C3HC:  C3HC zinc finger-like ;  InterPro: IPR012935 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc-finger like domain is distributed throughout the eukaryotic kingdom in NIPA (Nuclear interacting partner of ALK) and other proteins. NIPA is thought to perform an antiapoptotic role in nucleophosmin-anaplastic lymphoma kinase (ALK) mediated signalling events []. The domain is often repeated, with the second domain usually containing a large insert (approximately 90 residues) after the first three cysteine residues. The Schizosaccharomyces pombe protein containing this domain (O94506 from SWISSPROT) is involved in mRNA export from the nucleus [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=69.10  E-value=5.2  Score=22.23  Aligned_cols=16  Identities=38%  Similarity=0.949  Sum_probs=14.8

Q ss_pred             CCceecCCCCCeEEEe
Q 035423            8 GDVIQCRECGYRILYK   23 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK   23 (35)
                      .+.++|..||..+.++
T Consensus        41 ~d~l~C~~C~~~l~~~   56 (133)
T PF07967_consen   41 KDMLKCESCGARLCVK   56 (133)
T ss_pred             CCEEEeCCCCCEEEEe
Confidence            6789999999999998


No 96 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=69.08  E-value=2.5  Score=17.91  Aligned_cols=10  Identities=30%  Similarity=1.052  Sum_probs=8.1

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      -+.|+.||-.
T Consensus         2 l~~C~~CgR~   11 (25)
T PF13913_consen    2 LVPCPICGRK   11 (25)
T ss_pred             CCcCCCCCCE
Confidence            4689999965


No 97 
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=69.04  E-value=2.1  Score=28.95  Aligned_cols=17  Identities=24%  Similarity=0.763  Sum_probs=14.2

Q ss_pred             ccCCCCceecCCCCCeE
Q 035423            4 TLKPGDVIQCRECGYRI   20 (35)
Q Consensus         4 ~lk~~~~irC~~CG~RI   20 (35)
                      .|+.....||.+||++.
T Consensus       348 ~l~~~~~YRC~~CGF~a  364 (389)
T COG2956         348 QLRRKPRYRCQNCGFTA  364 (389)
T ss_pred             HHhhcCCceecccCCcc
Confidence            46778899999999974


No 98 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=68.88  E-value=2.6  Score=21.01  Aligned_cols=9  Identities=33%  Similarity=0.855  Sum_probs=6.3

Q ss_pred             ceecCCCCC
Q 035423           10 VIQCRECGY   18 (35)
Q Consensus        10 ~irC~~CG~   18 (35)
                      .-+|++||+
T Consensus        44 ~y~C~~Cg~   52 (54)
T PF10058_consen   44 QYRCPYCGA   52 (54)
T ss_pred             EEEcCCCCC
Confidence            467777775


No 99 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=68.06  E-value=3  Score=23.17  Aligned_cols=10  Identities=20%  Similarity=0.564  Sum_probs=7.2

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ..+||.||..
T Consensus        88 ~~~CP~Cgs~   97 (117)
T PRK00564         88 YGVCEKCHSK   97 (117)
T ss_pred             CCcCcCCCCC
Confidence            3468888875


No 100
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=68.03  E-value=4.1  Score=19.61  Aligned_cols=15  Identities=20%  Similarity=0.494  Sum_probs=10.8

Q ss_pred             ecCCCCCeEEEeecC
Q 035423           12 QCRECGYRILYKKRT   26 (35)
Q Consensus        12 rC~~CG~RIlyK~R~   26 (35)
                      -||.||...+.....
T Consensus         5 PCPFCG~~~~~~~~~   19 (61)
T PF14354_consen    5 PCPFCGSADVLIRQD   19 (61)
T ss_pred             CCCCCCCcceEeecc
Confidence            399999877665543


No 101
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=67.74  E-value=4  Score=21.58  Aligned_cols=13  Identities=23%  Similarity=0.751  Sum_probs=10.6

Q ss_pred             CceecCCCCCeEE
Q 035423            9 DVIQCRECGYRIL   21 (35)
Q Consensus         9 ~~irC~~CG~RIl   21 (35)
                      ..++||.||++=.
T Consensus        61 ~~~~Cp~Cg~~~a   73 (104)
T TIGR01384        61 TRVECPKCGHKEA   73 (104)
T ss_pred             ccCCCCCCCCCee
Confidence            3589999999864


No 102
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=67.51  E-value=3.1  Score=18.47  Aligned_cols=8  Identities=50%  Similarity=1.277  Sum_probs=5.8

Q ss_pred             ecCCCCCe
Q 035423           12 QCRECGYR   19 (35)
Q Consensus        12 rC~~CG~R   19 (35)
                      +|+.|||-
T Consensus         3 ~C~~CGy~   10 (33)
T cd00350           3 VCPVCGYI   10 (33)
T ss_pred             ECCCCCCE
Confidence            67788874


No 103
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=67.11  E-value=2.3  Score=22.91  Aligned_cols=10  Identities=30%  Similarity=0.780  Sum_probs=6.1

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .-+|++|+++
T Consensus        33 rS~C~~C~~~   42 (92)
T PF06750_consen   33 RSHCPHCGHP   42 (92)
T ss_pred             CCcCcCCCCc
Confidence            4566666664


No 104
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=67.11  E-value=3.1  Score=20.03  Aligned_cols=14  Identities=29%  Similarity=0.821  Sum_probs=9.8

Q ss_pred             eecCCCCCeEEEeecC
Q 035423           11 IQCRECGYRILYKKRT   26 (35)
Q Consensus        11 irC~~CG~RIlyK~R~   26 (35)
                      =+|+.|||.  |+.+.
T Consensus        29 W~C~~Cgh~--w~~~v   42 (55)
T PF14311_consen   29 WKCPKCGHE--WKASV   42 (55)
T ss_pred             EECCCCCCe--eEccH
Confidence            389999995  55433


No 105
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=67.04  E-value=3.2  Score=17.39  Aligned_cols=11  Identities=27%  Similarity=0.703  Sum_probs=9.0

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        13 k~~~C~~C~k~   23 (26)
T PF13465_consen   13 KPYKCPYCGKS   23 (26)
T ss_dssp             SSEEESSSSEE
T ss_pred             CCCCCCCCcCe
Confidence            45899999975


No 106
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=66.86  E-value=2.9  Score=23.89  Aligned_cols=12  Identities=25%  Similarity=0.526  Sum_probs=8.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ....+|+.||+-
T Consensus        27 l~g~kC~~CG~v   38 (140)
T COG1545          27 LLGTKCKKCGRV   38 (140)
T ss_pred             EEEEEcCCCCeE
Confidence            346788888864


No 107
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=66.81  E-value=3.3  Score=21.89  Aligned_cols=16  Identities=19%  Similarity=0.634  Sum_probs=13.1

Q ss_pred             CCCceecCCCCCeEEE
Q 035423            7 PGDVIQCRECGYRILY   22 (35)
Q Consensus         7 ~~~~irC~~CG~RIly   22 (35)
                      ....+.||.||.-+..
T Consensus         4 ~~~~v~CP~Cgkpv~w   19 (65)
T COG3024           4 LRITVPCPTCGKPVVW   19 (65)
T ss_pred             ccccccCCCCCCcccc
Confidence            3457899999999887


No 108
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=66.38  E-value=3.5  Score=23.63  Aligned_cols=14  Identities=29%  Similarity=0.762  Sum_probs=10.9

Q ss_pred             CCCCceecCCCCCe
Q 035423            6 KPGDVIQCRECGYR   19 (35)
Q Consensus         6 k~~~~irC~~CG~R   19 (35)
                      ..++..-||+|||-
T Consensus        15 ~dg~~~iCpeC~~E   28 (109)
T TIGR00686        15 HDGTQLICPSCLYE   28 (109)
T ss_pred             ecCCeeECcccccc
Confidence            45667889999985


No 109
>PF04502 DUF572:  Family of unknown function (DUF572) ;  InterPro: IPR007590 This entry represents eukaryotic proteins with undetermined function belonging to the CWC16 family.
Probab=66.33  E-value=4.7  Score=25.72  Aligned_cols=17  Identities=29%  Similarity=0.774  Sum_probs=13.0

Q ss_pred             eecCCCCCeEEEeecCC
Q 035423           11 IQCRECGYRILYKKRTR   27 (35)
Q Consensus        11 irC~~CG~RIlyK~R~~   27 (35)
                      ++|+.|+.-|-+|-=|+
T Consensus        78 ~kC~~C~~~i~~kTDPk   94 (324)
T PF04502_consen   78 IKCPRCSNEIEFKTDPK   94 (324)
T ss_pred             EEcCCCCCEEeeecCCC
Confidence            68999999888875443


No 110
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=66.33  E-value=5.3  Score=18.48  Aligned_cols=10  Identities=50%  Similarity=1.371  Sum_probs=8.5

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      -..|+.|||-
T Consensus        20 ~~vC~~Cg~~   29 (52)
T smart00661       20 RFVCRKCGYE   29 (52)
T ss_pred             EEECCcCCCe
Confidence            6789999985


No 111
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=66.12  E-value=5.5  Score=18.26  Aligned_cols=13  Identities=23%  Similarity=0.856  Sum_probs=8.7

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      .+.+.|++||--|
T Consensus         2 ~~~~~C~nC~R~v   14 (33)
T PF08209_consen    2 SPYVECPNCGRPV   14 (33)
T ss_dssp             S-EEE-TTTSSEE
T ss_pred             CCeEECCCCcCCc
Confidence            3568999999765


No 112
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=66.12  E-value=3.6  Score=20.72  Aligned_cols=12  Identities=25%  Similarity=0.755  Sum_probs=9.5

Q ss_pred             ceecCCCCCeEE
Q 035423           10 VIQCRECGYRIL   21 (35)
Q Consensus        10 ~irC~~CG~RIl   21 (35)
                      -..||.||...+
T Consensus        13 Y~~Cp~CGN~~v   24 (49)
T PF12677_consen   13 YCKCPKCGNDKV   24 (49)
T ss_pred             hccCcccCCcEe
Confidence            368999998765


No 113
>KOG2907 consensus RNA polymerase I transcription factor TFIIS, subunit A12.2/RPA12 [Transcription]
Probab=66.10  E-value=2.7  Score=24.37  Aligned_cols=8  Identities=38%  Similarity=1.232  Sum_probs=7.0

Q ss_pred             ecCCCCCe
Q 035423           12 QCRECGYR   19 (35)
Q Consensus        12 rC~~CG~R   19 (35)
                      +||.|||-
T Consensus        76 kCpkCghe   83 (116)
T KOG2907|consen   76 KCPKCGHE   83 (116)
T ss_pred             cCcccCCc
Confidence            79999985


No 114
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=66.05  E-value=5.7  Score=20.37  Aligned_cols=18  Identities=22%  Similarity=0.447  Sum_probs=9.4

Q ss_pred             cccCCCCceecCCCCCeE
Q 035423            3 NTLKPGDVIQCRECGYRI   20 (35)
Q Consensus         3 ~~lk~~~~irC~~CG~RI   20 (35)
                      +.++...+-.||.||.-|
T Consensus        17 ~~~~S~~PatCP~C~a~~   34 (54)
T PF09237_consen   17 SKSQSEQPATCPICGAVI   34 (54)
T ss_dssp             CCCTTS--EE-TTT--EE
T ss_pred             HhhccCCCCCCCcchhhc
Confidence            456677889999999653


No 115
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=65.67  E-value=3.4  Score=20.87  Aligned_cols=10  Identities=30%  Similarity=0.690  Sum_probs=8.2

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .|+||.||.-
T Consensus        24 eIKCpRC~ti   33 (51)
T PF10122_consen   24 EIKCPRCKTI   33 (51)
T ss_pred             EEECCCCCcc
Confidence            6899999863


No 116
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=65.47  E-value=6.3  Score=17.19  Aligned_cols=15  Identities=27%  Similarity=0.519  Sum_probs=9.7

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      ..+-..+|+.||+..
T Consensus        17 ~~g~~r~C~~Cg~~~   31 (32)
T PF09297_consen   17 PGGWARRCPSCGHEH   31 (32)
T ss_dssp             SSSS-EEESSSS-EE
T ss_pred             CCcCEeECCCCcCEe
Confidence            345678999999863


No 117
>PF14952 zf-tcix:  Putative treble-clef, zinc-finger, Zn-binding
Probab=64.99  E-value=2.9  Score=20.66  Aligned_cols=9  Identities=33%  Similarity=1.117  Sum_probs=6.6

Q ss_pred             ceecCCCCC
Q 035423           10 VIQCRECGY   18 (35)
Q Consensus        10 ~irC~~CG~   18 (35)
                      .-+||.||.
T Consensus        11 irkCp~CGt   19 (44)
T PF14952_consen   11 IRKCPKCGT   19 (44)
T ss_pred             cccCCcCcC
Confidence            347999984


No 118
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=64.91  E-value=3.9  Score=16.38  Aligned_cols=10  Identities=30%  Similarity=1.022  Sum_probs=6.0

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      .+|+.|.|.-
T Consensus         1 y~C~~C~y~t   10 (24)
T PF13909_consen    1 YKCPHCSYST   10 (24)
T ss_dssp             EE-SSSS-EE
T ss_pred             CCCCCCCCcC
Confidence            3799999863


No 119
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=64.88  E-value=4.5  Score=20.33  Aligned_cols=16  Identities=31%  Similarity=0.760  Sum_probs=10.0

Q ss_pred             cCCCCceecCCCCCeE
Q 035423            5 LKPGDVIQCRECGYRI   20 (35)
Q Consensus         5 lk~~~~irC~~CG~RI   20 (35)
                      +..-..+.|+.||.-.
T Consensus        22 l~~~~l~~C~~CG~~~   37 (57)
T PRK12286         22 LKAPGLVECPNCGEPK   37 (57)
T ss_pred             ccCCcceECCCCCCcc
Confidence            4445566788777643


No 120
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=64.77  E-value=3.9  Score=21.10  Aligned_cols=12  Identities=25%  Similarity=0.761  Sum_probs=9.2

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      ..|+||.|+.--
T Consensus        10 ~~VkCp~C~n~q   21 (59)
T PRK00415         10 LKVKCPDCGNEQ   21 (59)
T ss_pred             EEEECCCCCCeE
Confidence            358999999754


No 121
>PF13395 HNH_4:  HNH endonuclease
Probab=64.74  E-value=2.9  Score=20.17  Aligned_cols=9  Identities=44%  Similarity=0.922  Sum_probs=7.4

Q ss_pred             cCCCCCeEE
Q 035423           13 CRECGYRIL   21 (35)
Q Consensus        13 C~~CG~RIl   21 (35)
                      |+|||-.|=
T Consensus         1 C~Y~g~~i~    9 (54)
T PF13395_consen    1 CPYCGKPIS    9 (54)
T ss_pred             CCCCCCCCC
Confidence            899998864


No 122
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=64.54  E-value=2.8  Score=23.81  Aligned_cols=10  Identities=40%  Similarity=1.235  Sum_probs=8.0

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ..+||.||..
T Consensus       107 ~~~CP~Cgs~  116 (135)
T PRK03824        107 FLKCPKCGSR  116 (135)
T ss_pred             CcCCcCCCCC
Confidence            4679999975


No 123
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=64.38  E-value=3.4  Score=16.17  Aligned_cols=8  Identities=38%  Similarity=1.049  Sum_probs=6.5

Q ss_pred             ecCCCCCe
Q 035423           12 QCRECGYR   19 (35)
Q Consensus        12 rC~~CG~R   19 (35)
                      .|+.||..
T Consensus         2 ~C~~C~~~    9 (23)
T PF00096_consen    2 KCPICGKS    9 (23)
T ss_dssp             EETTTTEE
T ss_pred             CCCCCCCc
Confidence            69999965


No 124
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]
Probab=63.71  E-value=4  Score=25.18  Aligned_cols=17  Identities=29%  Similarity=0.759  Sum_probs=13.3

Q ss_pred             CCCCceecCCCCCeEEE
Q 035423            6 KPGDVIQCRECGYRILY   22 (35)
Q Consensus         6 k~~~~irC~~CG~RIly   22 (35)
                      +.+...+||.||+.-.=
T Consensus       161 ~~~~~l~Cp~Cg~tEkR  177 (188)
T COG1096         161 KKGNMLKCPNCGNTEKR  177 (188)
T ss_pred             EcCcEEECCCCCCEEee
Confidence            46788999999987443


No 125
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=63.68  E-value=2.7  Score=23.76  Aligned_cols=11  Identities=27%  Similarity=1.138  Sum_probs=8.8

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+-+|+.|||-
T Consensus        57 ~Pa~CkkCGfe   67 (97)
T COG3357          57 RPARCKKCGFE   67 (97)
T ss_pred             cChhhcccCcc
Confidence            36789999985


No 126
>PF09158 MotCF:  Bacteriophage T4 MotA, C-terminal;  InterPro: IPR015241  Transcription factor MotA is required for the activation of middle promoters in Bacteriophage T4, in addition to phage T4 co-activator AsiA, and sigma-70-containing Escherichia coli RNA polymerase. Phage T4 middle promoters have the sigma70 -10 DNA element, but not the -35 element; instead, they have a MotA box at -30 to which the transcription factor MotA binds []. MotA and AsiA interact with the C-terminal of sigma70 (region 4), which normally binds the -35 element and the beta-flap, thereby diverting sigma70 away from host promoters that require -35 element-binding to phage T4 middle promoters.  Transcription factor MotA has two domains: an N-terminal domain required for binding to sigma70, and a C-terminal domain required for binding to the -30 MotA box element in the phage T4 middle promoter. This entry represents the C-terminal domain of MotA factors, which adopts a compact alpha/beta structure comprising three alpha-helices and six beta-strands in the order: alpha1-beta1-beta2-beta3-beta4-alpha2-beta5-beta6-alpha3. In this architecture, the domain's hydrophobic core is at the sheet-helix interface, and the second surface of the beta-sheet is completely exposed. It contains a DNA-binding motif, with a consensus sequence containing nine base pairs (5'-TTTGCTTTA-3'), that appears to bind to various mot boxes, allowing access to the minor groove towards the 5'-end of this sequence and the major groove towards the 3'-end [].; PDB: 1KAF_B.
Probab=63.41  E-value=8.4  Score=21.85  Aligned_cols=17  Identities=53%  Similarity=0.843  Sum_probs=15.0

Q ss_pred             CeEEEeecCCceEEEEe
Q 035423           18 YRILYKKRTRRIVQYEA   34 (35)
Q Consensus        18 ~RIlyK~R~~~~~~~~A   34 (35)
                      +-|++++|+....|||-
T Consensus        32 ~~i~f~KRt~GirqfEi   48 (103)
T PF09158_consen   32 YEIRFKKRTKGIRQFEI   48 (103)
T ss_dssp             EEEEEEEEETTEEEEEE
T ss_pred             eEEeeecccCceeEEEE
Confidence            56899999999999984


No 127
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=63.05  E-value=4.1  Score=18.81  Aligned_cols=14  Identities=36%  Similarity=0.745  Sum_probs=7.9

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      -...+-|++||=|.
T Consensus        18 ~~~~isC~~CGPr~   31 (35)
T PF07503_consen   18 HYQFISCTNCGPRY   31 (35)
T ss_dssp             T-TT--BTTCC-SC
T ss_pred             cCcCccCCCCCCCE
Confidence            35689999999764


No 128
>PF14369 zf-RING_3:  zinc-finger
Probab=62.40  E-value=6.7  Score=17.88  Aligned_cols=14  Identities=14%  Similarity=0.465  Sum_probs=9.9

Q ss_pred             CCceecCCCCCeEE
Q 035423            8 GDVIQCRECGYRIL   21 (35)
Q Consensus         8 ~~~irC~~CG~RIl   21 (35)
                      .+.+-||+|+...|
T Consensus        19 ~~~~~CP~C~~gFv   32 (35)
T PF14369_consen   19 DSDVACPRCHGGFV   32 (35)
T ss_pred             CCCcCCcCCCCcEe
Confidence            44456999997654


No 129
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=62.13  E-value=5.4  Score=19.50  Aligned_cols=8  Identities=38%  Similarity=0.983  Sum_probs=5.4

Q ss_pred             ecCCCCCe
Q 035423           12 QCRECGYR   19 (35)
Q Consensus        12 rC~~CG~R   19 (35)
                      -||.||..
T Consensus        22 fCP~Cg~~   29 (50)
T PRK00432         22 FCPRCGSG   29 (50)
T ss_pred             cCcCCCcc
Confidence            57777765


No 130
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=61.95  E-value=5.5  Score=19.64  Aligned_cols=15  Identities=33%  Similarity=0.899  Sum_probs=9.5

Q ss_pred             cCCCCceecCCCCCe
Q 035423            5 LKPGDVIQCRECGYR   19 (35)
Q Consensus         5 lk~~~~irC~~CG~R   19 (35)
                      |+.-..+.|+.||.-
T Consensus        21 l~~~~l~~c~~cg~~   35 (56)
T PF01783_consen   21 LKAPNLVKCPNCGEP   35 (56)
T ss_dssp             --TTSEEESSSSSSE
T ss_pred             ccccceeeeccCCCE
Confidence            455567788888864


No 131
>PF10825 DUF2752:  Protein of unknown function (DUF2752);  InterPro: IPR021215  This family is conserved in bacteria. Many members are annotated as being putative membrane proteins. 
Probab=61.54  E-value=3.3  Score=20.21  Aligned_cols=13  Identities=38%  Similarity=0.700  Sum_probs=9.9

Q ss_pred             CCCCceecCCCCC
Q 035423            6 KPGDVIQCRECGY   18 (35)
Q Consensus         6 k~~~~irC~~CG~   18 (35)
                      +....+.||-||-
T Consensus         5 ~~ltG~~CPgCG~   17 (52)
T PF10825_consen    5 KALTGIPCPGCGM   17 (52)
T ss_pred             hhhhCCCCCCCcH
Confidence            4556789999994


No 132
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=61.45  E-value=4.2  Score=25.42  Aligned_cols=11  Identities=36%  Similarity=1.072  Sum_probs=9.2

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..++|.+||+=
T Consensus        29 ~lvrC~eCG~V   39 (201)
T COG1326          29 PLVRCEECGTV   39 (201)
T ss_pred             eEEEccCCCcE
Confidence            37999999984


No 133
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=61.17  E-value=9  Score=22.42  Aligned_cols=15  Identities=33%  Similarity=0.813  Sum_probs=10.9

Q ss_pred             CCCceecCCCCCeEE
Q 035423            7 PGDVIQCRECGYRIL   21 (35)
Q Consensus         7 ~~~~irC~~CG~RIl   21 (35)
                      ....|-||.||++.-
T Consensus        41 KdG~v~CPvC~~~~~   55 (131)
T COG1645          41 KDGEVFCPVCGYREV   55 (131)
T ss_pred             eCCeEECCCCCceEE
Confidence            445688999998743


No 134
>KOG3404 consensus G10 protein/predicted nuclear transcription regulator [Transcription]
Probab=60.98  E-value=3.5  Score=24.62  Aligned_cols=16  Identities=31%  Similarity=0.870  Sum_probs=13.3

Q ss_pred             ccCCCCceecCCCCCe
Q 035423            4 TLKPGDVIQCRECGYR   19 (35)
Q Consensus         4 ~lk~~~~irC~~CG~R   19 (35)
                      .|.....+.|.+||+|
T Consensus       125 ~ld~~~~~~C~hCGCr  140 (145)
T KOG3404|consen  125 KLDVERIVECVHCGCR  140 (145)
T ss_pred             hcChhheeeeeccCcC
Confidence            4667778999999987


No 135
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=60.74  E-value=5.6  Score=18.58  Aligned_cols=10  Identities=30%  Similarity=1.049  Sum_probs=8.4

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      +.|+.||+.+
T Consensus        41 ~~C~~C~~~f   50 (64)
T PF01485_consen   41 VTCPSCGTEF   50 (64)
T ss_dssp             CCTTSCCSEE
T ss_pred             eECCCCCCcC
Confidence            8899999864


No 136
>PF04161 Arv1:  Arv1-like family ;  InterPro: IPR007290 Arv1 is a transmembrane protein, with potential zinc-binding motifs, that mediates sterol homeostasis. Its action is important in lipid homeostasis, which prevents free sterol toxicity []. Arv1 contains a homology domain (AHD), which consists of an N-terminal cysteine-rich subdomain with a putative zinc-binding motif, followed by a C-terminal subdomain of 33 amino acids. The C-terminal subdomain of the AHD is critical for the protein's function []. In yeast, Arv1p is important for the delivery of an early glycosylphosphatidylinositol GPI intermediate, GlcN-acylPI, to the first mannosyltransferase of GPI synthesis in the ER lumen []. It is important for the traffic of sterol in yeast and in humans. In eukaryotic cells, it may fuction in the sphingolipid metabolic pathway as a transporter of ceramides between the ER and Golgi []. 
Probab=60.71  E-value=5.3  Score=23.89  Aligned_cols=17  Identities=35%  Similarity=0.837  Sum_probs=10.7

Q ss_pred             ecCCCCCeE--EEeecCCc
Q 035423           12 QCRECGYRI--LYKKRTRR   28 (35)
Q Consensus        12 rC~~CG~RI--lyK~R~~~   28 (35)
                      +|-+||+.+  ||++=++.
T Consensus         2 iCIeCg~~v~~Ly~~Ys~~   20 (208)
T PF04161_consen    2 ICIECGHPVKSLYRQYSPG   20 (208)
T ss_pred             EeccCCCcchhhhhccCCC
Confidence            688888876  55544443


No 137
>PF12773 DZR:  Double zinc ribbon
Probab=60.67  E-value=4.5  Score=18.76  Aligned_cols=11  Identities=27%  Similarity=0.685  Sum_probs=6.1

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..+.|+.||..
T Consensus        28 ~~~~C~~Cg~~   38 (50)
T PF12773_consen   28 SKKICPNCGAE   38 (50)
T ss_pred             CCCCCcCCcCC
Confidence            34556666654


No 138
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=60.52  E-value=9.5  Score=19.15  Aligned_cols=17  Identities=29%  Similarity=0.366  Sum_probs=13.5

Q ss_pred             CceecCCCCCeEEEeec
Q 035423            9 DVIQCRECGYRILYKKR   25 (35)
Q Consensus         9 ~~irC~~CG~RIlyK~R   25 (35)
                      -.-.||+||..|=.++|
T Consensus        57 ~~H~Cp~C~~~lg~~~r   73 (73)
T PF10601_consen   57 VYHYCPNCGAFLGTYKR   73 (73)
T ss_pred             ceEECCCCCCEeEEEeC
Confidence            34689999999877765


No 139
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=60.37  E-value=4.2  Score=22.40  Aligned_cols=17  Identities=29%  Similarity=0.708  Sum_probs=13.4

Q ss_pred             ccCCCCceecCCCCCeE
Q 035423            4 TLKPGDVIQCRECGYRI   20 (35)
Q Consensus         4 ~lk~~~~irC~~CG~RI   20 (35)
                      .|+.-+.+.|++||--.
T Consensus        29 vIknVPa~~C~~CGe~y   45 (89)
T TIGR03829        29 EIKETPSISCSHCGMEY   45 (89)
T ss_pred             EEecCCcccccCCCcEe
Confidence            46777899999999653


No 140
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=60.34  E-value=4.3  Score=19.55  Aligned_cols=10  Identities=30%  Similarity=0.600  Sum_probs=8.5

Q ss_pred             ecCCCCCeEE
Q 035423           12 QCRECGYRIL   21 (35)
Q Consensus        12 rC~~CG~RIl   21 (35)
                      -||.||..-.
T Consensus         3 PCPfCGg~~~   12 (53)
T TIGR03655         3 PCPFCGGADV   12 (53)
T ss_pred             CCCCCCCcce
Confidence            4999999876


No 141
>TIGR00375 conserved hypothetical protein TIGR00375. The member of this family from Methanococcus jannaschii, MJ0043, is considerably longer and appears to contain an intein N-terminal to the region of homology.
Probab=60.23  E-value=3.8  Score=27.14  Aligned_cols=10  Identities=50%  Similarity=1.109  Sum_probs=8.2

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      ..+|| ||.+|
T Consensus       259 ~~~Cp-CG~~i  268 (374)
T TIGR00375       259 CANCP-CGGRI  268 (374)
T ss_pred             CCCCC-CCCcc
Confidence            36899 99994


No 142
>PRK10220 hypothetical protein; Provisional
Probab=60.10  E-value=6.4  Score=22.64  Aligned_cols=14  Identities=21%  Similarity=0.581  Sum_probs=10.7

Q ss_pred             CCCCceecCCCCCe
Q 035423            6 KPGDVIQCRECGYR   19 (35)
Q Consensus         6 k~~~~irC~~CG~R   19 (35)
                      ..++..-||+|||-
T Consensus        16 ~d~~~~vCpeC~hE   29 (111)
T PRK10220         16 EDNGMYICPECAHE   29 (111)
T ss_pred             cCCCeEECCcccCc
Confidence            45667889999985


No 143
>PRK00807 50S ribosomal protein L24e; Validated
Probab=59.83  E-value=5.3  Score=19.66  Aligned_cols=10  Identities=40%  Similarity=0.833  Sum_probs=8.3

Q ss_pred             ecCCCCCeEE
Q 035423           12 QCRECGYRIL   21 (35)
Q Consensus        12 rC~~CG~RIl   21 (35)
                      .|-+||+.|-
T Consensus         3 ~C~fcG~~I~   12 (52)
T PRK00807          3 TCSFCGKEIE   12 (52)
T ss_pred             ccCCCCCeEc
Confidence            5999999974


No 144
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=59.78  E-value=5.3  Score=21.16  Aligned_cols=16  Identities=31%  Similarity=0.694  Sum_probs=9.8

Q ss_pred             ceecCCCCCeEEEeecC
Q 035423           10 VIQCRECGYRILYKKRT   26 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R~   26 (35)
                      .=+| .||++|=.|+|.
T Consensus        20 TkkC-~CG~~l~vk~~r   35 (68)
T PF09082_consen   20 TKKC-VCGKTLKVKERR   35 (68)
T ss_dssp             EEEE-TTTEEEE--SSS
T ss_pred             eeEe-cCCCeeeeeeEE
Confidence            3468 888887777654


No 145
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=59.70  E-value=4.3  Score=27.61  Aligned_cols=17  Identities=24%  Similarity=0.501  Sum_probs=12.8

Q ss_pred             ceecCCCCCeEEEeecC
Q 035423           10 VIQCRECGYRILYKKRT   26 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R~   26 (35)
                      ..||+.||+|+=.....
T Consensus       367 g~rC~kCg~~~~~~~~~  383 (421)
T COG1571         367 GFRCKKCGTRARETLIK  383 (421)
T ss_pred             CcccccccccCCccccc
Confidence            78999999996544443


No 146
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=59.35  E-value=4.1  Score=27.71  Aligned_cols=14  Identities=21%  Similarity=0.707  Sum_probs=10.2

Q ss_pred             ceecCCCCCeEEEe
Q 035423           10 VIQCRECGYRILYK   23 (35)
Q Consensus        10 ~irC~~CG~RIlyK   23 (35)
                      -+.||+||+.-...
T Consensus       200 ~vpCPhCg~~~~l~  213 (557)
T PF05876_consen  200 YVPCPHCGEEQVLE  213 (557)
T ss_pred             EccCCCCCCCcccc
Confidence            47899999876544


No 147
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=59.28  E-value=9.2  Score=17.87  Aligned_cols=16  Identities=19%  Similarity=0.814  Sum_probs=12.0

Q ss_pred             CCCceecCCCCCeEEE
Q 035423            7 PGDVIQCRECGYRILY   22 (35)
Q Consensus         7 ~~~~irC~~CG~RIly   22 (35)
                      ....+.|+.||+..-+
T Consensus        37 ~~~~v~C~~C~~~fC~   52 (64)
T smart00647       37 GCNRVTCPKCGFSFCF   52 (64)
T ss_pred             CCCeeECCCCCCeECC
Confidence            4457999999987644


No 148
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=59.12  E-value=4.5  Score=20.65  Aligned_cols=10  Identities=30%  Similarity=0.640  Sum_probs=8.1

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      .-||.||.|+
T Consensus        40 ngCPfC~~~~   49 (55)
T PF14447_consen   40 NGCPFCGTPF   49 (55)
T ss_pred             cCCCCCCCcc
Confidence            4599999886


No 149
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=58.73  E-value=8.1  Score=18.91  Aligned_cols=11  Identities=36%  Similarity=1.186  Sum_probs=6.2

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ....|+.||+.
T Consensus        45 r~~~C~~Cg~~   55 (69)
T PF07282_consen   45 RVFTCPNCGFE   55 (69)
T ss_pred             ceEEcCCCCCE
Confidence            34556666654


No 150
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=58.54  E-value=9.9  Score=21.05  Aligned_cols=16  Identities=25%  Similarity=0.659  Sum_probs=10.5

Q ss_pred             CCCCceecCCCCCeEE
Q 035423            6 KPGDVIQCRECGYRIL   21 (35)
Q Consensus         6 k~~~~irC~~CG~RIl   21 (35)
                      +....+.||+||...|
T Consensus        17 klpt~f~CP~Cge~~v   32 (99)
T PRK14892         17 KLPKIFECPRCGKVSI   32 (99)
T ss_pred             CCCcEeECCCCCCeEe
Confidence            3445677888886544


No 151
>PF01667 Ribosomal_S27e:  Ribosomal protein S27;  InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families include mammalian, yeast, Chlamydomonas reinhardtii and Entamoeba histolytica S27, and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0250 []. These proteins have from 62 to 87 amino acids. They contain, in their central section, a putative zinc-finger region of the type C-x(2)-C-x(14)-C-x(2)-C.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1QXF_A 3IZ6_X 2XZN_6 2XZM_6 3U5G_b 3IZB_X 3U5C_b.
Probab=58.02  E-value=5.7  Score=20.14  Aligned_cols=10  Identities=20%  Similarity=0.507  Sum_probs=6.1

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .|+||.|+.-
T Consensus         7 ~VkCp~C~~~   16 (55)
T PF01667_consen    7 DVKCPGCYNI   16 (55)
T ss_dssp             EEE-TTT-SE
T ss_pred             EEECCCCCCe
Confidence            5889999874


No 152
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=57.92  E-value=3.9  Score=23.57  Aligned_cols=9  Identities=33%  Similarity=0.984  Sum_probs=7.4

Q ss_pred             ecCCCCCeE
Q 035423           12 QCRECGYRI   20 (35)
Q Consensus        12 rC~~CG~RI   20 (35)
                      =||+||.+-
T Consensus        22 GCp~CG~nk   30 (112)
T COG3364          22 GCPKCGCNK   30 (112)
T ss_pred             cCccccchh
Confidence            499999983


No 153
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=57.72  E-value=10  Score=17.81  Aligned_cols=14  Identities=14%  Similarity=0.498  Sum_probs=6.2

Q ss_pred             CCceecCC-CCCeEE
Q 035423            8 GDVIQCRE-CGYRIL   21 (35)
Q Consensus         8 ~~~irC~~-CG~RIl   21 (35)
                      ...|.||+ ||..+|
T Consensus         7 ~~~v~C~~~cc~~~i   21 (60)
T PF02176_consen    7 FRPVPCPNGCCNEMI   21 (60)
T ss_dssp             TSEEE-TT--S-BEE
T ss_pred             CCEeeCCCCCcccce
Confidence            34677777 554433


No 154
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=57.72  E-value=5  Score=17.87  Aligned_cols=13  Identities=31%  Similarity=0.680  Sum_probs=7.0

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      .-+|+.||.-.++
T Consensus        11 ~~rC~~Cg~~~~p   23 (37)
T PF12172_consen   11 GQRCRDCGRVQFP   23 (37)
T ss_dssp             EEE-TTT--EEES
T ss_pred             EEEcCCCCCEecC
Confidence            4689999987553


No 155
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=57.51  E-value=6.6  Score=21.02  Aligned_cols=13  Identities=38%  Similarity=0.838  Sum_probs=10.6

Q ss_pred             eecCCCCCeEEEe
Q 035423           11 IQCRECGYRILYK   23 (35)
Q Consensus        11 irC~~CG~RIlyK   23 (35)
                      +.||=|||..|-.
T Consensus         2 ~~CPCCg~~Tl~~   14 (78)
T PF14206_consen    2 YPCPCCGYYTLEE   14 (78)
T ss_pred             ccCCCCCcEEecc
Confidence            5799999998743


No 156
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=57.42  E-value=11  Score=20.72  Aligned_cols=20  Identities=25%  Similarity=0.536  Sum_probs=15.0

Q ss_pred             CCCceecCCCCCeEEEeecC
Q 035423            7 PGDVIQCRECGYRILYKKRT   26 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK~R~   26 (35)
                      .....+|+.||..+-.+.+.
T Consensus       120 ~~~~~~C~~C~~~~~r~~~~  139 (157)
T PF10263_consen  120 KKYVYRCPSCGREYKRHRRS  139 (157)
T ss_pred             cceEEEcCCCCCEeeeeccc
Confidence            34578899999998666665


No 157
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=57.29  E-value=8  Score=19.22  Aligned_cols=15  Identities=27%  Similarity=0.665  Sum_probs=10.7

Q ss_pred             cCCCCceecCCCCCe
Q 035423            5 LKPGDVIQCRECGYR   19 (35)
Q Consensus         5 lk~~~~irC~~CG~R   19 (35)
                      |+.-..+.|+.||.-
T Consensus        21 l~~p~l~~C~~cG~~   35 (55)
T TIGR01031        21 LTAPTLVVCPNCGEF   35 (55)
T ss_pred             ccCCcceECCCCCCc
Confidence            555667788888853


No 158
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=57.21  E-value=6.9  Score=17.93  Aligned_cols=12  Identities=25%  Similarity=0.670  Sum_probs=8.8

Q ss_pred             ceecCCCCCeEE
Q 035423           10 VIQCRECGYRIL   21 (35)
Q Consensus        10 ~irC~~CG~RIl   21 (35)
                      +-.|+.||...-
T Consensus         2 ~~~C~~Cg~~l~   13 (47)
T PF13005_consen    2 PRACPDCGGELK   13 (47)
T ss_pred             CCcCCCCCceee
Confidence            346999999743


No 159
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=56.83  E-value=5.5  Score=24.84  Aligned_cols=10  Identities=50%  Similarity=1.228  Sum_probs=8.6

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ...|..||||
T Consensus        43 t~~C~~CgYR   52 (201)
T COG1779          43 TGVCERCGYR   52 (201)
T ss_pred             EEEccccCCc
Confidence            4689999998


No 160
>smart00746 TRASH metallochaperone-like domain.
Probab=56.82  E-value=5.7  Score=15.49  Aligned_cols=9  Identities=44%  Similarity=1.003  Sum_probs=7.1

Q ss_pred             cCCCCCeEE
Q 035423           13 CRECGYRIL   21 (35)
Q Consensus        13 C~~CG~RIl   21 (35)
                      |+.||..|.
T Consensus         1 c~~C~~~~~    9 (39)
T smart00746        1 CSFCGKDIY    9 (39)
T ss_pred             CCCCCCCcc
Confidence            788988864


No 161
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=56.49  E-value=6.2  Score=23.69  Aligned_cols=12  Identities=50%  Similarity=1.154  Sum_probs=7.3

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      +..-+|+.|||-
T Consensus       132 ~~~~vC~vCGy~  143 (166)
T COG1592         132 GKVWVCPVCGYT  143 (166)
T ss_pred             CCEEEcCCCCCc
Confidence            335667777763


No 162
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=56.30  E-value=7.5  Score=17.53  Aligned_cols=17  Identities=29%  Similarity=0.647  Sum_probs=10.1

Q ss_pred             CCCceecCCCCCeEEEe
Q 035423            7 PGDVIQCRECGYRILYK   23 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK   23 (35)
                      ....++|.+|+..+-+.
T Consensus        13 ~~~~a~C~~C~~~~~~~   29 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYS   29 (45)
T ss_dssp             CSS-EEETTTTEE----
T ss_pred             CcCeEEeCCCCeEEeeC
Confidence            35679999999887665


No 163
>COG4640 Predicted membrane protein [Function unknown]
Probab=56.14  E-value=5  Score=27.74  Aligned_cols=15  Identities=40%  Similarity=0.953  Sum_probs=11.6

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      +..|.+.|+.||+.+
T Consensus        11 k~Ed~~qC~qCG~~~   25 (465)
T COG4640          11 KAEDDVQCTQCGHKF   25 (465)
T ss_pred             cccccccccccCCcC
Confidence            445678899999975


No 164
>COG0551 TopA Zn-finger domain associated with topoisomerase type I [DNA replication, recombination, and repair]
Probab=56.02  E-value=11  Score=20.92  Aligned_cols=17  Identities=24%  Similarity=0.432  Sum_probs=13.1

Q ss_pred             CCceecCCCCCeEEEee
Q 035423            8 GDVIQCRECGYRILYKK   24 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK~   24 (35)
                      .....||.||...+++.
T Consensus        15 ~~~~~Cp~Cg~~m~~~~   31 (140)
T COG0551          15 KTGQICPKCGKNMVKKF   31 (140)
T ss_pred             ccCccCCcCCCeeEEEE
Confidence            34679999999966654


No 165
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=55.90  E-value=10  Score=18.73  Aligned_cols=15  Identities=27%  Similarity=0.441  Sum_probs=10.1

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      +.....||-||+..+
T Consensus        31 ~~~~~~rC~YCe~~~   45 (52)
T PF02748_consen   31 KEPIKLRCHYCERII   45 (52)
T ss_dssp             TTTCEEEETTT--EE
T ss_pred             CCCCEEEeeCCCCEe
Confidence            456778999999765


No 166
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=55.75  E-value=4.5  Score=27.48  Aligned_cols=11  Identities=36%  Similarity=0.918  Sum_probs=8.9

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      .-+||.||.+|
T Consensus       265 ~wrCpkCGg~i  275 (403)
T COG1379         265 RWRCPKCGGKI  275 (403)
T ss_pred             cccCcccccch
Confidence            37899999954


No 167
>PF01246 Ribosomal_L24e:  Ribosomal protein L24e;  InterPro: IPR000988 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeabacterial ribosomal proteins can be grouped on the basis of sequence similarities. One of these families [] consists of mammalian ribosomal protein L24; yeast ribosomal protein L30A/B (Rp29) (YL21); Kluyveromyces lactis ribosomal protein L30; Arabidopsis thaliana ribosomal protein L24 homolog; Haloarcula marismortui ribosomal protein HL21/HL22; and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ1201. These proteins have 60 to 160 amino-acid residues. This entry represents proteins related to the L24e ribosomal proteins.; PDB: 2ZKR_u 1VQ9_U 1VQL_U 1KD1_V 1VQP_U 3CCM_U 3CD6_U 3CCL_U 3CCR_U 1Q86_V ....
Probab=55.66  E-value=6.5  Score=20.68  Aligned_cols=11  Identities=36%  Similarity=0.830  Sum_probs=7.0

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      .-.|.+||+.|
T Consensus         3 ~~~C~Fsg~~I   13 (71)
T PF01246_consen    3 TEKCSFSGYKI   13 (71)
T ss_dssp             SEE-TTT-SEE
T ss_pred             eEEecccCCcc
Confidence            35799999986


No 168
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=55.41  E-value=6.7  Score=21.06  Aligned_cols=10  Identities=50%  Similarity=1.235  Sum_probs=8.3

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      ..|++||.+|
T Consensus         5 Y~CRHCg~~I   14 (76)
T PF10955_consen    5 YYCRHCGTKI   14 (76)
T ss_pred             EEecCCCCEE
Confidence            4699999886


No 169
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=54.80  E-value=6.3  Score=18.88  Aligned_cols=14  Identities=36%  Similarity=0.601  Sum_probs=6.9

Q ss_pred             cCCCCceecCCCCCe
Q 035423            5 LKPGDVIQCRECGYR   19 (35)
Q Consensus         5 lk~~~~irC~~CG~R   19 (35)
                      |+..++ .||-||.-
T Consensus        16 l~~~~~-~CPlC~r~   29 (54)
T PF04423_consen   16 LKEAKG-CCPLCGRP   29 (54)
T ss_dssp             HTT-SE-E-TTT--E
T ss_pred             HhcCCC-cCCCCCCC
Confidence            444555 99999965


No 170
>PF00471 Ribosomal_L33:  Ribosomal protein L33;  InterPro: IPR001705 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L33 is one of the proteins from the large ribosomal subunit. In Escherichia coli, L33 has been shown to be on the surface of 50S subunit. L33 belongs to a family of ribosomal proteins which, on the basis of sequence similarities [, , ], groups:  Eubacterial L33. Algal and plant chloroplast L33. Cyanelle L33.   L33 is a small protein of 49 to 66 amino-acid residues.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3PIO_1 3PIP_1 3PYT_3 3MS1_3 3F1F_6 3F1H_6 3MRZ_3 3PYO_3 3D5B_6 3D5D_6 ....
Probab=54.64  E-value=12  Score=18.26  Aligned_cols=13  Identities=31%  Similarity=0.613  Sum_probs=11.1

Q ss_pred             ecCCCCCeEEEee
Q 035423           12 QCRECGYRILYKK   24 (35)
Q Consensus        12 rC~~CG~RIlyK~   24 (35)
                      -||.|+-..|+++
T Consensus        34 ycp~~~khtlhkE   46 (48)
T PF00471_consen   34 YCPRCRKHTLHKE   46 (48)
T ss_dssp             EETSSSSEEEEEC
T ss_pred             cCCCCCCEecEEE
Confidence            4899999999886


No 171
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=54.51  E-value=14  Score=19.58  Aligned_cols=19  Identities=21%  Similarity=0.370  Sum_probs=11.9

Q ss_pred             cCCCCCeEEEeecCCceEE
Q 035423           13 CRECGYRILYKKRTRRIVQ   31 (35)
Q Consensus        13 C~~CG~RIlyK~R~~~~~~   31 (35)
                      |+.||.--+++........
T Consensus         1 C~~C~~~~~~~~~~~~~~~   19 (127)
T TIGR03830         1 CPICGSGELVRDVKDEPYT   19 (127)
T ss_pred             CCCCCCccceeeeecceEE
Confidence            8899976566555544433


No 172
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=54.51  E-value=5.5  Score=20.35  Aligned_cols=9  Identities=44%  Similarity=1.073  Sum_probs=7.5

Q ss_pred             ecCCCCCeE
Q 035423           12 QCRECGYRI   20 (35)
Q Consensus        12 rC~~CG~RI   20 (35)
                      .|+.||.-|
T Consensus         5 HC~~CG~~I   13 (59)
T PF09889_consen    5 HCPVCGKPI   13 (59)
T ss_pred             cCCcCCCcC
Confidence            599999776


No 173
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=54.32  E-value=7.8  Score=19.78  Aligned_cols=16  Identities=31%  Similarity=0.571  Sum_probs=10.1

Q ss_pred             cCCCCceecCCCCCeE
Q 035423            5 LKPGDVIQCRECGYRI   20 (35)
Q Consensus         5 lk~~~~irC~~CG~RI   20 (35)
                      |+.-..+.|++||.-.
T Consensus        22 l~~~~~~~c~~cG~~~   37 (57)
T COG0333          22 LKAPTLSVCPNCGEYK   37 (57)
T ss_pred             hhCccceeccCCCCcc
Confidence            3344467888888654


No 174
>cd00472 Ribosomal_L24e_L24 Ribosomal protein L24e/L24 is a ribosomal protein found in eukaryotes (L24) and in archaea (L24e, distinct from archaeal L24). L24e/L24 is located on the surface of the large subunit, adjacent to proteins L14 and L3, and near the translation factor binding site.  L24e/L24 appears to play a role in the kinetics of peptide synthesis, and may be involved in interactions between the large and small subunits, either directly or through other factors. In mouse, a deletion mutation in L24 has been identified as the cause for the belly spot and tail (Bst) mutation that results in disrupted pigmentation, somitogenesis and retinal cell fate determination.  L24 may be an important protein in eukaryotic reproduction:  in shrimp, L24 expression is elevated in the ovary, suggesting a role in oogenesis, and in Arabidopsis, L24 has been proposed to have a specific function in gynoecium development. No protein with sequence or structural homology to L24e/L24 has been identifi
Probab=54.28  E-value=6.5  Score=19.70  Aligned_cols=11  Identities=45%  Similarity=1.174  Sum_probs=8.8

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      .-.|..||++|
T Consensus         3 ~~~C~f~g~~I   13 (54)
T cd00472           3 TEKCSFCGYKI   13 (54)
T ss_pred             EEEecCcCCee
Confidence            35799999986


No 175
>PHA02998 RNA polymerase subunit; Provisional
Probab=54.24  E-value=7.2  Score=24.35  Aligned_cols=13  Identities=15%  Similarity=0.330  Sum_probs=9.3

Q ss_pred             CceecCCCCCeEE
Q 035423            9 DVIQCRECGYRIL   21 (35)
Q Consensus         9 ~~irC~~CG~RIl   21 (35)
                      ..+.||.||++=.
T Consensus       142 t~v~CPkCg~~~A  154 (195)
T PHA02998        142 YNTPCPNCKSKNT  154 (195)
T ss_pred             cCCCCCCCCCCce
Confidence            4578888888633


No 176
>COG5132 BUD31 Cell cycle control protein, G10 family [Transcription / Cell division and chromosome partitioning]
Probab=53.95  E-value=3.7  Score=24.47  Aligned_cols=15  Identities=33%  Similarity=0.893  Sum_probs=11.6

Q ss_pred             cCCCCceecCCCCCe
Q 035423            5 LKPGDVIQCRECGYR   19 (35)
Q Consensus         5 lk~~~~irC~~CG~R   19 (35)
                      |.....++|.+||+|
T Consensus       126 ld~~qr~kC~hCGCr  140 (146)
T COG5132         126 LDVSQRLKCDHCGCR  140 (146)
T ss_pred             cCHHHhccccccCCC
Confidence            445567889999987


No 177
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=53.42  E-value=3.5  Score=22.95  Aligned_cols=17  Identities=18%  Similarity=0.305  Sum_probs=12.3

Q ss_pred             ccCCCCceecCCCCCeE
Q 035423            4 TLKPGDVIQCRECGYRI   20 (35)
Q Consensus         4 ~lk~~~~irC~~CG~RI   20 (35)
                      +.+..+.-.||.||...
T Consensus        29 e~~~~~~~~Cp~C~~~~   45 (89)
T COG1997          29 EAQQRAKHVCPFCGRTT   45 (89)
T ss_pred             HHHHhcCCcCCCCCCcc
Confidence            44556777899999874


No 178
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=53.38  E-value=12  Score=22.60  Aligned_cols=20  Identities=30%  Similarity=0.956  Sum_probs=15.4

Q ss_pred             cCCCCceecCCCCCeEEEee
Q 035423            5 LKPGDVIQCRECGYRILYKK   24 (35)
Q Consensus         5 lk~~~~irC~~CG~RIlyK~   24 (35)
                      ...+...+|..||-+++++.
T Consensus       135 ~~~g~~YrC~~C~gkL~~~~  154 (156)
T COG3091         135 VRRGEVYRCGKCGGKLVFKG  154 (156)
T ss_pred             ccccceEEeccCCceEEecc
Confidence            34556789999999988763


No 179
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional
Probab=53.31  E-value=2.3  Score=26.88  Aligned_cols=15  Identities=27%  Similarity=0.463  Sum_probs=12.0

Q ss_pred             CCceecCCCCCeEEE
Q 035423            8 GDVIQCRECGYRILY   22 (35)
Q Consensus         8 ~~~irC~~CG~RIly   22 (35)
                      .++.-||-|||++++
T Consensus         5 r~~~~CpGCg~~~il   19 (279)
T PRK11866          5 RPPIWCPGCGNYGIL   19 (279)
T ss_pred             CCCCCCCCCCChHHH
Confidence            467899999998554


No 180
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=53.16  E-value=7.2  Score=21.56  Aligned_cols=9  Identities=22%  Similarity=0.637  Sum_probs=7.4

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      ..||.||..
T Consensus        88 ~~CP~Cgs~   96 (114)
T PRK03681         88 RRCPQCHGD   96 (114)
T ss_pred             CcCcCcCCC
Confidence            679999965


No 181
>PHA00616 hypothetical protein
Probab=52.90  E-value=4.7  Score=19.64  Aligned_cols=11  Identities=36%  Similarity=0.673  Sum_probs=8.2

Q ss_pred             eecCCCCCeEE
Q 035423           11 IQCRECGYRIL   21 (35)
Q Consensus        11 irC~~CG~RIl   21 (35)
                      -+|+.||..-.
T Consensus         2 YqC~~CG~~F~   12 (44)
T PHA00616          2 YQCLRCGGIFR   12 (44)
T ss_pred             CccchhhHHHh
Confidence            47999997643


No 182
>PRK04860 hypothetical protein; Provisional
Probab=52.86  E-value=14  Score=21.77  Aligned_cols=17  Identities=35%  Similarity=0.915  Sum_probs=13.9

Q ss_pred             CCceecCCCCCeEEEee
Q 035423            8 GDVIQCRECGYRILYKK   24 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK~   24 (35)
                      ..+.+|..|+..+.|+.
T Consensus       141 ~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        141 EAVYRCRRCGETLVFKG  157 (160)
T ss_pred             CccEECCCCCceeEEec
Confidence            34689999999988864


No 183
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=52.78  E-value=15  Score=16.61  Aligned_cols=12  Identities=42%  Similarity=0.805  Sum_probs=8.3

Q ss_pred             ecCCCCCeEEEe
Q 035423           12 QCRECGYRILYK   23 (35)
Q Consensus        12 rC~~CG~RIlyK   23 (35)
                      -||+||.=.+.+
T Consensus         3 FCp~C~nlL~p~   14 (35)
T PF02150_consen    3 FCPECGNLLYPK   14 (35)
T ss_dssp             BETTTTSBEEEE
T ss_pred             eCCCCCccceEc
Confidence            499999864433


No 184
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=52.64  E-value=10  Score=17.84  Aligned_cols=16  Identities=19%  Similarity=0.603  Sum_probs=12.6

Q ss_pred             CceecCCCCCeEEEee
Q 035423            9 DVIQCRECGYRILYKK   24 (35)
Q Consensus         9 ~~irC~~CG~RIlyK~   24 (35)
                      +.+.|.+||..+=+..
T Consensus        17 ~~a~C~~C~~~l~~~~   32 (50)
T smart00614       17 QRAKCKYCGKKLSRSS   32 (50)
T ss_pred             eEEEecCCCCEeeeCC
Confidence            4699999999876543


No 185
>PRK00595 rpmG 50S ribosomal protein L33; Validated
Probab=52.54  E-value=14  Score=18.32  Aligned_cols=12  Identities=17%  Similarity=-0.017  Sum_probs=10.0

Q ss_pred             cCCCCCeEEEee
Q 035423           13 CRECGYRILYKK   24 (35)
Q Consensus        13 C~~CG~RIlyK~   24 (35)
                      ||.|+...|+|+
T Consensus        40 cp~~~khtlhkE   51 (53)
T PRK00595         40 DPVLRKHVLHKE   51 (53)
T ss_pred             CCCCCCEEeEEe
Confidence            888888888876


No 186
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=52.12  E-value=8  Score=19.35  Aligned_cols=13  Identities=46%  Similarity=1.288  Sum_probs=10.2

Q ss_pred             CCCceecCCCCCe
Q 035423            7 PGDVIQCRECGYR   19 (35)
Q Consensus         7 ~~~~irC~~CG~R   19 (35)
                      +-...+|..|||.
T Consensus        25 p~~A~~CRKCg~~   37 (48)
T PRK04136         25 PWRATKCRKCGYK   37 (48)
T ss_pred             CccccccccCCCC
Confidence            3456899999996


No 187
>PF14122 YokU:  YokU-like protein
Probab=52.08  E-value=8.8  Score=21.26  Aligned_cols=15  Identities=27%  Similarity=0.725  Sum_probs=12.9

Q ss_pred             ccCCCCceecCCCCC
Q 035423            4 TLKPGDVIQCRECGY   18 (35)
Q Consensus         4 ~lk~~~~irC~~CG~   18 (35)
                      +|+..+.+-|.+||-
T Consensus        29 eI~~tP~i~C~~Cgm   43 (87)
T PF14122_consen   29 EITDTPAIICSNCGM   43 (87)
T ss_pred             EecCCceeeecCCCc
Confidence            577889999999995


No 188
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=52.03  E-value=6.4  Score=20.73  Aligned_cols=9  Identities=33%  Similarity=1.232  Sum_probs=7.4

Q ss_pred             ceecCCCCC
Q 035423           10 VIQCRECGY   18 (35)
Q Consensus        10 ~irC~~CG~   18 (35)
                      -.+||.||.
T Consensus        17 ~lrCPRC~~   25 (65)
T COG4049          17 FLRCPRCGM   25 (65)
T ss_pred             eeeCCchhH
Confidence            479999994


No 189
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=51.76  E-value=20  Score=16.97  Aligned_cols=16  Identities=25%  Similarity=0.746  Sum_probs=10.5

Q ss_pred             eecCCCCCeEEEeecCC
Q 035423           11 IQCRECGYRILYKKRTR   27 (35)
Q Consensus        11 irC~~CG~RIlyK~R~~   27 (35)
                      -.||.||.. |++.+..
T Consensus        18 ~~Cp~C~~P-L~~~k~g   33 (41)
T PF06677_consen   18 EHCPDCGTP-LMRDKDG   33 (41)
T ss_pred             CccCCCCCe-eEEecCC
Confidence            469999865 6654443


No 190
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=51.72  E-value=6.2  Score=23.15  Aligned_cols=10  Identities=40%  Similarity=0.916  Sum_probs=7.8

Q ss_pred             ecCCCCCeEE
Q 035423           12 QCRECGYRIL   21 (35)
Q Consensus        12 rC~~CG~RIl   21 (35)
                      =||.||.+-+
T Consensus        21 GCP~CGg~kF   30 (131)
T PF09845_consen   21 GCPECGGNKF   30 (131)
T ss_pred             cCcccCCcce
Confidence            4999998843


No 191
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=51.58  E-value=12  Score=21.85  Aligned_cols=16  Identities=19%  Similarity=0.657  Sum_probs=12.8

Q ss_pred             CceecCCCCCeEEEee
Q 035423            9 DVIQCRECGYRILYKK   24 (35)
Q Consensus         9 ~~irC~~CG~RIlyK~   24 (35)
                      ....|..|||.+-|..
T Consensus       111 G~l~C~~Cg~~~~~~~  126 (146)
T PF07295_consen  111 GTLVCENCGHEVELTH  126 (146)
T ss_pred             ceEecccCCCEEEecC
Confidence            4578999999988865


No 192
>PRK09521 exosome complex RNA-binding protein Csl4; Provisional
Probab=51.40  E-value=9.9  Score=22.21  Aligned_cols=12  Identities=25%  Similarity=0.769  Sum_probs=10.0

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      ..+.|++||++-
T Consensus       165 ~~~~c~~~~~~e  176 (189)
T PRK09521        165 NELKCPNCGNIE  176 (189)
T ss_pred             CEEECCCCCCEE
Confidence            679999999763


No 193
>PF10533 Plant_zn_clust:  Plant zinc cluster domain;  InterPro: IPR018872  This zinc binding domain is found associated with the WRKY domain IPR003657 from INTERPRO []. 
Probab=51.35  E-value=13  Score=18.47  Aligned_cols=25  Identities=24%  Similarity=0.489  Sum_probs=18.7

Q ss_pred             CCCceecCCCCCeEEEeecCCceEEEEe
Q 035423            7 PGDVIQCRECGYRILYKKRTRRIVQYEA   34 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK~R~~~~~~~~A   34 (35)
                      -...-+| +|..+  =|.|-++++.+.|
T Consensus        16 ~sssgrC-HCsKk--RK~RvKR~irVPA   40 (47)
T PF10533_consen   16 CSSSGRC-HCSKK--RKSRVKRTIRVPA   40 (47)
T ss_pred             cCCCCcc-cCCCc--ccccceeeEEeec
Confidence            3456688 89886  5778888888876


No 194
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=51.34  E-value=3.9  Score=22.57  Aligned_cols=17  Identities=18%  Similarity=0.323  Sum_probs=12.7

Q ss_pred             cccCCCCceecCCCCCe
Q 035423            3 NTLKPGDVIQCRECGYR   19 (35)
Q Consensus         3 ~~lk~~~~irC~~CG~R   19 (35)
                      .+++....-.||.||.-
T Consensus        29 ie~~q~a~y~CpfCgk~   45 (90)
T PTZ00255         29 IEISQHAKYFCPFCGKH   45 (90)
T ss_pred             HHHHHhCCccCCCCCCC
Confidence            45667778889999854


No 195
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=51.18  E-value=15  Score=20.60  Aligned_cols=24  Identities=25%  Similarity=0.551  Sum_probs=17.1

Q ss_pred             CCceecCCCCCeEEEeecCCceEE
Q 035423            8 GDVIQCRECGYRILYKKRTRRIVQ   31 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK~R~~~~~~   31 (35)
                      .-.-+|..||..++...|...+.+
T Consensus       110 ~~~y~C~~C~~~~~~~rr~~~~~~  133 (146)
T smart00731      110 KYPYRCTGCGQRYLRVRRSNNVSR  133 (146)
T ss_pred             eEEEECCCCCCCCceEccccCcce
Confidence            346788889988887777766433


No 196
>cd02772 MopB_NDH-1_NuoG2 MopB_NDH-1_NuoG2: The second domain of the NuoG subunit of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1), found in beta- and gammaproteobacteria. The NDH-1 is the first energy-transducting complex in the respiratory chain and functions as a redox pump that uses the redox energy to translocate H+ ions across the membrane, resulting in a significant contribution to energy production. In Escherichia coli NDH-1, the largest subunit is encoded by the nuoG gene, and is part of the 14 distinct subunits constituting the functional enzyme. The NuoG subunit is made of two domains: the first contains three binding sites for FeS clusters (the fer2 domain), the second domain (this CD), is of unknown function or, as postulated, has lost an ancestral formate dehydrogenase activity that became redundant during the evolution of the complex I enzyme. Although only vestigial sequence evidence remains of a molybdopterin binding site, this protein domain belongs to t
Probab=50.66  E-value=26  Score=22.01  Aligned_cols=23  Identities=4%  Similarity=0.176  Sum_probs=19.0

Q ss_pred             ecCCC--CCeEEEeecCCceEEEEe
Q 035423           12 QCREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        12 rC~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      -|+.|  |+-|+...+..+++.++.
T Consensus         3 ~C~~C~~gC~i~v~~~~g~i~~v~~   27 (414)
T cd02772           3 VSPHDALGSNLVVHVKNNKVMRVVP   27 (414)
T ss_pred             cCCCCCCCCCeEEEEECCEEEEEEc
Confidence            38888  888999999888888764


No 197
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=50.50  E-value=11  Score=17.35  Aligned_cols=14  Identities=21%  Similarity=0.501  Sum_probs=11.1

Q ss_pred             ceecCCCCCeE-EEe
Q 035423           10 VIQCRECGYRI-LYK   23 (35)
Q Consensus        10 ~irC~~CG~RI-lyK   23 (35)
                      .|.||.|+.-= +||
T Consensus         5 ~v~CP~C~s~~~v~k   19 (36)
T PF03811_consen    5 DVHCPRCQSTEGVKK   19 (36)
T ss_pred             eeeCCCCCCCCccee
Confidence            58999999876 555


No 198
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=50.47  E-value=7.6  Score=20.04  Aligned_cols=9  Identities=44%  Similarity=1.010  Sum_probs=7.5

Q ss_pred             ecCCCCCeE
Q 035423           12 QCRECGYRI   20 (35)
Q Consensus        12 rC~~CG~RI   20 (35)
                      +||.||..-
T Consensus        17 ~CP~Cgs~~   25 (61)
T PRK08351         17 RCPVCGSRD   25 (61)
T ss_pred             cCCCCcCCc
Confidence            799999863


No 199
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=50.43  E-value=6.5  Score=20.68  Aligned_cols=12  Identities=33%  Similarity=0.708  Sum_probs=9.8

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      -||||=.||.-|
T Consensus         3 iPiRCFsCGkvi   14 (63)
T COG1644           3 IPVRCFSCGKVI   14 (63)
T ss_pred             CceEeecCCCCH
Confidence            479999999754


No 200
>COG1631 RPL42A Ribosomal protein L44E [Translation, ribosomal structure and biogenesis]
Probab=50.37  E-value=12  Score=21.04  Aligned_cols=13  Identities=31%  Similarity=0.692  Sum_probs=10.9

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      -.+|.+||+.+.-
T Consensus        68 r~~Ct~Cgkah~~   80 (94)
T COG1631          68 RLRCTECGKAHQR   80 (94)
T ss_pred             EEEehhhcccccc
Confidence            4689999999775


No 201
>PRK01343 zinc-binding protein; Provisional
Probab=50.19  E-value=7.2  Score=19.96  Aligned_cols=18  Identities=22%  Similarity=0.355  Sum_probs=12.8

Q ss_pred             CCceecCCCCCeEEEeec
Q 035423            8 GDVIQCRECGYRILYKKR   25 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK~R   25 (35)
                      ...++||.||.......|
T Consensus         7 ~p~~~CP~C~k~~~~~~r   24 (57)
T PRK01343          7 RPTRPCPECGKPSTREAY   24 (57)
T ss_pred             CCCCcCCCCCCcCcCCCC
Confidence            357899999987654433


No 202
>PF04475 DUF555:  Protein of unknown function (DUF555);  InterPro: IPR007564 This is a family of uncharacterised, hypothetical archaeal proteins.
Probab=50.13  E-value=7.7  Score=22.05  Aligned_cols=16  Identities=31%  Similarity=0.860  Sum_probs=10.7

Q ss_pred             ccCCCCceecCCCCCeE
Q 035423            4 TLKPGDVIQCRECGYRI   20 (35)
Q Consensus         4 ~lk~~~~irC~~CG~RI   20 (35)
                      ++..++ ..||.||.-+
T Consensus        42 eIevG~-~~cP~Cge~~   57 (102)
T PF04475_consen   42 EIEVGD-TICPKCGEEL   57 (102)
T ss_pred             EEecCc-ccCCCCCCcc
Confidence            344443 7899999863


No 203
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=50.01  E-value=7  Score=21.58  Aligned_cols=10  Identities=20%  Similarity=0.604  Sum_probs=7.6

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ...||.||..
T Consensus        86 ~~~CP~Cgs~   95 (115)
T TIGR00100        86 LYRCPKCHGI   95 (115)
T ss_pred             CccCcCCcCC
Confidence            4679999964


No 204
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=49.61  E-value=9.3  Score=24.54  Aligned_cols=15  Identities=20%  Similarity=0.561  Sum_probs=11.3

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      ...+.+.|+.||++=
T Consensus       254 ~~t~~~~C~~C~~~~  268 (299)
T TIGR01385       254 AVTDLFTCGKCKQKK  268 (299)
T ss_pred             CCcccccCCCCCCcc
Confidence            345678999999873


No 205
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=49.56  E-value=6.8  Score=20.74  Aligned_cols=11  Identities=27%  Similarity=0.685  Sum_probs=4.0

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..-.||.|||.
T Consensus        21 ~~F~CPfC~~~   31 (81)
T PF05129_consen   21 KVFDCPFCNHE   31 (81)
T ss_dssp             S----TTT--S
T ss_pred             ceEcCCcCCCC
Confidence            45689999965


No 206
>TIGR01023 rpmG_bact ribosomal protein L33, bacterial type. This model describes bacterial ribosomal protein L33 and its chloroplast and mitochondrial equivalents.
Probab=49.42  E-value=16  Score=18.18  Aligned_cols=12  Identities=33%  Similarity=0.750  Sum_probs=9.9

Q ss_pred             cCCCCCeEEEee
Q 035423           13 CRECGYRILYKK   24 (35)
Q Consensus        13 C~~CG~RIlyK~   24 (35)
                      ||.|+...|+|+
T Consensus        41 cp~~~khtlhkE   52 (54)
T TIGR01023        41 CPVCRKHVLHKE   52 (54)
T ss_pred             CCCCCCeEeEEe
Confidence            788888888876


No 207
>COG1743 Adenine-specific DNA methylase containing a Zn-ribbon [DNA replication, recombination, and repair]
Probab=48.98  E-value=8.6  Score=28.49  Aligned_cols=10  Identities=30%  Similarity=0.926  Sum_probs=8.4

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .|+||.||+-
T Consensus       178 ~VkCP~CG~~  187 (875)
T COG1743         178 EVKCPRCGRL  187 (875)
T ss_pred             EEecCCcCcc
Confidence            4899999974


No 208
>PF09151 DUF1936:  Domain of unknown function (DUF1936);  InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins. Its exact function has not, as yet, been defined. ; PDB: 2QH1_B 1PVM_B.
Probab=48.81  E-value=9.2  Score=18.01  Aligned_cols=11  Identities=36%  Similarity=0.927  Sum_probs=8.1

Q ss_pred             ecCCCCCeEEE
Q 035423           12 QCRECGYRILY   22 (35)
Q Consensus        12 rC~~CG~RIly   22 (35)
                      -||.||--+|-
T Consensus         3 lcpkcgvgvl~   13 (36)
T PF09151_consen    3 LCPKCGVGVLE   13 (36)
T ss_dssp             B-TTTSSSBEE
T ss_pred             cCCccCceEEE
Confidence            49999988874


No 209
>PF15494 SRCR_2:  Scavenger receptor cysteine-rich domain
Probab=48.73  E-value=9.4  Score=20.03  Aligned_cols=10  Identities=50%  Similarity=1.305  Sum_probs=8.2

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .++|-.||.|
T Consensus        88 sL~C~~CG~r   97 (98)
T PF15494_consen   88 SLQCSDCGKR   97 (98)
T ss_pred             EEECcccCCc
Confidence            4789999976


No 210
>PRK00420 hypothetical protein; Validated
Probab=48.64  E-value=17  Score=20.63  Aligned_cols=16  Identities=19%  Similarity=0.293  Sum_probs=10.6

Q ss_pred             CCceecCCCCCeEEEe
Q 035423            8 GDVIQCRECGYRILYK   23 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK   23 (35)
                      ...+.||.||.-+..+
T Consensus        38 ~g~~~Cp~Cg~~~~v~   53 (112)
T PRK00420         38 DGEVVCPVHGKVYIVK   53 (112)
T ss_pred             CCceECCCCCCeeeec
Confidence            4467788888765543


No 211
>PRK02935 hypothetical protein; Provisional
Probab=48.25  E-value=10  Score=21.83  Aligned_cols=11  Identities=18%  Similarity=0.465  Sum_probs=8.8

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+|.||+|+.-
T Consensus        69 vqV~CP~C~K~   79 (110)
T PRK02935         69 VQVICPSCEKP   79 (110)
T ss_pred             eeeECCCCCch
Confidence            46899999864


No 212
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=48.22  E-value=11  Score=21.04  Aligned_cols=11  Identities=27%  Similarity=0.776  Sum_probs=8.4

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      .+.||.||++=
T Consensus        72 ~~~CpkCg~~e   82 (113)
T COG1594          72 KEKCPKCGNKE   82 (113)
T ss_pred             cccCCCCCCce
Confidence            46799999873


No 213
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=48.20  E-value=7.5  Score=21.77  Aligned_cols=8  Identities=50%  Similarity=1.294  Sum_probs=6.7

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      ..||.||.
T Consensus        93 ~~CP~Cgs  100 (124)
T PRK00762         93 IECPVCGN  100 (124)
T ss_pred             CcCcCCCC
Confidence            57999994


No 214
>PF03330 DPBB_1:  Rare lipoprotein A (RlpA)-like double-psi beta-barrel;  InterPro: IPR009009  Beta barrels are commonly observed in protein structures. They are classified in terms of two integral parameters: the number of strands in the sheet, n, and the shear number, S, a measure of the stagger of the strands in the beta-sheet. These two parameters have been shown to determine the major geometrical features of beta-barrels. Six-stranded beta-barrels with a pseudo-twofold axis are found in several proteins. One involving parallel strands forming two psi structures is known as the double-psi barrel. The first psi structure consists of the loop connecting strands beta1 and beta2 (a 'psi loop') and the strand beta5, whereas the second psi structure consists of the loop connecting strands beta4 and beta5 and the strand beta2. All the psi structures in double-psi barrels have a unique handedness, in that beta1 (beta4), beta2 (beta5) and the loop following beta5 (beta2) form a right-handed helix. The unique handedness may be related to the fact that the twisting angle between the parallel pair of strands is always larger than that between the antiparallel pair [].; PDB: 1N10_B 3D30_A 2BH0_A 2HCZ_X.
Probab=48.11  E-value=13  Score=18.65  Aligned_cols=11  Identities=27%  Similarity=0.498  Sum_probs=7.9

Q ss_pred             eecCCCCCeEE
Q 035423           11 IQCRECGYRIL   21 (35)
Q Consensus        11 irC~~CG~RIl   21 (35)
                      -+||.|+.+.|
T Consensus        46 D~Cp~~~~~~l   56 (78)
T PF03330_consen   46 DRCPGCPPNHL   56 (78)
T ss_dssp             EE-TTSSSSEE
T ss_pred             ccCCCCcCCEE
Confidence            47999998876


No 215
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=47.96  E-value=6.2  Score=24.42  Aligned_cols=10  Identities=40%  Similarity=0.929  Sum_probs=4.0

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      -+.||+||..
T Consensus       211 R~~Cp~Cg~~  220 (290)
T PF04216_consen  211 RIKCPYCGNT  220 (290)
T ss_dssp             TTS-TTT---
T ss_pred             CCCCcCCCCC
Confidence            3567888753


No 216
>PF15288 zf-CCHC_6:  Zinc knuckle
Probab=47.84  E-value=6.9  Score=18.82  Aligned_cols=8  Identities=38%  Similarity=1.481  Sum_probs=6.3

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      ++|..||-
T Consensus         2 ~kC~~CG~    9 (40)
T PF15288_consen    2 VKCKNCGA    9 (40)
T ss_pred             cccccccc
Confidence            68999973


No 217
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=47.41  E-value=12  Score=22.52  Aligned_cols=16  Identities=38%  Similarity=0.904  Sum_probs=12.5

Q ss_pred             ccCCCCceecCCCCCe
Q 035423            4 TLKPGDVIQCRECGYR   19 (35)
Q Consensus         4 ~lk~~~~irC~~CG~R   19 (35)
                      .+++.+...|.+||+.
T Consensus       348 ~~~~~p~~~c~~cg~~  363 (389)
T PRK11788        348 QLKRKPRYRCRNCGFT  363 (389)
T ss_pred             HHhCCCCEECCCCCCC
Confidence            3677778889999975


No 218
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=47.37  E-value=22  Score=15.51  Aligned_cols=16  Identities=31%  Similarity=0.690  Sum_probs=12.7

Q ss_pred             CCceecCCCCCeEEEe
Q 035423            8 GDVIQCRECGYRILYK   23 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK   23 (35)
                      ..-.+|..||.-+..-
T Consensus         5 ~~~ykC~~Cgniv~v~   20 (34)
T TIGR00319         5 GQVYKCEVCGNIVEVL   20 (34)
T ss_pred             CcEEEcCCCCcEEEEE
Confidence            5578999999987654


No 219
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=47.32  E-value=11  Score=20.88  Aligned_cols=15  Identities=40%  Similarity=1.108  Sum_probs=12.9

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      ..++.+-|..||-|+
T Consensus        48 q~g~~lvC~~C~~~~   62 (102)
T PF10080_consen   48 QEGDQLVCKNCGVRF   62 (102)
T ss_pred             EECCEEEEecCCCEE
Confidence            467899999999985


No 220
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=47.24  E-value=23  Score=15.53  Aligned_cols=16  Identities=25%  Similarity=0.590  Sum_probs=12.0

Q ss_pred             CceecCCCCCeEEEee
Q 035423            9 DVIQCRECGYRILYKK   24 (35)
Q Consensus         9 ~~irC~~CG~RIlyK~   24 (35)
                      .-.+|..||.-+..-.
T Consensus         3 ~~ykC~~CGniv~v~~   18 (34)
T cd00974           3 EVYKCEICGNIVEVLN   18 (34)
T ss_pred             cEEEcCCCCcEEEEEE
Confidence            4578999999886543


No 221
>cd02768 MopB_NADH-Q-OR-NuoG2 MopB_NADH-Q-OR-NuoG2: The NuoG/Nad11/75-kDa subunit (second domain) of the NADH-quinone oxidoreductase (NADH-Q-OR)/respiratory complex I/NADH dehydrogenase-1 (NDH-1). The NADH-Q-OR is the first energy-transducting complex in the respiratory chains of many prokaryotes and eukaryotes. Mitochondrial complex I and its bacterial counterpart, NDH-1, function as a redox pump that uses the redox energy to translocate H+ ions across the membrane, resulting in a significant contribution to energy production. The atomic structure of complex I is not known and the mechanisms of electron transfer and proton pumping are not established. The nad11 gene codes for the largest (75-kDa) subunit of the mitochondrial NADH:ubiquinone oxidoreductase, it constitutes the electron input part of the enzyme, or the so-called NADH dehydrogenase fragment. In Escherichia coli, this subunit is encoded by the nuoG gene, and is part of the 14 distinct subunits constituting the 'minimal' fun
Probab=46.81  E-value=32  Score=21.21  Aligned_cols=23  Identities=13%  Similarity=0.011  Sum_probs=17.0

Q ss_pred             ecCCC--CCeEEEeecCCceEEEEe
Q 035423           12 QCREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        12 rC~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      -|+.|  |+-|.+..|..+++.++.
T Consensus         3 ~C~~C~~gC~i~v~~~~g~i~~i~~   27 (386)
T cd02768           3 IDVHDALGSNIRVDVRGGEVMRILP   27 (386)
T ss_pred             cCCCCCCCCCeEEEEECCEEEEEeC
Confidence            48888  778888888777766653


No 222
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=46.78  E-value=5.4  Score=23.41  Aligned_cols=18  Identities=33%  Similarity=0.645  Sum_probs=12.5

Q ss_pred             cCCCCceecCCCCCeEEE
Q 035423            5 LKPGDVIQCRECGYRILY   22 (35)
Q Consensus         5 lk~~~~irC~~CG~RIly   22 (35)
                      |+.+-.-+||.||.-=||
T Consensus        16 i~~Gl~grCP~CGeGrLF   33 (126)
T COG5349          16 IKRGLRGRCPRCGEGRLF   33 (126)
T ss_pred             HHHHhcCCCCCCCCchhh
Confidence            555666789999965444


No 223
>PRK11032 hypothetical protein; Provisional
Probab=46.29  E-value=17  Score=21.69  Aligned_cols=16  Identities=13%  Similarity=0.532  Sum_probs=10.8

Q ss_pred             CceecCCCCCeEEEee
Q 035423            9 DVIQCRECGYRILYKK   24 (35)
Q Consensus         9 ~~irC~~CG~RIlyK~   24 (35)
                      ....|.+|||.+-|..
T Consensus       123 G~LvC~~Cg~~~~~~~  138 (160)
T PRK11032        123 GNLVCEKCHHHLAFYT  138 (160)
T ss_pred             ceEEecCCCCEEEecC
Confidence            3467888888776643


No 224
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=46.22  E-value=6  Score=23.96  Aligned_cols=18  Identities=22%  Similarity=0.438  Sum_probs=13.8

Q ss_pred             ceecCCCCCeEEEeecCC
Q 035423           10 VIQCRECGYRILYKKRTR   27 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R~~   27 (35)
                      .-|||+|+-.+.-..+..
T Consensus        97 ~~RCp~CN~~L~~vs~ee  114 (165)
T COG1656          97 FSRCPECNGELEKVSREE  114 (165)
T ss_pred             cccCcccCCEeccCcHHH
Confidence            579999999977655554


No 225
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=46.15  E-value=11  Score=22.31  Aligned_cols=19  Identities=21%  Similarity=0.539  Sum_probs=14.4

Q ss_pred             CCCCceecCCCCCeEEEee
Q 035423            6 KPGDVIQCRECGYRILYKK   24 (35)
Q Consensus         6 k~~~~irC~~CG~RIlyK~   24 (35)
                      .....|-||.||.--+-|.
T Consensus        28 ~~~glv~CP~Cgs~~V~K~   46 (148)
T PF06676_consen   28 QARGLVSCPVCGSTEVSKA   46 (148)
T ss_pred             HHcCCccCCCCCCCeEeee
Confidence            3456799999999877663


No 226
>PRK04173 glycyl-tRNA synthetase; Provisional
Probab=45.82  E-value=10  Score=25.26  Aligned_cols=15  Identities=40%  Similarity=1.006  Sum_probs=12.0

Q ss_pred             ceecCCCCCe---------EEEee
Q 035423           10 VIQCRECGYR---------ILYKK   24 (35)
Q Consensus        10 ~irC~~CG~R---------IlyK~   24 (35)
                      +++||.||.-         .||+-
T Consensus       125 ~m~cp~~~~~~~~~~~~f~l~f~~  148 (456)
T PRK04173        125 DIKCPECGGENWTEVRQFNLMFKT  148 (456)
T ss_pred             CCCCCCCCCCCCcCccchhhceee
Confidence            6999999865         78773


No 227
>PF09706 Cas_CXXC_CXXC:  CRISPR-associated protein (Cas_CXXC_CXXC);  InterPro: IPR019121 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.  This entry represents a conserved domain of about 65 amino acids found in otherwise highly divergent proteins encoded in CRISPR-associated regions. This domain features two CXXC motifs. 
Probab=45.66  E-value=14  Score=18.91  Aligned_cols=20  Identities=30%  Similarity=0.411  Sum_probs=15.4

Q ss_pred             CCCceecCCCCCeEEEeecC
Q 035423            7 PGDVIQCRECGYRILYKKRT   26 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK~R~   26 (35)
                      ..+.-.|-.||-|+.++...
T Consensus         2 ~k~~~~C~~Cg~r~~~~~k~   21 (69)
T PF09706_consen    2 SKKKYNCIFCGERPSKKKKG   21 (69)
T ss_pred             CCCCCcCcCCCCcccccccc
Confidence            35567899999998777655


No 228
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=45.41  E-value=11  Score=18.36  Aligned_cols=8  Identities=63%  Similarity=1.522  Sum_probs=5.6

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      -+|+.|||
T Consensus         2 y~C~~Cgy    9 (47)
T PF00301_consen    2 YQCPVCGY    9 (47)
T ss_dssp             EEETTTSB
T ss_pred             cCCCCCCE
Confidence            36788886


No 229
>cd02753 MopB_Formate-Dh-H Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons. It is a component of the anaerobic formate hydrogen lyase complex. The E. coli formate dehydrogenase H (Fdh-H) is a monomer composed of a single polypeptide chain with a  Mo active site region and a [4Fe-4S] center. Members of the MopB_Formate-Dh-H CD belong to the molybdopterin_binding (MopB) superfamily of proteins.
Probab=45.27  E-value=34  Score=22.19  Aligned_cols=23  Identities=26%  Similarity=0.475  Sum_probs=17.7

Q ss_pred             ecCCC--CCeEEEeecCCceEEEEe
Q 035423           12 QCREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        12 rC~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      -|+.|  |+-|....|..+++.++.
T Consensus         3 ~C~~C~~~C~i~v~v~~g~v~ri~g   27 (512)
T cd02753           3 VCPYCGVGCGLELWVKDNKIVGVEP   27 (512)
T ss_pred             cCCCCCCCCCEEEEEECCeEEEeec
Confidence            37777  678998888888877764


No 230
>PF00935 Ribosomal_L44:  Ribosomal protein L44;  InterPro: IPR000552 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families consists of mammalian [], Trypanosoma brucei, Caenorhabditis elegans and fungal L44, and Haloarcula marismortui LA [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3IZS_r 1S1I_Z 3O5H_f 3O58_f 3IZR_r 1M1K_4 3CCQ_3 3CCL_3 3CME_3 1K73_4 ....
Probab=45.20  E-value=16  Score=19.59  Aligned_cols=14  Identities=29%  Similarity=0.738  Sum_probs=10.1

Q ss_pred             ceecCCCCCeEEEe
Q 035423           10 VIQCRECGYRILYK   23 (35)
Q Consensus        10 ~irC~~CG~RIlyK   23 (35)
                      -.+|.+||+..+..
T Consensus        53 rl~C~~C~~~~~~~   66 (77)
T PF00935_consen   53 RLECTECGKAHMRP   66 (77)
T ss_dssp             EEEETTTS-EEEEE
T ss_pred             EEEeCCCCcccccc
Confidence            46899999987643


No 231
>KOG1088 consensus Uncharacterized conserved protein [Function unknown]
Probab=45.19  E-value=12  Score=21.91  Aligned_cols=11  Identities=27%  Similarity=0.486  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ....||+||+-
T Consensus        97 G~l~CpetG~v  107 (124)
T KOG1088|consen   97 GELVCPETGRV  107 (124)
T ss_pred             ceEecCCCCcE
Confidence            35889999975


No 232
>KOG2463 consensus Predicted RNA-binding protein Nob1p involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones]
Probab=45.10  E-value=14  Score=24.99  Aligned_cols=17  Identities=29%  Similarity=0.419  Sum_probs=13.2

Q ss_pred             CCCceecCCCCCeEEEe
Q 035423            7 PGDVIQCRECGYRILYK   23 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK   23 (35)
                      ....+-||.||++-|-|
T Consensus       254 ~m~k~FCp~CG~~TL~K  270 (376)
T KOG2463|consen  254 EMPKDFCPSCGHKTLTK  270 (376)
T ss_pred             ccchhcccccCCCeeeE
Confidence            34467899999997765


No 233
>PF14577 SEO_C:  Sieve element occlusion C-terminus
Probab=44.98  E-value=12  Score=23.61  Aligned_cols=13  Identities=38%  Similarity=0.785  Sum_probs=10.1

Q ss_pred             CCCceecCCCCCe
Q 035423            7 PGDVIQCRECGYR   19 (35)
Q Consensus         7 ~~~~irC~~CG~R   19 (35)
                      .-+.|.||+||..
T Consensus       211 ipe~i~CpeC~R~  223 (235)
T PF14577_consen  211 IPETIVCPECGRP  223 (235)
T ss_pred             CCceeECCCCCCc
Confidence            4467999999964


No 234
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit. IOR catalyzes the oxidative decarboxylation of arylpyruvates, such as indolepyruvate or phenylpyruvate, which are generated by the transamination of aromatic amino acids, to the corresponding aryl acetyl-CoA.
Probab=44.88  E-value=4.4  Score=23.05  Aligned_cols=17  Identities=18%  Similarity=0.208  Sum_probs=13.2

Q ss_pred             CCceecCCCCCeEEEee
Q 035423            8 GDVIQCRECGYRILYKK   24 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK~   24 (35)
                      .++--|+-|+|++++..
T Consensus         2 ~~~~~c~gc~~~~~~~~   18 (178)
T cd02008           2 RPPGLCPGCPHRPSFYA   18 (178)
T ss_pred             CCCCcCCCCCChHHHHH
Confidence            35678999999987654


No 235
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=44.82  E-value=16  Score=21.17  Aligned_cols=13  Identities=31%  Similarity=0.784  Sum_probs=7.5

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      .-.||.||.-..+
T Consensus       128 ~F~Cp~Cg~~L~~  140 (158)
T TIGR00373       128 NFTCPRCGAMLDY  140 (158)
T ss_pred             CCcCCCCCCEeee
Confidence            3566666665443


No 236
>PF05265 DUF723:  Protein of unknown function (DUF723);  InterPro: IPR007929 This family contains several uncharacterised proteins from Neisseria meningitidis. These proteins may have a role in DNA binding.
Probab=44.75  E-value=10  Score=19.66  Aligned_cols=6  Identities=67%  Similarity=1.735  Sum_probs=4.5

Q ss_pred             ecCCCC
Q 035423           12 QCRECG   17 (35)
Q Consensus        12 rC~~CG   17 (35)
                      =||+||
T Consensus        55 GCP~Cg   60 (60)
T PF05265_consen   55 GCPECG   60 (60)
T ss_pred             CCCCCC
Confidence            488886


No 237
>PF08996 zf-DNA_Pol:  DNA Polymerase alpha zinc finger;  InterPro: IPR015088 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNA Polymerase alpha zinc finger domain adopts an alpha-helix-like structure, followed by three turns, all of which involve proline. The resulting motif is a helix-turn-helix motif, in contrast to other zinc finger domains, which show anti-parallel sheet and helix conformation. Zinc binding occurs due to the presence of four cysteine residues positioned to bind the metal centre in a tetrahedral coordination geometry. The function of this domain is uncertain: it has been proposed that the zinc finger motif may be an essential part of the DNA binding domain [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0001882 nucleoside binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 3FLO_D 1N5G_A 1K0P_A 1K18_A.
Probab=44.72  E-value=17  Score=21.38  Aligned_cols=15  Identities=20%  Similarity=0.669  Sum_probs=8.8

Q ss_pred             ceecCCCCCeEEEee
Q 035423           10 VIQCRECGYRILYKK   24 (35)
Q Consensus        10 ~irC~~CG~RIlyK~   24 (35)
                      .++||.||+...|.-
T Consensus        18 ~~~C~~C~~~~~f~g   32 (188)
T PF08996_consen   18 KLTCPSCGTEFEFPG   32 (188)
T ss_dssp             EEE-TTT--EEEE-S
T ss_pred             EeECCCCCCCccccc
Confidence            478999999988753


No 238
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=44.71  E-value=26  Score=21.64  Aligned_cols=15  Identities=40%  Similarity=0.576  Sum_probs=11.2

Q ss_pred             ceecCCCCCeEEEee
Q 035423           10 VIQCRECGYRILYKK   24 (35)
Q Consensus        10 ~irC~~CG~RIlyK~   24 (35)
                      .--||.||..|.--+
T Consensus       245 g~pC~~Cg~~I~~~~  259 (274)
T PRK01103        245 GEPCRRCGTPIEKIK  259 (274)
T ss_pred             CCCCCCCCCeeEEEE
Confidence            345999999986544


No 239
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=44.70  E-value=15  Score=23.11  Aligned_cols=14  Identities=29%  Similarity=0.717  Sum_probs=10.2

Q ss_pred             CCCCceecCCCCCe
Q 035423            6 KPGDVIQCRECGYR   19 (35)
Q Consensus         6 k~~~~irC~~CG~R   19 (35)
                      ..++.-+|+.||..
T Consensus       142 ~~~~~p~C~~Cg~~  155 (250)
T COG0846         142 EDGLIPRCPKCGGP  155 (250)
T ss_pred             ccCCCCcCccCCCc
Confidence            34456789999985


No 240
>PRK05978 hypothetical protein; Provisional
Probab=44.69  E-value=10  Score=22.37  Aligned_cols=15  Identities=27%  Similarity=0.561  Sum_probs=11.8

Q ss_pred             CceecCCCCCeEEEe
Q 035423            9 DVIQCRECGYRILYK   23 (35)
Q Consensus         9 ~~irC~~CG~RIlyK   23 (35)
                      -.-|||.||.-=||+
T Consensus        32 l~grCP~CG~G~LF~   46 (148)
T PRK05978         32 FRGRCPACGEGKLFR   46 (148)
T ss_pred             HcCcCCCCCCCcccc
Confidence            346899999887775


No 241
>cd04482 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacterized archaeal OB folds with similarity to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32). RPA2 is a subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B; RPA2 DBD-D is a weak ssDNA-binding domain. RPA2 DBD-D is also involved in trimerization. The ssDNA binding mechanism is believed to be multistep and to involve conformational change. N-terminal to human RPA2 DBD-D is a domain containing all the known phosphorylation sites of RPA. Human RPA2 is phosphorylated in a cell cycle depende
Probab=44.62  E-value=10  Score=20.01  Aligned_cols=8  Identities=38%  Similarity=0.983  Sum_probs=6.0

Q ss_pred             ceecCCCC
Q 035423           10 VIQCRECG   17 (35)
Q Consensus        10 ~irC~~CG   17 (35)
                      .-+||.||
T Consensus        84 np~C~~C~   91 (91)
T cd04482          84 NPVCPKCG   91 (91)
T ss_pred             CCcCCCCC
Confidence            45788887


No 242
>PRK11823 DNA repair protein RadA; Provisional
Probab=44.59  E-value=15  Score=24.31  Aligned_cols=14  Identities=36%  Similarity=0.769  Sum_probs=9.8

Q ss_pred             CCCCceecCCCCCe
Q 035423            6 KPGDVIQCRECGYR   19 (35)
Q Consensus         6 k~~~~irC~~CG~R   19 (35)
                      +.....+|.+|||.
T Consensus         3 ~~~~~y~C~~Cg~~   16 (446)
T PRK11823          3 KKKTAYVCQECGAE   16 (446)
T ss_pred             CCCCeEECCcCCCC
Confidence            34556788888875


No 243
>cd00368 Molybdopterin-Binding Molybdopterin-Binding (MopB) domain of the MopB superfamily of proteins, a  large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor. The MopB domain is found in a wide variety of molybdenum- and tungsten-containing enzymes, including formate dehydrogenase-H (Fdh-H) and -N (Fdh-N), several forms of nitrate reductase (Nap, Nas, NarG), dimethylsulfoxide reductase (DMSOR), thiosulfate reductase, formylmethanofuran dehydrogenase, and arsenite oxidase. Molybdenum is present in most of these enzymes in the form of molybdopterin, a modified pterin ring with a dithiolene side chain, which is responsible for ligating the Mo. In many bacterial and archaeal species, molybdopterin is in the form of a dinucleotide, with two molybdopterin dinucleotide units per molybdenum. These proteins can function as monomers, heterodimers, or heterotrimers, depending on the protein and organism. Also included in the MopB superfamily is 
Probab=44.44  E-value=39  Score=20.47  Aligned_cols=23  Identities=30%  Similarity=0.590  Sum_probs=17.0

Q ss_pred             ecCCC--CCeEEEeecCCceEEEEe
Q 035423           12 QCREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        12 rC~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      -|+.|  |+-|....|..+++.++.
T Consensus         3 ~C~~C~~gC~i~v~~~~g~i~ri~~   27 (374)
T cd00368           3 VCPFCGVGCGILVYVKDGKVVRIEG   27 (374)
T ss_pred             CCCCCcCCCCEEEEEECCEEEEEEC
Confidence            47777  677888888777777654


No 244
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=44.17  E-value=14  Score=19.41  Aligned_cols=13  Identities=38%  Similarity=0.810  Sum_probs=10.0

Q ss_pred             CCCceecCCCCCe
Q 035423            7 PGDVIQCRECGYR   19 (35)
Q Consensus         7 ~~~~irC~~CG~R   19 (35)
                      +.|.-.||.||..
T Consensus        15 ~~d~e~CP~Cgs~   27 (64)
T COG2093          15 PEDTEICPVCGST   27 (64)
T ss_pred             CCCCccCCCCCCc
Confidence            4555679999987


No 245
>PRK10445 endonuclease VIII; Provisional
Probab=43.75  E-value=27  Score=21.57  Aligned_cols=19  Identities=26%  Similarity=0.368  Sum_probs=13.0

Q ss_pred             ceecCCCCCeEEEeecCCc
Q 035423           10 VIQCRECGYRILYKKRTRR   28 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R~~~   28 (35)
                      .--||.||..|.-.+-..+
T Consensus       235 g~~Cp~Cg~~I~~~~~~gR  253 (263)
T PRK10445        235 GEACERCGGIIEKTTLSSR  253 (263)
T ss_pred             CCCCCCCCCEeEEEEECCC
Confidence            4569999999875544333


No 246
>PRK14891 50S ribosomal protein L24e/unknown domain fusion protein; Provisional
Probab=43.68  E-value=11  Score=22.23  Aligned_cols=10  Identities=30%  Similarity=0.464  Sum_probs=8.3

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      -.|.+||++|
T Consensus         5 e~CsFcG~kI   14 (131)
T PRK14891          5 RTCDYTGEEI   14 (131)
T ss_pred             eeecCcCCcc
Confidence            4699999886


No 247
>PF14996 RMP:  Retinal Maintenance
Probab=43.48  E-value=16  Score=21.78  Aligned_cols=16  Identities=25%  Similarity=0.877  Sum_probs=13.0

Q ss_pred             CCCceecCCCCCeEEE
Q 035423            7 PGDVIQCRECGYRILY   22 (35)
Q Consensus         7 ~~~~irC~~CG~RIly   22 (35)
                      .=+.+||..|-++|+.
T Consensus        65 ~C~~LrC~~CDf~V~~   80 (146)
T PF14996_consen   65 ACDNLRCTKCDFRVVR   80 (146)
T ss_pred             cCCCCEEecCCcEEEE
Confidence            3467899999999874


No 248
>cd02771 MopB_NDH-1_NuoG2-N7 MopB_NDH-1_NuoG2-N7: The second domain of the NuoG subunit (with a [4Fe-4S] cluster, N7) of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1) found in various bacteria. The NDH-1 is the first energy-transducting complex in the respiratory chain and functions as a redox pump that uses the redox energy to translocate H+ ions across the membrane, resulting in a significant contribution to energy production. In Escherichia coli NDH-1, the largest subunit is encoded by the nuoG gene, and is part of the 14 distinct subunits constituting the functional enzyme. The NuoG subunit is made of two domains: the first contains three binding sites for FeS clusters (the fer2 domain), the second domain (this CD), is of unknown function or, as postulated, has lost an ancestral formate dehydrogenase activity that became redundant during the evolution of the complex I enzyme. Unique to this group, compared to the other prokaryotic and eukaryotic groups in this domain 
Probab=43.09  E-value=35  Score=21.89  Aligned_cols=23  Identities=26%  Similarity=0.540  Sum_probs=18.4

Q ss_pred             ecCCC--CCeEEEeecCCceEEEEe
Q 035423           12 QCREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        12 rC~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      -|++|  |+-|.+..|..+++.++.
T Consensus         3 ~C~~C~~gC~i~v~v~dg~v~rv~~   27 (472)
T cd02771           3 ICHHCSVGCNISLGERYGELRRVEN   27 (472)
T ss_pred             cCcCcccCCCcEEEEECCEEEEEEC
Confidence            48888  688998888888887764


No 249
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=43.06  E-value=16  Score=24.31  Aligned_cols=13  Identities=23%  Similarity=0.680  Sum_probs=8.6

Q ss_pred             CCCceecCCCCCe
Q 035423            7 PGDVIQCRECGYR   19 (35)
Q Consensus         7 ~~~~irC~~CG~R   19 (35)
                      .....+|.+|||.
T Consensus         4 ~~~~y~C~~Cg~~   16 (454)
T TIGR00416         4 AKSKFVCQHCGAD   16 (454)
T ss_pred             CCCeEECCcCCCC
Confidence            3455778788775


No 250
>smart00355 ZnF_C2H2 zinc finger.
Probab=42.86  E-value=12  Score=13.97  Aligned_cols=8  Identities=50%  Similarity=1.236  Sum_probs=6.3

Q ss_pred             ecCCCCCe
Q 035423           12 QCRECGYR   19 (35)
Q Consensus        12 rC~~CG~R   19 (35)
                      .|+.|+..
T Consensus         2 ~C~~C~~~    9 (26)
T smart00355        2 RCPECGKV    9 (26)
T ss_pred             CCCCCcch
Confidence            68999865


No 251
>PRK06386 replication factor A; Reviewed
Probab=42.61  E-value=11  Score=24.88  Aligned_cols=11  Identities=27%  Similarity=0.573  Sum_probs=8.7

Q ss_pred             eecCCCCCeEE
Q 035423           11 IQCRECGYRIL   21 (35)
Q Consensus        11 irC~~CG~RIl   21 (35)
                      -|||+|+-.+-
T Consensus       237 ~rCP~C~R~l~  247 (358)
T PRK06386        237 TKCSVCNKIIE  247 (358)
T ss_pred             ecCcCCCeEcc
Confidence            58999987754


No 252
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=42.43  E-value=16  Score=24.14  Aligned_cols=12  Identities=33%  Similarity=1.140  Sum_probs=6.4

Q ss_pred             eecCCCCCeEEE
Q 035423           11 IQCRECGYRILY   22 (35)
Q Consensus        11 irC~~CG~RIly   22 (35)
                      .+|+.||+|..-
T Consensus       286 FkC~~C~~Rt~s  297 (344)
T PF09332_consen  286 FKCKDCGNRTIS  297 (344)
T ss_dssp             EE-T-TS-EEEE
T ss_pred             EECCCCCCeeee
Confidence            578889988653


No 253
>PF06957 COPI_C:  Coatomer (COPI) alpha subunit C-terminus;  InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.  This entry represents the C terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit [, ]. This domain is found along with the IPR006692 from INTERPRO domain. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat; PDB: 3MKR_B 3MV2_E 3MKQ_B 3MV3_A.
Probab=42.39  E-value=15  Score=24.88  Aligned_cols=13  Identities=23%  Similarity=0.746  Sum_probs=7.2

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      .+.++||+||.+-
T Consensus       378 ~~~v~CP~cgA~y  390 (422)
T PF06957_consen  378 SPSVKCPYCGAKY  390 (422)
T ss_dssp             S-EEE-TTT--EE
T ss_pred             CCCeeCCCCCCcc
Confidence            4779999999873


No 254
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=42.26  E-value=14  Score=24.42  Aligned_cols=15  Identities=40%  Similarity=1.048  Sum_probs=12.3

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      ..+.++.||.|||-.
T Consensus       205 ~k~k~~PCPKCg~et  219 (314)
T PF06524_consen  205 EKGKPIPCPKCGYET  219 (314)
T ss_pred             ccCCCCCCCCCCCcc
Confidence            456889999999973


No 255
>PRK01110 rpmF 50S ribosomal protein L32; Validated
Probab=42.16  E-value=22  Score=17.90  Aligned_cols=16  Identities=13%  Similarity=0.005  Sum_probs=10.0

Q ss_pred             cCCCCceecCCCCCeE
Q 035423            5 LKPGDVIQCRECGYRI   20 (35)
Q Consensus         5 lk~~~~irC~~CG~RI   20 (35)
                      ++.-..+.|+.||.-+
T Consensus        22 ~~~~~~~~c~~cg~~~   37 (60)
T PRK01110         22 LTAPTLSVDKTTGEYH   37 (60)
T ss_pred             ccCCceeEcCCCCcee
Confidence            3444567788887544


No 256
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=42.10  E-value=11  Score=19.40  Aligned_cols=11  Identities=27%  Similarity=0.625  Sum_probs=8.5

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      .-.||+||.-.
T Consensus        41 ~~~CPNCgGel   51 (57)
T PF06906_consen   41 NGVCPNCGGEL   51 (57)
T ss_pred             cCcCcCCCCcc
Confidence            35799999874


No 257
>PF08063 PADR1:  PADR1 (NUC008) domain;  InterPro: IPR012982 This domain is found in poly(ADP-ribose)-synthetases []. The function of this domain is unknown.; GO: 0003950 NAD+ ADP-ribosyltransferase activity, 0005634 nucleus; PDB: 2JVN_A 4DQY_E 2RIQ_A.
Probab=41.94  E-value=17  Score=17.98  Aligned_cols=17  Identities=18%  Similarity=0.632  Sum_probs=9.4

Q ss_pred             CCceecCCCCC-eEEEee
Q 035423            8 GDVIQCRECGY-RILYKK   24 (35)
Q Consensus         8 ~~~irC~~CG~-RIlyK~   24 (35)
                      +..-.||.|+. .+.|..
T Consensus        12 Gal~~Cp~C~~~~l~~~~   29 (55)
T PF08063_consen   12 GALEPCPKCKGGQLYFDG   29 (55)
T ss_dssp             TEE---SSSSE-EEEEET
T ss_pred             cCCCCCCCCCCCeEEecC
Confidence            44568999999 555543


No 258
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=41.86  E-value=14  Score=20.37  Aligned_cols=11  Identities=18%  Similarity=0.471  Sum_probs=7.7

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ...+|+.||+.
T Consensus        69 ~~~~C~~Cg~~   79 (113)
T PRK12380         69 AQAWCWDCSQV   79 (113)
T ss_pred             cEEEcccCCCE
Confidence            35778888864


No 259
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=41.77  E-value=13  Score=19.32  Aligned_cols=12  Identities=33%  Similarity=0.700  Sum_probs=9.9

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      -||||-.||.=|
T Consensus         3 iPvRCFTCGkvi   14 (62)
T PRK04016          3 IPVRCFTCGKVI   14 (62)
T ss_pred             CCeEecCCCCCh
Confidence            479999999754


No 260
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor. In the TCA cycle, OGFOR catalyzes the oxidative decarboxylation of 2-oxoglutarate to succinyl-CoA. In the reductive tricarboxylic acid cycle found in the anaerobic autotroph Hydrogenobacter thermophilus, OGFOR catalyzes the reductive carboxylation of succinyl-CoA to produce 2-oxoglutarate. Thauera aromatica OGFOR has been shown to provide reduced ferredoxin to benzoyl-CoA reductase, a key enzyme in the anaerobic metabolism of aromatic compounds. OGFOR is dependent on TPP and a divalent metal cation for activity.
Probab=41.73  E-value=3.4  Score=24.09  Aligned_cols=11  Identities=36%  Similarity=0.857  Sum_probs=9.2

Q ss_pred             cCCCCCeEEEe
Q 035423           13 CRECGYRILYK   23 (35)
Q Consensus        13 C~~CG~RIlyK   23 (35)
                      |+-||||+.|+
T Consensus         2 c~gc~~~~~~~   12 (193)
T cd03375           2 CPGCGDGSILK   12 (193)
T ss_pred             CCCCCcHHHHH
Confidence            88999998775


No 261
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=41.60  E-value=13  Score=20.29  Aligned_cols=9  Identities=44%  Similarity=1.328  Sum_probs=4.2

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      .+|+.||+.
T Consensus        71 ~~C~~Cg~~   79 (113)
T PF01155_consen   71 ARCRDCGHE   79 (113)
T ss_dssp             EEETTTS-E
T ss_pred             EECCCCCCE
Confidence            455555543


No 262
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=41.24  E-value=14  Score=21.32  Aligned_cols=9  Identities=44%  Similarity=1.423  Sum_probs=7.8

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .|+| .|||-
T Consensus        24 ~vkc-~CGh~   32 (112)
T PF08882_consen   24 VVKC-DCGHE   32 (112)
T ss_pred             eeec-cCCCe
Confidence            7999 99985


No 263
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.16  E-value=13  Score=21.80  Aligned_cols=12  Identities=25%  Similarity=0.133  Sum_probs=10.0

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      .++|-||+||..
T Consensus        24 rdPiVsPytG~s   35 (129)
T COG4530          24 RDPIVSPYTGKS   35 (129)
T ss_pred             CCccccCccccc
Confidence            578999999974


No 264
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=41.07  E-value=13  Score=19.39  Aligned_cols=9  Identities=22%  Similarity=0.353  Sum_probs=7.5

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      -.||.||..
T Consensus        18 ~~Cp~Cgs~   26 (64)
T PRK06393         18 KTCPVHGDE   26 (64)
T ss_pred             CcCCCCCCC
Confidence            389999985


No 265
>KOG2703 consensus C4-type Zn-finger protein [General function prediction only]
Probab=41.02  E-value=12  Score=25.99  Aligned_cols=10  Identities=30%  Similarity=1.042  Sum_probs=8.2

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ..-||+||++
T Consensus        68 SF~CpHCG~k   77 (460)
T KOG2703|consen   68 SFECPHCGHK   77 (460)
T ss_pred             EeecCccCCc
Confidence            4679999986


No 266
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=40.89  E-value=6.6  Score=21.74  Aligned_cols=17  Identities=18%  Similarity=0.419  Sum_probs=12.2

Q ss_pred             cccCCCCceecCCCCCe
Q 035423            3 NTLKPGDVIQCRECGYR   19 (35)
Q Consensus         3 ~~lk~~~~irC~~CG~R   19 (35)
                      .++++...-.||.||.-
T Consensus        28 ie~~q~a~y~CpfCgk~   44 (91)
T TIGR00280        28 IEIQQKAKYVCPFCGKK   44 (91)
T ss_pred             HHHHHhcCccCCCCCCC
Confidence            45566777889999853


No 267
>PHA02768 hypothetical protein; Provisional
Probab=40.82  E-value=12  Score=19.00  Aligned_cols=9  Identities=33%  Similarity=0.811  Sum_probs=6.7

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      -.|++||.+
T Consensus         6 y~C~~CGK~   14 (55)
T PHA02768          6 YECPICGEI   14 (55)
T ss_pred             cCcchhCCe
Confidence            478888876


No 268
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=40.76  E-value=13  Score=19.35  Aligned_cols=9  Identities=33%  Similarity=0.789  Sum_probs=7.2

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      -.||.||..
T Consensus        18 e~Cp~CG~~   26 (59)
T COG2260          18 EKCPVCGGD   26 (59)
T ss_pred             ccCCCCCCc
Confidence            379999976


No 269
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=40.76  E-value=12  Score=18.28  Aligned_cols=8  Identities=63%  Similarity=1.680  Sum_probs=5.8

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      -+|..|||
T Consensus         2 y~C~~Cgy    9 (50)
T cd00730           2 YECRICGY    9 (50)
T ss_pred             cCCCCCCe
Confidence            36888886


No 270
>COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown]
Probab=40.59  E-value=17  Score=25.00  Aligned_cols=16  Identities=31%  Similarity=0.800  Sum_probs=10.9

Q ss_pred             cCCCCceecCCCCCeE
Q 035423            5 LKPGDVIQCRECGYRI   20 (35)
Q Consensus         5 lk~~~~irC~~CG~RI   20 (35)
                      |..+...-||.|||.|
T Consensus        33 l~~~q~A~CPRC~~~l   48 (418)
T COG2995          33 LDSGQSAYCPRCGHTL   48 (418)
T ss_pred             CCCCCcccCCCCCCcc
Confidence            5566667777777763


No 271
>CHL00104 rpl33 ribosomal protein L33
Probab=40.48  E-value=24  Score=18.35  Aligned_cols=12  Identities=25%  Similarity=0.509  Sum_probs=10.0

Q ss_pred             cCCCCCeEEEee
Q 035423           13 CRECGYRILYKK   24 (35)
Q Consensus        13 C~~CG~RIlyK~   24 (35)
                      ||.|.-..|+|+
T Consensus        52 cp~c~kHtlhkE   63 (66)
T CHL00104         52 CPYCYKHTIHKE   63 (66)
T ss_pred             CCCCCCEeeEee
Confidence            888888888876


No 272
>PRK08116 hypothetical protein; Validated
Probab=40.33  E-value=18  Score=22.27  Aligned_cols=18  Identities=28%  Similarity=0.396  Sum_probs=12.9

Q ss_pred             CCCCceecCCCCCeEEEe
Q 035423            6 KPGDVIQCRECGYRILYK   23 (35)
Q Consensus         6 k~~~~irC~~CG~RIlyK   23 (35)
                      .......|+.||..+.++
T Consensus        12 ~~~~~~~C~~Cg~~~~~~   29 (268)
T PRK08116         12 EEDGGEYCEVCGKRIEKV   29 (268)
T ss_pred             ccccCccCcCCCCcceee
Confidence            344566799999987653


No 273
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=40.20  E-value=7.3  Score=21.51  Aligned_cols=17  Identities=24%  Similarity=0.247  Sum_probs=12.1

Q ss_pred             cccCCCCceecCCCCCe
Q 035423            3 NTLKPGDVIQCRECGYR   19 (35)
Q Consensus         3 ~~lk~~~~irC~~CG~R   19 (35)
                      .+++....-.||.||.-
T Consensus        29 ie~~q~a~y~CpfCgk~   45 (90)
T PRK03976         29 IEEKMRAKHVCPVCGRP   45 (90)
T ss_pred             HHHHHhcCccCCCCCCC
Confidence            45566777889999754


No 274
>PRK07218 replication factor A; Provisional
Probab=39.81  E-value=12  Score=25.18  Aligned_cols=10  Identities=50%  Similarity=1.042  Sum_probs=8.2

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      -|||+|+-.+
T Consensus       298 ~rCP~C~r~v  307 (423)
T PRK07218        298 ERCPECGRVI  307 (423)
T ss_pred             ecCcCccccc
Confidence            5899998775


No 275
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=39.76  E-value=16  Score=27.77  Aligned_cols=13  Identities=23%  Similarity=0.669  Sum_probs=9.9

Q ss_pred             eecCCCCCeEEEe
Q 035423           11 IQCRECGYRILYK   23 (35)
Q Consensus        11 irC~~CG~RIlyK   23 (35)
                      -+|+.||.+|+.-
T Consensus      1029 G~C~kCGg~lilT 1041 (1095)
T TIGR00354      1029 GKCLKCGNNLTLT 1041 (1095)
T ss_pred             CcccccCCeEEEE
Confidence            3688999988753


No 276
>PF11682 DUF3279:  Protein of unknown function (DUF3279);  InterPro: IPR021696  This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. 
Probab=39.70  E-value=27  Score=20.22  Aligned_cols=18  Identities=28%  Similarity=0.728  Sum_probs=15.5

Q ss_pred             CCCCceecCCCCCeEEEe
Q 035423            6 KPGDVIQCRECGYRILYK   23 (35)
Q Consensus         6 k~~~~irC~~CG~RIlyK   23 (35)
                      .+++..-|..||.++.|-
T Consensus        24 ~~~~~~tC~~Cg~~L~lh   41 (128)
T PF11682_consen   24 APYDHWTCHSCGCPLILH   41 (128)
T ss_pred             CCCCeEEEecCCceEEEe
Confidence            367889999999999886


No 277
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=39.51  E-value=17  Score=19.00  Aligned_cols=12  Identities=42%  Similarity=1.162  Sum_probs=9.7

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      .+.+-|-.|||.
T Consensus        28 ve~vECV~CGy~   39 (71)
T PF09526_consen   28 VEYVECVECGYT   39 (71)
T ss_pred             ceEEEecCCCCe
Confidence            456789999997


No 278
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional
Probab=39.44  E-value=5  Score=25.42  Aligned_cols=18  Identities=22%  Similarity=0.399  Sum_probs=13.8

Q ss_pred             CCCCceecCCCCCeEEEe
Q 035423            6 KPGDVIQCRECGYRILYK   23 (35)
Q Consensus         6 k~~~~irC~~CG~RIlyK   23 (35)
                      ...+.+-||-|||+++++
T Consensus         4 ~~~~~~~CpGCg~~~i~~   21 (280)
T PRK11869          4 EKYDIAWCPGCGNFGIRN   21 (280)
T ss_pred             ccCCCCCCcCCCCHHHHH
Confidence            456678899999987653


No 279
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg). All proteins in the FPG family with known functions are FAPY-DNA glycosylases that function in base excision repair. Homologous to endonuclease VIII (nei). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=39.34  E-value=33  Score=21.25  Aligned_cols=15  Identities=40%  Similarity=0.576  Sum_probs=11.5

Q ss_pred             ceecCCCCCeEEEee
Q 035423           10 VIQCRECGYRILYKK   24 (35)
Q Consensus        10 ~irC~~CG~RIlyK~   24 (35)
                      .--||.||..|...+
T Consensus       245 g~pC~~Cg~~I~~~~  259 (272)
T TIGR00577       245 GEPCRRCGTPIEKIK  259 (272)
T ss_pred             CCCCCCCCCeeEEEE
Confidence            446999999986544


No 280
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=39.28  E-value=14  Score=18.74  Aligned_cols=10  Identities=30%  Similarity=0.770  Sum_probs=7.0

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      -.||.||--+
T Consensus        20 ~~CPrCG~gv   29 (51)
T COG1998          20 RFCPRCGPGV   29 (51)
T ss_pred             ccCCCCCCcc
Confidence            3599999543


No 281
>COG0267 RpmG Ribosomal protein L33 [Translation, ribosomal structure and biogenesis]
Probab=39.23  E-value=25  Score=17.50  Aligned_cols=12  Identities=33%  Similarity=0.647  Sum_probs=9.1

Q ss_pred             cCCCCCeEEEee
Q 035423           13 CRECGYRILYKK   24 (35)
Q Consensus        13 C~~CG~RIlyK~   24 (35)
                      ||.|+.-+|+|+
T Consensus        37 cp~~~khtlhkE   48 (50)
T COG0267          37 CPVCRKHTLHKE   48 (50)
T ss_pred             CcccccEEEEee
Confidence            777887777775


No 282
>cd00085 HNHc HNH nucleases; HNH endonuclease signature which is found in viral, prokaryotic, and eukaryotic proteins. The alignment includes members of the large group of homing endonucleases, yeast intron 1 protein, MutS, as well as bacterial colicins, pyocins, and anaredoxins.
Probab=39.20  E-value=14  Score=16.32  Aligned_cols=10  Identities=30%  Similarity=0.414  Sum_probs=8.5

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      -+|.+||..+
T Consensus        12 ~~C~~c~~~~   21 (57)
T cd00085          12 GLCPYCGKPG   21 (57)
T ss_pred             CcCccCCCcC
Confidence            5799999876


No 283
>PLN00209 ribosomal protein S27; Provisional
Probab=39.16  E-value=18  Score=19.97  Aligned_cols=10  Identities=20%  Similarity=0.547  Sum_probs=8.0

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .|+||.|+.-
T Consensus        36 ~VkCp~C~n~   45 (86)
T PLN00209         36 DVKCQGCFNI   45 (86)
T ss_pred             EEECCCCCCe
Confidence            5899999874


No 284
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=39.15  E-value=22  Score=18.93  Aligned_cols=15  Identities=40%  Similarity=0.762  Sum_probs=12.7

Q ss_pred             cCCCCceec----CCCCCe
Q 035423            5 LKPGDVIQC----RECGYR   19 (35)
Q Consensus         5 lk~~~~irC----~~CG~R   19 (35)
                      |...++..|    +.|+|.
T Consensus        75 Lp~~~G~~C~~~~~~C~y~   93 (109)
T PF12013_consen   75 LPVYDGYRCQCDPPHCGYI   93 (109)
T ss_pred             CCCCCCeeeecCCCCCCcE
Confidence            566789999    999985


No 285
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=39.12  E-value=21  Score=19.51  Aligned_cols=13  Identities=23%  Similarity=0.542  Sum_probs=10.4

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      ..+..|.+|+++|
T Consensus        69 ~~~~~C~~C~~~V   81 (118)
T PF02318_consen   69 NRGRVCVDCKHRV   81 (118)
T ss_dssp             TTCEEETTTTEEE
T ss_pred             CCCCcCCcCCccc
Confidence            4468999999886


No 286
>PF09696 Ctf8:  Ctf8;  InterPro: IPR018607  Ctf8 (chromosome transmissions fidelity 8) is a component of the Ctf18 RFC-like complex which is a DNA clamp loader involved in sister chromatid cohesion. 
Probab=39.08  E-value=14  Score=20.71  Aligned_cols=12  Identities=33%  Similarity=0.863  Sum_probs=10.0

Q ss_pred             CCCeEEEeecCC
Q 035423           16 CGYRILYKKRTR   27 (35)
Q Consensus        16 CG~RIlyK~R~~   27 (35)
                      .-++|+||.||.
T Consensus       109 I~~KiiFk~RP~  120 (122)
T PF09696_consen  109 IRYKIIFKTRPK  120 (122)
T ss_pred             eeeeeEccCCCC
Confidence            458999999986


No 287
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=38.93  E-value=17  Score=19.44  Aligned_cols=11  Identities=36%  Similarity=0.878  Sum_probs=9.6

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      ||||=.||.=|
T Consensus         4 PVRCFTCGkvi   14 (71)
T PLN00032          4 PVRCFTCGKVI   14 (71)
T ss_pred             ceeecCCCCCc
Confidence            79999999765


No 288
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription]
Probab=38.92  E-value=51  Score=18.85  Aligned_cols=16  Identities=19%  Similarity=0.572  Sum_probs=10.4

Q ss_pred             ecCCCCCeEEEeecCC
Q 035423           12 QCRECGYRILYKKRTR   27 (35)
Q Consensus        12 rC~~CG~RIlyK~R~~   27 (35)
                      -||.||.=++++.-..
T Consensus         3 FCP~Cgn~Live~g~~   18 (105)
T KOG2906|consen    3 FCPTCGNMLIVESGES   18 (105)
T ss_pred             ccCCCCCEEEEecCCe
Confidence            3777777777765443


No 289
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=38.69  E-value=22  Score=20.78  Aligned_cols=8  Identities=38%  Similarity=0.941  Sum_probs=4.0

Q ss_pred             ceecCCCC
Q 035423           10 VIQCRECG   17 (35)
Q Consensus        10 ~irC~~CG   17 (35)
                      ...|+.||
T Consensus       309 S~~C~~cg  316 (364)
T COG0675         309 SKTCPCCG  316 (364)
T ss_pred             cccccccC
Confidence            34455555


No 290
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=38.66  E-value=15  Score=18.70  Aligned_cols=12  Identities=25%  Similarity=0.722  Sum_probs=9.1

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      .-..-||.||.-
T Consensus        12 ~v~~~Cp~cGip   23 (55)
T PF13824_consen   12 HVNFECPDCGIP   23 (55)
T ss_pred             ccCCcCCCCCCc
Confidence            445779999964


No 291
>TIGR02820 formald_GSH S-(hydroxymethyl)glutathione synthase. The formation of S-(hydroxymethyl)glutathione synthase from glutathione and formaldehyde occurs naturally, but this enzyme speeds its formation in some species as part of a pathway of formaldehyde detoxification.
Probab=38.46  E-value=14  Score=22.32  Aligned_cols=13  Identities=23%  Similarity=0.746  Sum_probs=11.0

Q ss_pred             ecCCCCCeEEEee
Q 035423           12 QCRECGYRILYKK   24 (35)
Q Consensus        12 rC~~CG~RIlyK~   24 (35)
                      -|+.||..|++..
T Consensus        91 FC~~CGS~L~~~~  103 (182)
T TIGR02820        91 ACKGCGTHMYGRI  103 (182)
T ss_pred             cCCCCCCcccccc
Confidence            3999999987765


No 292
>KOG3497 consensus DNA-directed RNA polymerase, subunit RPB10 [Transcription]
Probab=38.46  E-value=14  Score=19.67  Aligned_cols=11  Identities=45%  Similarity=0.905  Sum_probs=9.4

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      +|||-.||.-|
T Consensus         4 PiRCFtCGKvi   14 (69)
T KOG3497|consen    4 PIRCFTCGKVI   14 (69)
T ss_pred             eeEeeeccccc
Confidence            79999999765


No 293
>PRK05767 rpl44e 50S ribosomal protein L44e; Validated
Probab=38.44  E-value=23  Score=19.62  Aligned_cols=14  Identities=29%  Similarity=0.596  Sum_probs=10.8

Q ss_pred             ceecCCCCCeEEEe
Q 035423           10 VIQCRECGYRILYK   23 (35)
Q Consensus        10 ~irC~~CG~RIlyK   23 (35)
                      -.+|.+||+..+..
T Consensus        67 r~~C~~C~~~~~~~   80 (92)
T PRK05767         67 RYRCTECGKAHTRE   80 (92)
T ss_pred             EEEecccChhhccc
Confidence            46899999986654


No 294
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=38.39  E-value=18  Score=16.68  Aligned_cols=12  Identities=25%  Similarity=0.780  Sum_probs=8.1

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      -++.|+.||..-
T Consensus        12 ~~~~C~~C~~~F   23 (43)
T PF01428_consen   12 LPFKCKHCGKSF   23 (43)
T ss_dssp             SHEE-TTTS-EE
T ss_pred             CCeECCCCCccc
Confidence            589999999763


No 295
>TIGR02443 conserved hypothetical metal-binding protein. Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N-terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various Proteobacteria.
Probab=38.39  E-value=17  Score=18.80  Aligned_cols=11  Identities=45%  Similarity=1.506  Sum_probs=9.2

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      +.+-|-.|||+
T Consensus        30 e~vECv~Cg~~   40 (59)
T TIGR02443        30 ELVECVECGYQ   40 (59)
T ss_pred             eEEEeccCCCc
Confidence            45889999997


No 296
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=38.32  E-value=16  Score=21.63  Aligned_cols=13  Identities=23%  Similarity=0.578  Sum_probs=7.0

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      .-.||.||.-..+
T Consensus       136 ~F~Cp~Cg~~L~~  148 (178)
T PRK06266        136 GFRCPQCGEMLEE  148 (178)
T ss_pred             CCcCCCCCCCCee
Confidence            3456666655443


No 297
>PRK09335 30S ribosomal protein S26e; Provisional
Probab=38.24  E-value=17  Score=20.36  Aligned_cols=13  Identities=38%  Similarity=0.966  Sum_probs=10.3

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      ...|+|.+||--+
T Consensus        18 v~~V~C~nCgr~v   30 (95)
T PRK09335         18 VGYVQCDNCGRRV   30 (95)
T ss_pred             CccEEeCCCCCcC
Confidence            3579999999764


No 298
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=38.08  E-value=18  Score=22.50  Aligned_cols=13  Identities=23%  Similarity=0.299  Sum_probs=10.1

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      .--||.||..|.-
T Consensus       244 g~pCprCG~~I~~  256 (272)
T PRK14810        244 GEPCLNCKTPIRR  256 (272)
T ss_pred             CCcCCCCCCeeEE
Confidence            4569999998843


No 299
>cd02759 MopB_Acetylene-hydratase The MopB_Acetylene-hydratase CD contains acetylene hydratase (Ahy) and other related proteins. The acetylene hydratase of Pelobacter acetylenicus is a tungsten iron-sulfur protein involved in the fermentation of acetylene to ethanol and acetate. Members of this CD belong to the molybdopterin_binding (MopB) superfamily of proteins.
Probab=38.02  E-value=52  Score=21.35  Aligned_cols=23  Identities=26%  Similarity=0.634  Sum_probs=17.5

Q ss_pred             ecCCC--CCeEEEeecCCceEEEEe
Q 035423           12 QCREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        12 rC~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      -|++|  |+-|+...+..+++.++.
T Consensus         3 ~C~~C~~~C~l~v~v~~g~v~~v~g   27 (477)
T cd02759           3 TCPGCHSGCGVLVYVKDGKLVKVEG   27 (477)
T ss_pred             cCcCCcCCCCEEEEEECCEEEEEEc
Confidence            48888  567999888877777653


No 300
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=37.97  E-value=13  Score=19.99  Aligned_cols=10  Identities=30%  Similarity=0.926  Sum_probs=8.0

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .-+|+.||-.
T Consensus         8 ~~~C~~CG~d   17 (86)
T PF06170_consen    8 APRCPHCGLD   17 (86)
T ss_pred             CCcccccCCc
Confidence            3489999976


No 301
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=37.76  E-value=25  Score=18.34  Aligned_cols=12  Identities=42%  Similarity=0.949  Sum_probs=6.1

Q ss_pred             ceecCCCCCeEE
Q 035423           10 VIQCRECGYRIL   21 (35)
Q Consensus        10 ~irC~~CG~RIl   21 (35)
                      -|+||.|..+=|
T Consensus        29 iv~C~gC~~~Hl   40 (66)
T PF05180_consen   29 IVQCPGCKNRHL   40 (66)
T ss_dssp             EEE-TTS--EEE
T ss_pred             EEECCCCcceee
Confidence            378888887644


No 302
>COG2126 RPL37A Ribosomal protein L37E [Translation, ribosomal structure and biogenesis]
Probab=37.71  E-value=11  Score=19.67  Aligned_cols=17  Identities=47%  Similarity=0.966  Sum_probs=12.0

Q ss_pred             CCceecCCCCCeEEEeec
Q 035423            8 GDVIQCRECGYRILYKKR   25 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK~R   25 (35)
                      ..-++|.-||.+ -|-.+
T Consensus        14 ~tH~~CRRCGr~-syhv~   30 (61)
T COG2126          14 KTHIRCRRCGRR-SYHVR   30 (61)
T ss_pred             cceehhhhccch-heeec
Confidence            456899999987 44443


No 303
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=37.70  E-value=15  Score=23.80  Aligned_cols=7  Identities=57%  Similarity=1.787  Sum_probs=4.4

Q ss_pred             ecCCCCC
Q 035423           12 QCRECGY   18 (35)
Q Consensus        12 rC~~CG~   18 (35)
                      -||+|||
T Consensus        59 vcp~c~~   65 (296)
T CHL00174         59 ICEQCGY   65 (296)
T ss_pred             CCCCCCC
Confidence            4666666


No 304
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=37.63  E-value=18  Score=28.04  Aligned_cols=13  Identities=46%  Similarity=1.027  Sum_probs=9.9

Q ss_pred             eecCCCCCeEEEe
Q 035423           11 IQCRECGYRILYK   23 (35)
Q Consensus        11 irC~~CG~RIlyK   23 (35)
                      -+|+.||.+|+.-
T Consensus      1270 G~C~kCGg~iilT 1282 (1337)
T PRK14714       1270 GKCRKCGGRIILT 1282 (1337)
T ss_pred             CcccccCCeEEEE
Confidence            3688999988753


No 305
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family. Several related four-subunit enzymes may exist in the same species. This model describes a subfamily of beta subunits, representing mostly pyruvate and 2-ketoisovalerate specific enzymes.
Probab=37.60  E-value=4.8  Score=25.59  Aligned_cols=12  Identities=25%  Similarity=0.382  Sum_probs=9.1

Q ss_pred             eecCCCCCeEEE
Q 035423           11 IQCRECGYRILY   22 (35)
Q Consensus        11 irC~~CG~RIly   22 (35)
                      +-||-|||++++
T Consensus         2 ~~CpGCg~~~i~   13 (287)
T TIGR02177         2 DWCPGCGDFGIL   13 (287)
T ss_pred             CcCCCCCChHHH
Confidence            469999996543


No 306
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=37.47  E-value=21  Score=18.08  Aligned_cols=12  Identities=25%  Similarity=0.562  Sum_probs=7.2

Q ss_pred             eecCCCCCeEEE
Q 035423           11 IQCRECGYRILY   22 (35)
Q Consensus        11 irC~~CG~RIly   22 (35)
                      -.||+|...|=.
T Consensus        56 G~CP~C~~~i~~   67 (70)
T PF11793_consen   56 GECPYCSSPISW   67 (70)
T ss_dssp             EE-TTT-SEEEG
T ss_pred             cCCcCCCCeeeE
Confidence            469999988743


No 307
>COG1552 RPL40A Ribosomal protein L40E [Translation, ribosomal structure and biogenesis]
Probab=37.42  E-value=9.9  Score=19.20  Aligned_cols=16  Identities=44%  Similarity=1.138  Sum_probs=12.8

Q ss_pred             CCCCceecCCCCCeEE
Q 035423            6 KPGDVIQCRECGYRIL   21 (35)
Q Consensus         6 k~~~~irC~~CG~RIl   21 (35)
                      .+-+..+|+.|||.=|
T Consensus        24 np~~A~kCRkC~~k~L   39 (50)
T COG1552          24 NPPRATKCRKCGYKNL   39 (50)
T ss_pred             CCcchhHHhhccCCCc
Confidence            4567789999999855


No 308
>PF01283 Ribosomal_S26e:  Ribosomal protein S26e;  InterPro: IPR000892 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic ribosomal proteins can be grouped on the basis of sequence similarities. One of these families, the S26E family, includes mammalian S26 []; Octopus S26 []; Drosophila S26 (DS31) []; plant cytoplasmic S26; and fungal S26 []. These proteins have 114 to 127 amino acids.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3U5G_a 3U5C_a 2XZM_5 2XZN_5.
Probab=37.15  E-value=20  Score=20.56  Aligned_cols=13  Identities=23%  Similarity=0.761  Sum_probs=7.8

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      ...|+|.+||.-+
T Consensus        18 v~~V~C~nCgr~v   30 (113)
T PF01283_consen   18 VQPVRCDNCGRCV   30 (113)
T ss_dssp             --EEE-TTTB-EE
T ss_pred             CcCEeeCcccccC
Confidence            3579999999875


No 309
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=37.06  E-value=31  Score=15.83  Aligned_cols=14  Identities=21%  Similarity=0.423  Sum_probs=8.3

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      ...+.+|..|+..+
T Consensus        25 ~~~g~~C~~C~~~~   38 (53)
T PF00130_consen   25 GKQGYRCSWCGLVC   38 (53)
T ss_dssp             SSCEEEETTTT-EE
T ss_pred             CCCeEEECCCCChH
Confidence            45567777777653


No 310
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=37.03  E-value=15  Score=20.89  Aligned_cols=13  Identities=23%  Similarity=0.669  Sum_probs=9.7

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      ..-||.|||--+-
T Consensus        22 ~FtCp~Cghe~vs   34 (104)
T COG4888          22 TFTCPRCGHEKVS   34 (104)
T ss_pred             eEecCccCCeeee
Confidence            3679999997543


No 311
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.82  E-value=11  Score=20.11  Aligned_cols=15  Identities=33%  Similarity=0.662  Sum_probs=11.9

Q ss_pred             CceecCCCCCeEEEe
Q 035423            9 DVIQCRECGYRILYK   23 (35)
Q Consensus         9 ~~irC~~CG~RIlyK   23 (35)
                      -...|++|.+||--|
T Consensus        30 rtymC~eC~~Rva~k   44 (68)
T COG4896          30 RTYMCPECEHRVAIK   44 (68)
T ss_pred             eeEechhhHhhhchh
Confidence            345799999998766


No 312
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=36.80  E-value=18  Score=22.47  Aligned_cols=15  Identities=27%  Similarity=0.361  Sum_probs=11.1

Q ss_pred             ceecCCCCCeEEEee
Q 035423           10 VIQCRECGYRILYKK   24 (35)
Q Consensus        10 ~irC~~CG~RIlyK~   24 (35)
                      .--||.||..|.-.+
T Consensus       235 g~pC~~Cg~~I~~~~  249 (269)
T PRK14811        235 GQPCPRCGTPIEKIV  249 (269)
T ss_pred             cCCCCcCCCeeEEEE
Confidence            345999999986544


No 313
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=36.62  E-value=12  Score=22.45  Aligned_cols=12  Identities=33%  Similarity=0.495  Sum_probs=0.0

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      .-+.||.||-.|
T Consensus       167 ~~~~cPitGe~I  178 (229)
T PF12230_consen  167 KMIICPITGEMI  178 (229)
T ss_dssp             ------------
T ss_pred             cccccccccccc
Confidence            458999999876


No 314
>PF13575 DUF4135:  Domain of unknown function (DUF4135)
Probab=36.55  E-value=23  Score=22.52  Aligned_cols=12  Identities=42%  Similarity=0.764  Sum_probs=9.8

Q ss_pred             CCCeEEEeecCC
Q 035423           16 CGYRILYKKRTR   27 (35)
Q Consensus        16 CG~RIlyK~R~~   27 (35)
                      -|.+|+||.|+-
T Consensus        69 ~g~kivYKPRsl   80 (370)
T PF13575_consen   69 SGKKIVYKPRSL   80 (370)
T ss_pred             CCCEEEEeCccc
Confidence            467999999974


No 315
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=36.49  E-value=16  Score=21.19  Aligned_cols=9  Identities=33%  Similarity=0.959  Sum_probs=7.4

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      -.||.||.-
T Consensus        50 t~CP~Cg~~   58 (115)
T COG1885          50 TSCPKCGEP   58 (115)
T ss_pred             ccCCCCCCc
Confidence            579999974


No 316
>PRK05320 rhodanese superfamily protein; Provisional
Probab=36.40  E-value=23  Score=21.94  Aligned_cols=18  Identities=22%  Similarity=0.388  Sum_probs=14.0

Q ss_pred             cccCCCCceecCCCCCeE
Q 035423            3 NTLKPGDVIQCRECGYRI   20 (35)
Q Consensus         3 ~~lk~~~~irC~~CG~RI   20 (35)
                      ..++++....|..||+.+
T Consensus       237 ~~~~~~~~~~c~~c~~~~  254 (257)
T PRK05320        237 PQLAPLVDVTCFACRAVV  254 (257)
T ss_pred             CCCccCccceecCCCCcC
Confidence            456777778899999864


No 317
>PF01125 G10:  G10 protein;  InterPro: IPR001748 A Xenopus protein known as G10 [] has been found to be highly conserved in a wide range of eukaryotic species. The function of G10 is still unknown. G10 is a protein of about 17 to 18 kDa (143 to 157 residues) which is hydrophilic and whose C-terminal half is rich in cysteines and could be involved in metal-binding.; GO: 0005634 nucleus
Probab=36.10  E-value=17  Score=21.55  Aligned_cols=16  Identities=31%  Similarity=0.868  Sum_probs=12.4

Q ss_pred             ccCCCCceecCCCCCe
Q 035423            4 TLKPGDVIQCRECGYR   19 (35)
Q Consensus         4 ~lk~~~~irC~~CG~R   19 (35)
                      ++..+..+.|..||++
T Consensus       126 ~l~~~~~~~c~~CGC~  141 (145)
T PF01125_consen  126 KLEEKQFVECVHCGCR  141 (145)
T ss_pred             HhccCcccccCCCCCC
Confidence            3555677899999986


No 318
>PF10005 DUF2248:  Uncharacterized protein conserved in bacteria (DUF2248);  InterPro: IPR011201 This is a family of uncharacterised bacterial proteins.
Probab=36.04  E-value=19  Score=24.00  Aligned_cols=11  Identities=27%  Similarity=1.132  Sum_probs=6.8

Q ss_pred             ecCCCCCeEEE
Q 035423           12 QCRECGYRILY   22 (35)
Q Consensus        12 rC~~CG~RIly   22 (35)
                      .|+.||..+.|
T Consensus         1 ~C~~Cg~~v~F   11 (343)
T PF10005_consen    1 SCPNCGQPVFF   11 (343)
T ss_pred             CCCCCCCccee
Confidence            36677766554


No 319
>PRK04023 DNA polymerase II large subunit; Validated
Probab=35.96  E-value=23  Score=27.08  Aligned_cols=13  Identities=23%  Similarity=0.741  Sum_probs=9.8

Q ss_pred             eecCCCCCeEEEe
Q 035423           11 IQCRECGYRILYK   23 (35)
Q Consensus        11 irC~~CG~RIlyK   23 (35)
                      -+|+.||.+|+.-
T Consensus      1054 G~C~kCGg~lilT 1066 (1121)
T PRK04023       1054 GKCPKCGGNLILT 1066 (1121)
T ss_pred             CcCccCCCeEEEE
Confidence            3688899888753


No 320
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=35.56  E-value=17  Score=18.40  Aligned_cols=10  Identities=30%  Similarity=0.640  Sum_probs=6.9

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ...||.||-.
T Consensus        17 k~~CP~CG~~   26 (56)
T PRK13130         17 KEICPVCGGK   26 (56)
T ss_pred             cccCcCCCCC
Confidence            4568888854


No 321
>COG5525 Bacteriophage tail assembly protein [General function prediction only]
Probab=35.45  E-value=19  Score=25.81  Aligned_cols=9  Identities=33%  Similarity=1.099  Sum_probs=6.1

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      +.||+||+.
T Consensus       228 vpCPHCGe~  236 (611)
T COG5525         228 VPCPHCGEE  236 (611)
T ss_pred             eeCCCCCch
Confidence            567777765


No 322
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=35.37  E-value=43  Score=15.56  Aligned_cols=17  Identities=24%  Similarity=0.661  Sum_probs=9.6

Q ss_pred             CCCceecCCCCCeEEEe
Q 035423            7 PGDVIQCRECGYRILYK   23 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK   23 (35)
                      ...-.+|..||.=|..-
T Consensus         3 ~~~~YkC~~CGniVev~   19 (36)
T PF06397_consen    3 KGEFYKCEHCGNIVEVV   19 (36)
T ss_dssp             TTEEEE-TTT--EEEEE
T ss_pred             cccEEEccCCCCEEEEE
Confidence            45567999999876543


No 323
>COG1468 CRISPR-associated protein Cas4 (RecB family exonuclease) [Defense    mechanisms]
Probab=35.20  E-value=31  Score=20.67  Aligned_cols=19  Identities=26%  Similarity=0.667  Sum_probs=15.0

Q ss_pred             cCCCCceecCCCCCeEEEe
Q 035423            5 LKPGDVIQCRECGYRILYK   23 (35)
Q Consensus         5 lk~~~~irC~~CG~RIlyK   23 (35)
                      ..+..+-+|..|+++-+.+
T Consensus       169 p~~~~~~~C~~C~y~~iC~  187 (190)
T COG1468         169 PPPKKKKKCKKCAYREICF  187 (190)
T ss_pred             CCCCCCCcCCCCCcceecc
Confidence            4566788999999997754


No 324
>PLN03166 60S ribosomal protein L34; Provisional
Probab=35.19  E-value=23  Score=19.65  Aligned_cols=15  Identities=33%  Similarity=0.452  Sum_probs=11.4

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      |....-+|..||-++
T Consensus        37 K~~~~pkC~~cg~~L   51 (96)
T PLN03166         37 KRASGPKCPVTGKRI   51 (96)
T ss_pred             cCCCCCcCCCCCCcc
Confidence            455677899999874


No 325
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=34.78  E-value=24  Score=15.63  Aligned_cols=12  Identities=17%  Similarity=0.551  Sum_probs=9.2

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+.+|..|+..
T Consensus        26 ~~~~~C~~C~~~   37 (50)
T cd00029          26 KQGLRCSWCKVK   37 (50)
T ss_pred             cceeEcCCCCCc
Confidence            467889888865


No 326
>PTZ00172 40S ribosomal protein S26; Provisional
Probab=34.47  E-value=21  Score=20.44  Aligned_cols=13  Identities=23%  Similarity=0.754  Sum_probs=10.2

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      ...|+|.+||--+
T Consensus        18 v~~V~C~nCgr~v   30 (108)
T PTZ00172         18 VKPVRCSNCGRCV   30 (108)
T ss_pred             CccEEeCCccccc
Confidence            3579999999754


No 327
>PTZ00083 40S ribosomal protein S27; Provisional
Probab=34.42  E-value=23  Score=19.45  Aligned_cols=10  Identities=20%  Similarity=0.644  Sum_probs=7.9

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .|+||.|+.-
T Consensus        35 ~VkCp~C~n~   44 (85)
T PTZ00083         35 DVKCPGCSQI   44 (85)
T ss_pred             EEECCCCCCe
Confidence            5889999864


No 328
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=34.39  E-value=20  Score=16.67  Aligned_cols=9  Identities=33%  Similarity=0.700  Sum_probs=6.9

Q ss_pred             ceecCCCCC
Q 035423           10 VIQCRECGY   18 (35)
Q Consensus        10 ~irC~~CG~   18 (35)
                      ..-||.||-
T Consensus         3 ~~pCP~CGG   11 (37)
T smart00778        3 HGPCPNCGG   11 (37)
T ss_pred             ccCCCCCCC
Confidence            356999986


No 329
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=34.36  E-value=44  Score=14.04  Aligned_cols=11  Identities=27%  Similarity=0.461  Sum_probs=5.3

Q ss_pred             ecCCCCCeEEE
Q 035423           12 QCRECGYRILY   22 (35)
Q Consensus        12 rC~~CG~RIly   22 (35)
                      .|+-||.-|.=
T Consensus         3 ~C~rC~~~~~~   13 (30)
T PF06827_consen    3 KCPRCWNYIED   13 (30)
T ss_dssp             B-TTT--BBEE
T ss_pred             cCccCCCcceE
Confidence            68888877543


No 330
>PF03691 UPF0167:  Uncharacterised protein family (UPF0167);  InterPro: IPR005363 The proteins in this family are about 200 amino acids long and each contain 3 CXXC motifs.
Probab=34.23  E-value=30  Score=20.90  Aligned_cols=13  Identities=38%  Similarity=1.025  Sum_probs=11.2

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      .-||.+||...||
T Consensus       160 lFrClhCgk~~l~  172 (176)
T PF03691_consen  160 LFRCLHCGKHRLY  172 (176)
T ss_pred             EEEcCcCCcEEEE
Confidence            4699999998887


No 331
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=34.01  E-value=19  Score=23.32  Aligned_cols=10  Identities=20%  Similarity=0.737  Sum_probs=7.7

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      -++|++||..
T Consensus       224 R~~C~~Cg~~  233 (305)
T TIGR01562       224 RVKCSHCEES  233 (305)
T ss_pred             CccCCCCCCC
Confidence            4789999973


No 332
>COG1773 Rubredoxin [Energy production and conversion]
Probab=33.90  E-value=18  Score=18.35  Aligned_cols=8  Identities=50%  Similarity=1.456  Sum_probs=4.9

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      -+|..|||
T Consensus         4 ~~C~~CG~   11 (55)
T COG1773           4 WRCSVCGY   11 (55)
T ss_pred             eEecCCce
Confidence            45666665


No 333
>PF11648 RIG-I_C-RD:  C-terminal domain of RIG-I;  InterPro: IPR021673  This family of proteins represents the regulatory domain RD of RIG-I, a protein which initiates a signalling cascade that provides essential antiviral protection for the host. The RD domain binds viral RNA, activating the RIG-I ATPase by RNA-dependent dimerisation. The structure of RD contains a zinc-binding domain and is thought to confer ligand specificity []. ; GO: 0016817 hydrolase activity, acting on acid anhydrides; PDB: 2RQB_A 3GA3_A 2W4R_D 3EQT_A 2RQA_A 2RMJ_A 3NCU_A 2QFD_C 2QFB_D 3TMI_A ....
Probab=33.87  E-value=16  Score=20.49  Aligned_cols=15  Identities=33%  Similarity=0.962  Sum_probs=11.6

Q ss_pred             cCCCCceecCCCCCe
Q 035423            5 LKPGDVIQCRECGYR   19 (35)
Q Consensus         5 lk~~~~irC~~CG~R   19 (35)
                      ..++..|.|..||+.
T Consensus        55 ~~~~~~I~C~~C~~~   69 (123)
T PF11648_consen   55 WEPNGKIHCKNCGQD   69 (123)
T ss_dssp             SEEEEEEEETSTSBE
T ss_pred             eEeCCEEEcCCCChH
Confidence            345567999999986


No 334
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=33.79  E-value=16  Score=18.55  Aligned_cols=16  Identities=19%  Similarity=0.426  Sum_probs=11.9

Q ss_pred             CCCceecCCCCCeEEE
Q 035423            7 PGDVIQCRECGYRILY   22 (35)
Q Consensus         7 ~~~~irC~~CG~RIly   22 (35)
                      ..+.-.|+-||.+|..
T Consensus        75 i~~~~~C~vC~k~l~~   90 (109)
T PF10367_consen   75 ITESTKCSVCGKPLGN   90 (109)
T ss_pred             ECCCCCccCcCCcCCC
Confidence            3456679999999754


No 335
>PF14319 Zn_Tnp_IS91:  Transposase zinc-binding domain
Probab=33.55  E-value=24  Score=19.38  Aligned_cols=15  Identities=20%  Similarity=0.534  Sum_probs=10.5

Q ss_pred             CCCceecCCCCCeEE
Q 035423            7 PGDVIQCRECGYRIL   21 (35)
Q Consensus         7 ~~~~irC~~CG~RIl   21 (35)
                      .+...+|+.||+.-+
T Consensus        39 G~~~~~C~~Cg~~~~   53 (111)
T PF14319_consen   39 GFHRYRCEDCGHEKI   53 (111)
T ss_pred             CcceeecCCCCceEE
Confidence            345678999998643


No 336
>TIGR02652 conserved hypothetical protein TIGR02652, cyanobacterial. Members of this family of conserved hypothetical proteins are found, so far, only in the Cyanobacteria. Members are about 170 amino acids long and share a motif CxxCx(14)CxxH near the amino end.
Probab=33.50  E-value=14  Score=22.43  Aligned_cols=14  Identities=36%  Similarity=0.710  Sum_probs=10.8

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      -+..|.||+|.--|
T Consensus         6 FGpei~CPhCRQ~i   19 (163)
T TIGR02652         6 FGPEIRCPHCRQNI   19 (163)
T ss_pred             cCCcCcCchhhccc
Confidence            36789999997654


No 337
>PF08295 Sin3_corepress:  Sin3 family co-repressor;  InterPro: IPR013194 This domain is found on transcriptional regulators. It forms interactions with histone deacetylases [].
Probab=33.46  E-value=13  Score=20.62  Aligned_cols=14  Identities=50%  Similarity=1.160  Sum_probs=10.5

Q ss_pred             ecCCCC--CeEEEeec
Q 035423           12 QCRECG--YRILYKKR   25 (35)
Q Consensus        12 rC~~CG--~RIlyK~R   25 (35)
                      .|..||  ||.|-|.=
T Consensus         1 ~c~~~gpSYr~LP~~~   16 (101)
T PF08295_consen    1 NCERCGPSYRLLPKSY   16 (101)
T ss_pred             CCCcCccchhhCCccc
Confidence            388999  88886643


No 338
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=33.37  E-value=19  Score=16.96  Aligned_cols=8  Identities=38%  Similarity=0.721  Sum_probs=4.1

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      .-||.||-
T Consensus         4 ~pCP~CGG   11 (40)
T PF08273_consen    4 GPCPICGG   11 (40)
T ss_dssp             E--TTTT-
T ss_pred             CCCCCCcC
Confidence            45999985


No 339
>PLN00186 ribosomal protein S26; Provisional
Probab=33.18  E-value=23  Score=20.32  Aligned_cols=13  Identities=31%  Similarity=0.764  Sum_probs=10.1

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      -..|+|.+||--+
T Consensus        18 v~~V~C~nCgr~v   30 (109)
T PLN00186         18 VKRIRCSNCGKCV   30 (109)
T ss_pred             CcceeeCCCcccc
Confidence            3579999999753


No 340
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=33.18  E-value=21  Score=15.15  Aligned_cols=10  Identities=30%  Similarity=0.750  Sum_probs=8.3

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      +.||-|+..+
T Consensus         2 v~CPiC~~~v   11 (26)
T smart00734        2 VQCPVCFREV   11 (26)
T ss_pred             CcCCCCcCcc
Confidence            5799999875


No 341
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=33.05  E-value=18  Score=21.88  Aligned_cols=10  Identities=30%  Similarity=0.806  Sum_probs=8.2

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      ..||+|++.|
T Consensus        40 ~~Cp~C~~~I   49 (158)
T PF10083_consen   40 TSCPNCSTPI   49 (158)
T ss_pred             HHCcCCCCCC
Confidence            4699999876


No 342
>PRK04059 rpl34e 50S ribosomal protein L34e; Validated
Probab=32.98  E-value=26  Score=19.20  Aligned_cols=15  Identities=27%  Similarity=0.592  Sum_probs=11.3

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      +....-+|..||.++
T Consensus        30 K~~~~pkC~~c~~~L   44 (88)
T PRK04059         30 KKPSKAKCAICGKPL   44 (88)
T ss_pred             cCCCCCcCCCCCCcc
Confidence            455667899999874


No 343
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=32.95  E-value=36  Score=19.32  Aligned_cols=9  Identities=33%  Similarity=1.029  Sum_probs=6.8

Q ss_pred             cCCCCCeEE
Q 035423           13 CRECGYRIL   21 (35)
Q Consensus        13 C~~CG~RIl   21 (35)
                      ||-||....
T Consensus         1 CPvCg~~l~    9 (113)
T PF09862_consen    1 CPVCGGELV    9 (113)
T ss_pred             CCCCCCceE
Confidence            888887754


No 344
>PRK14715 DNA polymerase II large subunit; Provisional
Probab=32.69  E-value=27  Score=27.67  Aligned_cols=13  Identities=23%  Similarity=0.856  Sum_probs=10.2

Q ss_pred             eecCCCCCeEEEe
Q 035423           11 IQCRECGYRILYK   23 (35)
Q Consensus        11 irC~~CG~RIlyK   23 (35)
                      -+||.||.+|+.-
T Consensus      1558 G~C~kCGg~~ilT 1570 (1627)
T PRK14715       1558 GKCPKCGSKLILT 1570 (1627)
T ss_pred             CcCcccCCeEEEE
Confidence            4799999998753


No 345
>COG3791 Uncharacterized conserved protein [Function unknown]
Probab=32.50  E-value=31  Score=19.28  Aligned_cols=16  Identities=19%  Similarity=0.590  Sum_probs=12.5

Q ss_pred             eecCCCCCeEEEeecC
Q 035423           11 IQCRECGYRILYKKRT   26 (35)
Q Consensus        11 irC~~CG~RIlyK~R~   26 (35)
                      .-|+.||....+.-..
T Consensus        70 ~FC~~CGs~l~~~~~~   85 (133)
T COG3791          70 GFCPTCGSPLFWRGPD   85 (133)
T ss_pred             eecccCCCceEEecCC
Confidence            3799999998777444


No 346
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=32.42  E-value=26  Score=19.87  Aligned_cols=12  Identities=25%  Similarity=0.631  Sum_probs=8.8

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ...-+|+.||..
T Consensus       127 ~~~~~C~~C~~~  138 (178)
T PF02146_consen  127 EEPPRCPKCGGL  138 (178)
T ss_dssp             TSSCBCTTTSCB
T ss_pred             cccccccccCcc
Confidence            344589999985


No 347
>PRK00504 rpmG 50S ribosomal protein L33; Validated
Probab=32.30  E-value=41  Score=16.54  Aligned_cols=12  Identities=33%  Similarity=0.750  Sum_probs=8.3

Q ss_pred             cCCCCCeEEEee
Q 035423           13 CRECGYRILYKK   24 (35)
Q Consensus        13 C~~CG~RIlyK~   24 (35)
                      ||.|+-..|+|+
T Consensus        37 cp~c~khtlhkE   48 (50)
T PRK00504         37 CPRCNKHTLHKE   48 (50)
T ss_pred             CCCCCCeEeeee
Confidence            677777777665


No 348
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=32.25  E-value=21  Score=16.73  Aligned_cols=8  Identities=50%  Similarity=1.124  Sum_probs=5.2

Q ss_pred             cCCCCCeE
Q 035423           13 CRECGYRI   20 (35)
Q Consensus        13 C~~CG~RI   20 (35)
                      |.+||.-|
T Consensus         1 Cd~CG~~I    8 (37)
T PF08394_consen    1 CDYCGGEI    8 (37)
T ss_pred             CCccCCcc
Confidence            67787543


No 349
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=32.24  E-value=6.9  Score=21.60  Aligned_cols=17  Identities=18%  Similarity=0.378  Sum_probs=10.9

Q ss_pred             ccCCCCceecCCCCCeE
Q 035423            4 TLKPGDVIQCRECGYRI   20 (35)
Q Consensus         4 ~lk~~~~irC~~CG~RI   20 (35)
                      +++....-.||.||.--
T Consensus        29 e~~q~~ky~Cp~Cgk~~   45 (90)
T PF01780_consen   29 EISQHAKYTCPFCGKTS   45 (90)
T ss_dssp             HHHHHS-BEESSSSSSE
T ss_pred             HHHHhCCCcCCCCCCce
Confidence            34445567899998765


No 350
>COG4830 RPS26B Ribosomal protein S26 [Translation, ribosomal structure and biogenesis]
Probab=32.22  E-value=22  Score=20.43  Aligned_cols=12  Identities=25%  Similarity=0.960  Sum_probs=10.0

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      ..|+|-+||..+
T Consensus        19 ~~v~CdnCg~~v   30 (108)
T COG4830          19 KYVRCDNCGKAV   30 (108)
T ss_pred             cceeeccccccC
Confidence            469999999874


No 351
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=31.99  E-value=22  Score=14.75  Aligned_cols=10  Identities=20%  Similarity=0.368  Sum_probs=6.1

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ..+||.|+..
T Consensus        35 ~~~Cp~C~~~   44 (45)
T cd00162          35 KNTCPLCRTP   44 (45)
T ss_pred             cCCCCCCCCc
Confidence            4567777643


No 352
>PF14149 YhfH:  YhfH-like protein
Probab=31.72  E-value=6.1  Score=18.76  Aligned_cols=15  Identities=33%  Similarity=0.658  Sum_probs=10.4

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      +..+.-.|++||.-|
T Consensus         9 rnLp~K~C~~CG~~i   23 (37)
T PF14149_consen    9 RNLPPKKCTECGKEI   23 (37)
T ss_pred             HhCCCcccHHHHHHH
Confidence            345566899999654


No 353
>PF11290 DUF3090:  Protein of unknown function (DUF3090);  InterPro: IPR021441  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=31.67  E-value=21  Score=21.77  Aligned_cols=9  Identities=33%  Similarity=0.922  Sum_probs=7.1

Q ss_pred             ecCCCCCeE
Q 035423           12 QCRECGYRI   20 (35)
Q Consensus        12 rC~~CG~RI   20 (35)
                      .||.||.-|
T Consensus       156 ~CPlCg~Pl  164 (171)
T PF11290_consen  156 PCPLCGEPL  164 (171)
T ss_pred             CCCCCCCCC
Confidence            599999763


No 354
>PHA02942 putative transposase; Provisional
Probab=31.64  E-value=28  Score=22.77  Aligned_cols=10  Identities=40%  Similarity=1.271  Sum_probs=6.1

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ...|+.||+.
T Consensus       342 ~f~C~~CG~~  351 (383)
T PHA02942        342 YFHCPSCGYE  351 (383)
T ss_pred             EEECCCCCCE
Confidence            4566666664


No 355
>PF12322 T4_baseplate:  T4 bacteriophage base plate protein;  InterPro: IPR024364 Proteins in this family are found in T4-like viruses. They have a single completely conserved residue S that may be functionally important. The family includes the two base plate proteins from bacteriophage T4: Gp51 and Gp26, encoded by late genes []. Gp26 is a structural component of central hub of the baseplate. It associates with Gp25 (tail lysozyme) in the assembly process. Gp51 is essential for the formation of the central hub of the phage baseplate, playing a catalytic role for the central hub formation. It may be also a structural component of the hub.
Probab=31.49  E-value=23  Score=21.54  Aligned_cols=12  Identities=25%  Similarity=0.789  Sum_probs=9.0

Q ss_pred             CCCceecCCCCCe
Q 035423            7 PGDVIQCRECGYR   19 (35)
Q Consensus         7 ~~~~irC~~CG~R   19 (35)
                      ..-+|+| +||+.
T Consensus       181 ~~v~vkC-~cg~~  192 (205)
T PF12322_consen  181 HAVPVKC-KCGKE  192 (205)
T ss_pred             EEEEEee-cCCcc
Confidence            3447899 99975


No 356
>TIGR00269 conserved hypothetical protein TIGR00269.
Probab=31.47  E-value=23  Score=19.02  Aligned_cols=11  Identities=36%  Similarity=0.981  Sum_probs=8.7

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      +.-+|..||+-
T Consensus        79 ~~~~C~~CG~p   89 (104)
T TIGR00269        79 DLRRCERCGEP   89 (104)
T ss_pred             cCCcCCcCcCc
Confidence            45789999974


No 357
>PRK03954 ribonuclease P protein component 4; Validated
Probab=31.47  E-value=26  Score=20.02  Aligned_cols=11  Identities=55%  Similarity=0.936  Sum_probs=8.8

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      -.+.|-+||+-
T Consensus        92 vvitCl~CG~~  102 (121)
T PRK03954         92 VVITCLECGHI  102 (121)
T ss_pred             EEEECccCCCE
Confidence            35789999984


No 358
>PRK08665 ribonucleotide-diphosphate reductase subunit alpha; Validated
Probab=31.23  E-value=25  Score=25.14  Aligned_cols=13  Identities=31%  Similarity=0.572  Sum_probs=9.8

Q ss_pred             eecCCCCCeEEEe
Q 035423           11 IQCRECGYRILYK   23 (35)
Q Consensus        11 irC~~CG~RIlyK   23 (35)
                      ..||+||..+.|.
T Consensus       725 ~~Cp~Cg~~l~~~  737 (752)
T PRK08665        725 GACPECGSILEHE  737 (752)
T ss_pred             CCCCCCCcccEEC
Confidence            4799999876653


No 359
>TIGR01054 rgy reverse gyrase. Generally, these gyrases are encoded as a single polypeptide. An exception was found in Methanopyrus kandleri, where enzyme is split within the topoisomerase domain, yielding a heterodimer of gene products designated RgyB and RgyA.
Probab=31.21  E-value=21  Score=26.70  Aligned_cols=12  Identities=33%  Similarity=0.606  Sum_probs=9.1

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      -.-.||+||..|
T Consensus         6 y~~~CPnCgg~i   17 (1171)
T TIGR01054         6 YSNLCPNCGGEI   17 (1171)
T ss_pred             hcCCCCCCCCcc
Confidence            345799999874


No 360
>PTZ00157 60S ribosomal protein L36a; Provisional
Probab=31.14  E-value=34  Score=18.75  Aligned_cols=13  Identities=15%  Similarity=0.524  Sum_probs=10.3

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      -.+|.+||+..+.
T Consensus        69 rl~C~~C~~~~~~   81 (84)
T PTZ00157         69 KLECTKCKSKRQK   81 (84)
T ss_pred             EEEecccCceeEe
Confidence            4689999998663


No 361
>PF09814 HECT_2:  HECT-like Ubiquitin-conjugating enzyme (E2)-binding;  InterPro: IPR019193 This entry consists of E3 ubiquitin-protein ligases which accept ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfer it to substrates, generally promoting their degradation by the proteasome [].
Probab=31.03  E-value=30  Score=21.50  Aligned_cols=17  Identities=29%  Similarity=0.735  Sum_probs=13.2

Q ss_pred             cCCCC-ceecCCCCCeEE
Q 035423            5 LKPGD-VIQCRECGYRIL   21 (35)
Q Consensus         5 lk~~~-~irC~~CG~RIl   21 (35)
                      ++... .+.|..|+..|+
T Consensus       100 l~~~~~~~~C~~C~~~li  117 (354)
T PF09814_consen  100 LKSESFSLCCRNCKNPLI  117 (354)
T ss_pred             hcCCceEEECCCCCCccc
Confidence            44445 799999999975


No 362
>PF06769 Plasmid_Txe:  Plasmid encoded toxin Txe;  InterPro: IPR009614 The Axe-Txe pair in Enterococcus faecium (Streptococcus faecium) and the homologous YefM-YoeB pair in Escherichia coli have been shown to act as an antitoxin-toxin pair. This family describes the toxin component. Nearly every example found is next to an identifiable antitoxin, as indicated by match to IPR006442 from INTERPRO [].; GO: 0004519 endonuclease activity, 0006401 RNA catabolic process; PDB: 3OEI_L 2A6R_F 2A6Q_E 2A6S_D.
Probab=30.90  E-value=74  Score=16.83  Aligned_cols=19  Identities=21%  Similarity=0.352  Sum_probs=13.5

Q ss_pred             CCeEEEeecCCceEEEEeC
Q 035423           17 GYRILYKKRTRRIVQYEAR   35 (35)
Q Consensus        17 G~RIlyK~R~~~~~~~~Ar   35 (35)
                      .||++|+.-...+.-+.|+
T Consensus        59 ~hRLVY~v~~~~i~I~s~~   77 (80)
T PF06769_consen   59 KHRLVYEVDDDTITILSCR   77 (80)
T ss_dssp             SEEEEEEEESSEEEEEESS
T ss_pred             CceEEEEEeCCEEEEEEee
Confidence            5899999976666555543


No 363
>TIGR00598 rad14 DNA repair protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=30.89  E-value=37  Score=20.66  Aligned_cols=12  Identities=33%  Similarity=0.863  Sum_probs=10.2

Q ss_pred             eecCCCCCeEEE
Q 035423           11 IQCRECGYRILY   22 (35)
Q Consensus        11 irC~~CG~RIly   22 (35)
                      -+|..||+.+=|
T Consensus       158 k~C~~Cg~e~~~  169 (172)
T TIGR00598       158 RTCTTCGLEETY  169 (172)
T ss_pred             eecCCCCceEEE
Confidence            579999999866


No 364
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed
Probab=30.89  E-value=6.8  Score=24.67  Aligned_cols=15  Identities=20%  Similarity=0.443  Sum_probs=11.2

Q ss_pred             CCceecCCCCCeEEE
Q 035423            8 GDVIQCRECGYRILY   22 (35)
Q Consensus         8 ~~~irC~~CG~RIly   22 (35)
                      ..+.-||-||+.+++
T Consensus        15 ~~~~~CpGCg~~~il   29 (286)
T PRK11867         15 QEPRWCPGCGDGSIL   29 (286)
T ss_pred             CCCCcCCCCCCHHHH
Confidence            345689999998654


No 365
>cd02750 MopB_Nitrate-R-NarG-like Respiratory nitrate reductase A (NarGHI), alpha chain (NarG) and related proteins. Under anaerobic conditions in the presence of nitrate, E. coli synthesizes the cytoplasmic membrane-bound quinol-nitrate oxidoreductase (NarGHI), which reduces nitrate to nitrite and forms part of a redox loop generating a proton-motive force. Found in prokaryotes and some archaea, NarGHI usually functions as a heterotrimer. The alpha chain contains the molybdenum cofactor-containing Mo-bisMGD catalytic subunit. Members of the MopB_Nitrate-R-NarG-like CD belong to the molybdopterin_binding (MopB) superfamily of proteins.
Probab=30.63  E-value=82  Score=20.43  Aligned_cols=24  Identities=8%  Similarity=0.059  Sum_probs=18.2

Q ss_pred             eecCCC--CCeEEEeecCCceEEEEe
Q 035423           11 IQCREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        11 irC~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      .-|++|  |+-|....|..+++.++.
T Consensus         7 ~~c~~C~~gC~i~~~v~dg~v~~v~g   32 (461)
T cd02750           7 THGVNCTGSCSWNVYVKNGIVTREEQ   32 (461)
T ss_pred             CCCCCCCCCCceEEEEECCEEEEEec
Confidence            448888  578888888888777753


No 366
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=30.61  E-value=23  Score=16.02  Aligned_cols=8  Identities=38%  Similarity=1.211  Sum_probs=5.9

Q ss_pred             ecCCCCCe
Q 035423           12 QCRECGYR   19 (35)
Q Consensus        12 rC~~CG~R   19 (35)
                      .||.|+..
T Consensus         1 ~CP~C~~~    8 (41)
T PF13453_consen    1 KCPRCGTE    8 (41)
T ss_pred             CcCCCCcc
Confidence            48888873


No 367
>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only]
Probab=30.60  E-value=20  Score=23.58  Aligned_cols=11  Identities=27%  Similarity=0.661  Sum_probs=8.9

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      ..+|.+|+++-
T Consensus        70 ~~~C~fCaF~~   80 (370)
T COG1060          70 VNDCTFCAFYR   80 (370)
T ss_pred             cCCCCcccccc
Confidence            36899999984


No 368
>PF09654 DUF2396:  Protein of unknown function (DUF2396);  InterPro: IPR013472  These conserved hypothetical proteins have so far been found only in the Cyanobacteria. They are about 170 amino acids long and contain a CxxCx(14)CxxH motif near the N terminus.
Probab=30.56  E-value=17  Score=22.03  Aligned_cols=13  Identities=46%  Similarity=0.879  Sum_probs=10.3

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      +..|.||+|.--|
T Consensus         4 Gpei~CPhCRq~i   16 (161)
T PF09654_consen    4 GPEIQCPHCRQTI   16 (161)
T ss_pred             CCcCcCchhhccc
Confidence            6789999997654


No 369
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=30.54  E-value=31  Score=24.89  Aligned_cols=10  Identities=40%  Similarity=0.909  Sum_probs=4.7

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..||+||..
T Consensus       475 p~~Cp~Cgs~  484 (730)
T COG1198         475 PQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCC
Confidence            3445555544


No 370
>TIGR03847 conserved hypothetical protein. The conserved hypothetical protein described here occurs as part of the trio of uncharacterized proteins common in the Actinobacteria.
Probab=30.53  E-value=22  Score=21.86  Aligned_cols=9  Identities=44%  Similarity=0.999  Sum_probs=7.3

Q ss_pred             ecCCCCCeE
Q 035423           12 QCRECGYRI   20 (35)
Q Consensus        12 rC~~CG~RI   20 (35)
                      .||.||.-|
T Consensus       158 ~CPlCg~Pl  166 (177)
T TIGR03847       158 PCPLCGRPI  166 (177)
T ss_pred             CCCCCCCCC
Confidence            699999864


No 371
>PF12653 DUF3785:  Protein of unknown function (DUF3785);  InterPro: IPR024210 This family of proteins is functionally uncharacterised. Proteins in this family are approximately 140 amino acids in length and share two CXXC motifs suggesting these are zinc binding proteins. In clostridia proteins are found in an operon with three signalling proteins, suggesting that they are involved in DNA-binding transcription regulator downstream of an as yet unknown signalling pathway.
Probab=30.52  E-value=43  Score=19.93  Aligned_cols=13  Identities=31%  Similarity=0.777  Sum_probs=10.3

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      .+-||+||--++.
T Consensus       120 i~VC~nCG~y~i~  132 (138)
T PF12653_consen  120 IIVCPNCGNYSIE  132 (138)
T ss_pred             EEECCCCCceEEE
Confidence            5789999987654


No 372
>PF03243 MerB:  Alkylmercury lyase;  InterPro: IPR004927 Mercury is a highly toxic metal. Toxicity can result from three different mercurial forms: elemental, inorganic ion and organomercurial compounds. The ability of bacteria to detoxify mercurial compounds by reduction and volatilisation is conferred by the Mer genes, which are usually plasmid encoded (although chromosome resistance determinants have also occasionally been identified) []. Organomercurial lyase (MerB), also known as alkylmercury lyase, mediates the first of the two steps in the microbial detoxification of organomercurial salts (the other catalysed by mercuric reductase).  Organomercurial lyase catalyses the protonolysis of the C-Hg bond in a wide range of organomercurial salts (primary, secondary, tertiary, alkyl, vinyl, allyl and aryl) to Hg(II) and the respective organic compound []:  RHg(+) + H(+) = RH + Hg(2+)  Hg(II) is subsequently detoxified by mercuric reductase.  The enzyme has been purified to homogeneity in Escherichia coli and has been found to be a 22.4kDa monomer with no detectable cofactors or metal ions.; GO: 0018836 alkylmercury lyase activity, 0046413 organomercury catabolic process; PDB: 3FN8_B 3F2G_B 3F0P_A 3F2F_B 3F2H_A 3F0O_B 1S6L_A.
Probab=30.52  E-value=1e+02  Score=17.08  Aligned_cols=21  Identities=19%  Similarity=0.251  Sum_probs=13.2

Q ss_pred             eecCCCCCeEEEeecCCceEE
Q 035423           11 IQCRECGYRILYKKRTRRIVQ   31 (35)
Q Consensus        11 irC~~CG~RIlyK~R~~~~~~   31 (35)
                      -+||.||-.|=...++..+..
T Consensus        40 S~cp~tg~pI~l~v~~~~i~~   60 (127)
T PF03243_consen   40 SRCPATGEPIRLTVDPGGITD   60 (127)
T ss_dssp             EE-TTT--EEEEEE-SSSEEE
T ss_pred             EcCCCCCCeEEEEEeCCceee
Confidence            589999999999988765544


No 373
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism]
Probab=30.48  E-value=29  Score=22.90  Aligned_cols=17  Identities=29%  Similarity=0.591  Sum_probs=13.1

Q ss_pred             ceecCCCCCeEEEeecC
Q 035423           10 VIQCRECGYRILYKKRT   26 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R~   26 (35)
                      .-+|+||++..+.....
T Consensus        45 ~~~C~YC~fn~~~~~~~   61 (416)
T COG0635          45 VSKCPYCDFNSHVTKRG   61 (416)
T ss_pred             cccCCCCCCeeeccCCC
Confidence            35899999998776653


No 374
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=30.47  E-value=50  Score=22.22  Aligned_cols=8  Identities=25%  Similarity=0.808  Sum_probs=3.1

Q ss_pred             ecCCCCCe
Q 035423           12 QCRECGYR   19 (35)
Q Consensus        12 rC~~CG~R   19 (35)
                      +||+|+-.
T Consensus       224 ~C~~C~~~  231 (505)
T TIGR00595       224 CCPNCDVS  231 (505)
T ss_pred             CCCCCCCc
Confidence            33444333


No 375
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=30.16  E-value=13  Score=18.94  Aligned_cols=16  Identities=38%  Similarity=0.698  Sum_probs=12.0

Q ss_pred             CCCCceecCCCCCeEE
Q 035423            6 KPGDVIQCRECGYRIL   21 (35)
Q Consensus         6 k~~~~irC~~CG~RIl   21 (35)
                      ++-....|.+|.+||=
T Consensus        27 rPi~tYmC~eC~~RI~   42 (56)
T PF09963_consen   27 RPIHTYMCDECKERIR   42 (56)
T ss_pred             CCCcceeChhHHHHHh
Confidence            3555678999999974


No 376
>COG5415 Predicted integral membrane metal-binding protein [General function prediction only]
Probab=29.99  E-value=22  Score=22.96  Aligned_cols=15  Identities=27%  Similarity=0.627  Sum_probs=7.7

Q ss_pred             ccCCCCceecCCCCC
Q 035423            4 TLKPGDVIQCRECGY   18 (35)
Q Consensus         4 ~lk~~~~irC~~CG~   18 (35)
                      ++.+...+.||.|.|
T Consensus       186 ~~~~~~alIC~~C~h  200 (251)
T COG5415         186 DLSPFKALICPQCHH  200 (251)
T ss_pred             ccCchhhhccccccc
Confidence            344455555555544


No 377
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=29.79  E-value=21  Score=23.08  Aligned_cols=14  Identities=36%  Similarity=0.755  Sum_probs=5.5

Q ss_pred             ceecCCCCCeEEEe
Q 035423           10 VIQCRECGYRILYK   23 (35)
Q Consensus        10 ~irC~~CG~RIlyK   23 (35)
                      .+-||.||..-|=+
T Consensus        31 n~yCP~Cg~~~L~~   44 (254)
T PF06044_consen   31 NMYCPNCGSKPLSK   44 (254)
T ss_dssp             H---TTT--SS-EE
T ss_pred             CCcCCCCCChhHhh
Confidence            35799999885543


No 378
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=29.78  E-value=18  Score=15.82  Aligned_cols=11  Identities=18%  Similarity=0.634  Sum_probs=7.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+.+|..|+..
T Consensus        26 ~~~~C~~C~~~   36 (49)
T smart00109       26 QGLRCSWCKVK   36 (49)
T ss_pred             CCcCCCCCCch
Confidence            46788888754


No 379
>smart00507 HNHc HNH nucleases.
Probab=29.70  E-value=22  Score=15.32  Aligned_cols=11  Identities=27%  Similarity=0.437  Sum_probs=9.0

Q ss_pred             eecCCCCCeEE
Q 035423           11 IQCRECGYRIL   21 (35)
Q Consensus        11 irC~~CG~RIl   21 (35)
                      -.|.+||..+-
T Consensus        11 ~~C~~C~~~~~   21 (52)
T smart00507       11 GVCAYCGKPAS   21 (52)
T ss_pred             CCCcCCcCCCC
Confidence            68999998763


No 380
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways. Archaea, anaerobic bacteria and eukaryotes that lack mitochondria (and therefore pyruvate dehydrogenase) use PFOR to oxidatively decarboxylate pyruvate, with ferredoxin or flavodoxin as the electron acceptor. PFORs can be homodimeric, heterodimeric, or heterotetrameric, depending on the organism. These enzymes are dependent on TPP and a divalent metal cation as cofactors.
Probab=29.53  E-value=7.1  Score=23.64  Aligned_cols=14  Identities=21%  Similarity=0.404  Sum_probs=10.7

Q ss_pred             eecCCCCCeEEEee
Q 035423           11 IQCRECGYRILYKK   24 (35)
Q Consensus        11 irC~~CG~RIlyK~   24 (35)
                      --||-|||.++++.
T Consensus         6 ~~c~gc~~~~~~~~   19 (237)
T cd02018           6 GACAGCGEVTAVRV   19 (237)
T ss_pred             ccCcCCCcHHHHHH
Confidence            45999999887654


No 381
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=29.48  E-value=24  Score=15.55  Aligned_cols=10  Identities=30%  Similarity=0.534  Sum_probs=3.7

Q ss_pred             cCCCCCeEEE
Q 035423           13 CRECGYRILY   22 (35)
Q Consensus        13 C~~CG~RIly   22 (35)
                      |++||..+-+
T Consensus         1 C~~C~~~~~~   10 (47)
T PF01844_consen    1 CQYCGKPGSD   10 (47)
T ss_dssp             -TTT--B--G
T ss_pred             CCCCCCcCcc
Confidence            7888877543


No 382
>COG4647 AcxC Acetone carboxylase, gamma subunit [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=29.42  E-value=23  Score=21.47  Aligned_cols=8  Identities=50%  Similarity=1.277  Sum_probs=6.7

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      ..||+||.
T Consensus       121 ficpecg~  128 (165)
T COG4647         121 FICPECGI  128 (165)
T ss_pred             hhCccccc
Confidence            56999996


No 383
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=29.42  E-value=57  Score=18.96  Aligned_cols=16  Identities=19%  Similarity=0.445  Sum_probs=10.3

Q ss_pred             CCceecCCCCCeEEEe
Q 035423            8 GDVIQCRECGYRILYK   23 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK   23 (35)
                      .+.+-||-||..+-|-
T Consensus       103 ~~~~~CPwCg~~g~~~  118 (131)
T PF15616_consen  103 EGEVTCPWCGNEGSFG  118 (131)
T ss_pred             CCCEECCCCCCeeeec
Confidence            3457777777776553


No 384
>TIGR02646 conserved hypothetical protein TIGR02646. Members of this uncharacterized protein family are found exclusively in bacteria. Neighboring genes in various genomes are also uncharacterized or may annotated as similar to restriction system proteins.
Probab=29.41  E-value=22  Score=19.98  Aligned_cols=12  Identities=25%  Similarity=0.362  Sum_probs=9.4

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      ..-+|.||+.+|
T Consensus        23 ~~~~C~YC~~~~   34 (144)
T TIGR02646        23 QGGLCAYCEREI   34 (144)
T ss_pred             hCCCcCccCCCc
Confidence            356899999965


No 385
>PRK14873 primosome assembly protein PriA; Provisional
Probab=29.40  E-value=60  Score=22.95  Aligned_cols=10  Identities=40%  Similarity=0.883  Sum_probs=4.9

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ..+|.+||+.
T Consensus       410 ~l~Ch~CG~~  419 (665)
T PRK14873        410 TPRCRWCGRA  419 (665)
T ss_pred             eeECCCCcCC
Confidence            4455555543


No 386
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=29.20  E-value=39  Score=15.08  Aligned_cols=13  Identities=23%  Similarity=0.782  Sum_probs=9.7

Q ss_pred             eecCCCCCeEEEe
Q 035423           11 IQCRECGYRILYK   23 (35)
Q Consensus        11 irC~~CG~RIlyK   23 (35)
                      +.|..|+--++|=
T Consensus         2 ~~C~~C~t~L~yP   14 (31)
T TIGR01053         2 VVCGGCRTLLMYP   14 (31)
T ss_pred             cCcCCCCcEeecC
Confidence            6788888877763


No 387
>PF06467 zf-FCS:  MYM-type Zinc finger with FCS sequence motif;  InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  MYM-type zinc fingers were identified in MYM family proteins []. Human protein Q14202 from SWISSPROT is involved in a chromosomal translocation and may be responsible for X-linked retardation in XQ13.1 []. Q9UBW7 from SWISSPROT is also involved in disease. In myeloproliferative disorders it is fused to FGF receptor 1 []; in atypical myeloproliferative disorders it is rearranged []. Members of the family generally are involved in development. This Zn-finger domain functions as a transcriptional trans-activator of late vaccinia viral genes, and orthologues are also found in all nucleocytoplasmic large DNA viruses, NCLDV. This domain is also found fused to the C termini of recombinases from certain prokaryotic transposons []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2L8E_A 2DAS_A.
Probab=29.16  E-value=40  Score=14.85  Aligned_cols=15  Identities=20%  Similarity=0.257  Sum_probs=8.4

Q ss_pred             CCCceecCCCCCeEE
Q 035423            7 PGDVIQCRECGYRIL   21 (35)
Q Consensus         7 ~~~~irC~~CG~RIl   21 (35)
                      ......|.+|+.-|-
T Consensus         3 ~~~~~~C~~C~~~~~   17 (43)
T PF06467_consen    3 NLKMKTCSYCKKYIP   17 (43)
T ss_dssp             G-SCEE-TTT--EEE
T ss_pred             CCcCCcCcccCCccc
Confidence            356789999999874


No 388
>TIGR03129 one_C_dehyd_B formylmethanofuran dehydrogenase subunit B. Members of this largely archaeal protein family are subunit B of the formylmethanofuran dehydrogenase. Nomenclature in some bacteria may reflect inclusion of the formyltransferase described by TIGR03119 as part of the complex, and therefore call this protein formyltransferase/hydrolase complex Fhc subunit C. Note that this model does not distinguish tungsten (FwdB) from molybdenum-containing (FmdB) forms of this enzyme.
Probab=29.13  E-value=83  Score=19.51  Aligned_cols=22  Identities=23%  Similarity=0.369  Sum_probs=15.9

Q ss_pred             eecCCC--CCe-EEEeecCCceEEE
Q 035423           11 IQCREC--GYR-ILYKKRTRRIVQY   32 (35)
Q Consensus        11 irC~~C--G~R-IlyK~R~~~~~~~   32 (35)
                      +-|+.|  |+- |..+.+..+++.+
T Consensus         2 ~~C~~C~~gC~~l~v~v~~g~v~~v   26 (421)
T TIGR03129         2 VVCPFCGCLCDDIEVEVEGNKIVKV   26 (421)
T ss_pred             cccCCcccccCeEEEEEECCEEEEE
Confidence            468888  565 8888887766554


No 389
>cd02754 MopB_Nitrate-R-NapA-like Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite. Monomeric Nas is located in the cytoplasm and participates in nitrogen assimilation. Dimeric Nap is located in the periplasm and is coupled to quinol oxidation via a membrane-anchored tetraheme cytochrome. Members of the MopB_Nitrate-R-NapA CD belong to the molybdopterin_binding (MopB) superfamily of proteins.
Probab=29.13  E-value=88  Score=20.62  Aligned_cols=23  Identities=17%  Similarity=0.462  Sum_probs=17.3

Q ss_pred             ecCCC--CCeEEEeecCCceEEEEe
Q 035423           12 QCREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        12 rC~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      -|+.|  |+-|....|..+++.++.
T Consensus         3 ~C~~C~~~C~i~v~v~dg~i~ri~g   27 (565)
T cd02754           3 TCPYCGVGCGVEIGVKDGKVVAVRG   27 (565)
T ss_pred             CCCCCCCCCCEEEEEECCEEEEEEC
Confidence            37777  578888888888877764


No 390
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.10  E-value=27  Score=19.21  Aligned_cols=12  Identities=42%  Similarity=1.019  Sum_probs=6.2

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      .+..-|++||-+
T Consensus        31 dplt~ce~c~a~   42 (82)
T COG2331          31 DPLTTCEECGAR   42 (82)
T ss_pred             CccccChhhChH
Confidence            334456666554


No 391
>PF04032 Rpr2:  RNAse P Rpr2/Rpp21/SNM1 subunit domain;  InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [].; PDB: 2K3R_A 2KI7_B 2ZAE_B 1X0T_A.
Probab=29.03  E-value=27  Score=17.45  Aligned_cols=9  Identities=44%  Similarity=1.065  Sum_probs=5.0

Q ss_pred             ceecCCCCC
Q 035423           10 VIQCRECGY   18 (35)
Q Consensus        10 ~irC~~CG~   18 (35)
                      .+.|-.||+
T Consensus        77 ~~~C~~C~~   85 (85)
T PF04032_consen   77 VYTCLNCGH   85 (85)
T ss_dssp             EEEETTTTE
T ss_pred             EEEccccCC
Confidence            355666654


No 392
>PF02701 zf-Dof:  Dof domain, zinc finger;  InterPro: IPR003851 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry consists of proteins containing a Dof domain, which is a zinc finger DNA-binding domain that shows resemblance to the Cys2 zinc finger, although it has a longer putative loop where an extra Cys residue is conserved []. AOBP, a DNA-binding protein in pumpkin (Cucurbita maxima), contains a 52 amino acid Dof domain, which is highly conserved in several DNA-binding proteins of higher plants. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent
Probab=29.02  E-value=32  Score=18.05  Aligned_cols=13  Identities=31%  Similarity=0.830  Sum_probs=9.9

Q ss_pred             CCCCceecCCCCC
Q 035423            6 KPGDVIQCRECGY   18 (35)
Q Consensus         6 k~~~~irC~~CG~   18 (35)
                      ++..++.||.|+.
T Consensus         1 ~~~~~~~CPRC~S   13 (63)
T PF02701_consen    1 KPEQPLPCPRCDS   13 (63)
T ss_pred             CCccCCCCCCcCC
Confidence            3567789999975


No 393
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=28.94  E-value=32  Score=19.87  Aligned_cols=10  Identities=40%  Similarity=0.986  Sum_probs=7.8

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      =|.|++||..
T Consensus       102 yVlC~~C~sp  111 (138)
T PRK03988        102 YVICPECGSP  111 (138)
T ss_pred             cEECCCCCCC
Confidence            4789999874


No 394
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, U=I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specifici
Probab=28.83  E-value=27  Score=18.50  Aligned_cols=7  Identities=57%  Similarity=1.749  Sum_probs=5.9

Q ss_pred             cCCCCCe
Q 035423           13 CRECGYR   19 (35)
Q Consensus        13 C~~CG~R   19 (35)
                      ||.||..
T Consensus         1 c~~~~~~    7 (130)
T cd04511           1 CPDCGYI    7 (130)
T ss_pred             CCCCccc
Confidence            8999984


No 395
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=28.77  E-value=25  Score=17.95  Aligned_cols=8  Identities=38%  Similarity=1.132  Sum_probs=2.6

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      .+|.+||.
T Consensus        49 ~KC~~C~S   56 (61)
T PF14599_consen   49 HKCSHCGS   56 (61)
T ss_dssp             ---TTTS-
T ss_pred             hcCCCCCC
Confidence            45666653


No 396
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional
Probab=28.72  E-value=29  Score=21.58  Aligned_cols=14  Identities=36%  Similarity=0.581  Sum_probs=10.7

Q ss_pred             ceecCCCCCeEEEe
Q 035423           10 VIQCRECGYRILYK   23 (35)
Q Consensus        10 ~irC~~CG~RIlyK   23 (35)
                      .--|+.||..|.-.
T Consensus       254 g~pC~~Cg~~I~~~  267 (282)
T PRK13945        254 GKPCRKCGTPIERI  267 (282)
T ss_pred             cCCCCcCCCeeEEE
Confidence            44699999998643


No 397
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=28.43  E-value=30  Score=17.16  Aligned_cols=11  Identities=36%  Similarity=0.908  Sum_probs=8.8

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ....||+||..
T Consensus        52 g~L~Cp~c~r~   62 (68)
T PF03966_consen   52 GELICPECGRE   62 (68)
T ss_dssp             TEEEETTTTEE
T ss_pred             CEEEcCCCCCE
Confidence            56899999864


No 398
>PRK03922 hypothetical protein; Provisional
Probab=28.40  E-value=27  Score=20.18  Aligned_cols=10  Identities=30%  Similarity=0.853  Sum_probs=8.1

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ..-||.||.-
T Consensus        49 ~~~cP~cge~   58 (113)
T PRK03922         49 LTICPKCGEP   58 (113)
T ss_pred             cccCCCCCCc
Confidence            3679999975


No 399
>PF01199 Ribosomal_L34e:  Ribosomal protein L34e;  InterPro: IPR008195 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaebacterial ribosomal proteins belong to the L34e family. These include, vertebrate L34, mosquito L31 [], plant L34 [], yeast putative ribosomal protein YIL052c and archaebacterial L34e.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3IZR_i 3IZS_i 4A19_L 4A1D_L 4A18_L 4A1B_L.
Probab=28.25  E-value=28  Score=19.18  Aligned_cols=15  Identities=27%  Similarity=0.663  Sum_probs=7.8

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      +.....+|..||..+
T Consensus        37 K~~~~pkC~~cg~~L   51 (94)
T PF01199_consen   37 KKPKKPKCGDCGKPL   51 (94)
T ss_dssp             --TT--BSTSSS-BS
T ss_pred             ccCCCCCcCccCCcc
Confidence            445677899999763


No 400
>COG2023 RPR2 RNase P subunit RPR2 [Translation, ribosomal structure and biogenesis]
Probab=28.13  E-value=48  Score=18.78  Aligned_cols=14  Identities=43%  Similarity=0.797  Sum_probs=10.9

Q ss_pred             CceecCCCCCeEEE
Q 035423            9 DVIQCRECGYRILY   22 (35)
Q Consensus         9 ~~irC~~CG~RIly   22 (35)
                      -.+.|.+||+-.-|
T Consensus        81 v~vtC~~CG~~~R~   94 (105)
T COG2023          81 VVVTCLECGTIRRY   94 (105)
T ss_pred             EEEEecCCCcEEEe
Confidence            46899999986554


No 401
>cd02752 MopB_Formate-Dh-Na-like Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E. coli formate dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that is a complex of three different subunits and is the major electron donor to the nitrate respiratory chain. Also included in this CD is the Desulfovibrio gigas tungsten formate dehydrogenase, DgW-FDH. In contrast to Fdh-N, which is a  functional heterotrimer, DgW-FDH is a heterodimer. The DgW-FDH complex is composed of a large subunit carrying the W active site and one [4Fe-4S] center, and a small subunit that harbors a series of three [4Fe-4S] clusters as well as a putative vacant binding site for a fourth cluster. The smaller subunit is not included in this alignment. Members of the MopB_Formate-Dh-Na-like CD belong to the molybdopterin_binding (MopB) superfamily of proteins.
Probab=27.81  E-value=91  Score=21.93  Aligned_cols=22  Identities=23%  Similarity=0.394  Sum_probs=16.8

Q ss_pred             ecCCC--CCeEEEeecCCceEEEE
Q 035423           12 QCREC--GYRILYKKRTRRIVQYE   33 (35)
Q Consensus        12 rC~~C--G~RIlyK~R~~~~~~~~   33 (35)
                      -|++|  |+-|....+..+++.++
T Consensus         3 vC~~C~~gCgi~v~v~dg~iv~ve   26 (649)
T cd02752           3 ICPYCSVGCGLIAYVQNGVWVHQE   26 (649)
T ss_pred             cCcCcccCCCeEEEEECCEEEEEE
Confidence            38888  78888877777777665


No 402
>PRK07726 DNA topoisomerase III; Provisional
Probab=27.80  E-value=32  Score=23.95  Aligned_cols=14  Identities=29%  Similarity=0.636  Sum_probs=11.0

Q ss_pred             ceecCCCCCeEEEe
Q 035423           10 VIQCRECGYRILYK   23 (35)
Q Consensus        10 ~irC~~CG~RIlyK   23 (35)
                      ...||.||..++++
T Consensus       610 ~~~CP~C~~~~~~~  623 (658)
T PRK07726        610 GPKCPDCGKPMLKV  623 (658)
T ss_pred             cccccccCccceee
Confidence            46799999987654


No 403
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=27.71  E-value=31  Score=15.60  Aligned_cols=10  Identities=30%  Similarity=0.969  Sum_probs=7.9

Q ss_pred             CCceecCCCC
Q 035423            8 GDVIQCRECG   17 (35)
Q Consensus         8 ~~~irC~~CG   17 (35)
                      ...+.||.|+
T Consensus        34 ~~~~~CP~C~   43 (44)
T PF14634_consen   34 GKSVKCPICR   43 (44)
T ss_pred             CCCCCCcCCC
Confidence            4578999987


No 404
>TIGR00320 dfx_rbo desulfoferrodoxin. This protein is described in some articles as rubredoxin oxidoreductase (rbo), and its gene shares an operon with the rubredoxin gene in Desulfovibrio vulgaris Hildenborough.
Probab=27.71  E-value=44  Score=18.89  Aligned_cols=15  Identities=27%  Similarity=0.538  Sum_probs=11.9

Q ss_pred             CCceecCCCCCeEEE
Q 035423            8 GDVIQCRECGYRILY   22 (35)
Q Consensus         8 ~~~irC~~CG~RIly   22 (35)
                      ..-.+|+.||.-++.
T Consensus         5 ~~fYkC~~CGniv~v   19 (125)
T TIGR00320         5 LQVYKCEVCGNIVEV   19 (125)
T ss_pred             CcEEECCCCCcEEEE
Confidence            456899999998853


No 405
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit. Indolepyruvate ferredoxin oxidoreductase (IOR) is an alpha 2/beta 2 tetramer related to ketoacid oxidoreductases for pyruvate (1.2.7.1, POR), 2-ketoglutarate (1.2.7.3, KOR), and 2-oxoisovalerate (1.2.7.7, VOR). These multi-subunit enzymes typically are found in anaerobes and are inactiviated by oxygen. IOR in Pyrococcus acts in fermentation of all three aromatic amino acids, following removal of the amino group by transamination. In Methanococcus maripaludis, by contrast, IOR acts in the opposite direction, in pathways of amino acid biosynthesis from phenylacetate, indoleacetate, and p-hydroxyphenylacetate. In M. maripaludis and many other species, iorA and iorB are found next to an apparent phenylacetate-CoA ligase.
Probab=27.55  E-value=14  Score=25.01  Aligned_cols=18  Identities=22%  Similarity=0.375  Sum_probs=14.9

Q ss_pred             cCCCCceecCCCCCeEEE
Q 035423            5 LKPGDVIQCRECGYRILY   22 (35)
Q Consensus         5 lk~~~~irC~~CG~RIly   22 (35)
                      +...++.-|+-|+||.++
T Consensus       351 ~~~r~~~~C~GCp~~~~~  368 (595)
T TIGR03336       351 LPVRPPSLCAGCPHRATF  368 (595)
T ss_pred             cCCCCCCCCCCCCChHHH
Confidence            455678899999999876


No 406
>TIGR01591 Fdh-alpha formate dehydrogenase, alpha subunit, archaeal-type. This model is well-defined, with only a single fragmentary sequence falling between trusted and noise. The alpha subunit of a version of nitrate reductase is closely related.
Probab=27.54  E-value=95  Score=20.90  Aligned_cols=22  Identities=27%  Similarity=0.573  Sum_probs=16.9

Q ss_pred             cCCC--CCeEEEeecCCceEEEEe
Q 035423           13 CREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        13 C~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      |+.|  |+-|....|..+++.++.
T Consensus         3 C~~C~~~C~i~v~~~~g~i~rv~~   26 (671)
T TIGR01591         3 CPYCGVGCSLNLVVKDGKIVRVEP   26 (671)
T ss_pred             CCCCCCCCCEEEEEECCEEEEeec
Confidence            7777  578888888888877764


No 407
>PF10891 DUF2719:  Protein of unknown function (DUF2719);  InterPro: IPR020122 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf56; it is a family of uncharacterised viral proteins.
Probab=27.48  E-value=37  Score=18.60  Aligned_cols=12  Identities=25%  Similarity=0.833  Sum_probs=9.8

Q ss_pred             CCCceecCCCCC
Q 035423            7 PGDVIQCRECGY   18 (35)
Q Consensus         7 ~~~~irC~~CG~   18 (35)
                      ..+.|.|+.|.+
T Consensus        19 ~~qVV~C~~C~F   30 (81)
T PF10891_consen   19 ENQVVYCPKCYF   30 (81)
T ss_pred             cCCEEEccccce
Confidence            456899999976


No 408
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=27.44  E-value=28  Score=17.65  Aligned_cols=12  Identities=33%  Similarity=0.719  Sum_probs=8.6

Q ss_pred             ceecCCCCCeEE
Q 035423           10 VIQCRECGYRIL   21 (35)
Q Consensus        10 ~irC~~CG~RIl   21 (35)
                      .--|++||..++
T Consensus        35 ~~pC~fCg~~l~   46 (57)
T PF06221_consen   35 LGPCPFCGTPLL   46 (57)
T ss_pred             cCcCCCCCCccc
Confidence            356889987655


No 409
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=27.43  E-value=29  Score=22.61  Aligned_cols=9  Identities=22%  Similarity=0.881  Sum_probs=7.1

Q ss_pred             ceecCCCCC
Q 035423           10 VIQCRECGY   18 (35)
Q Consensus        10 ~irC~~CG~   18 (35)
                      -++|++||.
T Consensus       226 R~~C~~Cg~  234 (309)
T PRK03564        226 RVKCSNCEQ  234 (309)
T ss_pred             CccCCCCCC
Confidence            468899986


No 410
>cd02762 MopB_1 The MopB_1 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. These members belong to the molybdopterin_binding (MopB) superfamily of proteins.
Probab=27.39  E-value=90  Score=20.64  Aligned_cols=23  Identities=13%  Similarity=0.362  Sum_probs=15.9

Q ss_pred             ecCCCC--CeEEEeecCCceEEEEe
Q 035423           12 QCRECG--YRILYKKRTRRIVQYEA   34 (35)
Q Consensus        12 rC~~CG--~RIlyK~R~~~~~~~~A   34 (35)
                      -|+.|+  +.|....+..+++.++.
T Consensus         3 ~C~~C~~~C~i~v~v~~g~ivkv~g   27 (539)
T cd02762           3 ACILCEANCGLVVTVEDGRVASIRG   27 (539)
T ss_pred             cCCCcccCCCeEEEEECCEEEEEEC
Confidence            377775  77888777777766653


No 411
>PRK09401 reverse gyrase; Reviewed
Probab=27.32  E-value=27  Score=26.22  Aligned_cols=11  Identities=36%  Similarity=0.757  Sum_probs=8.2

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      .--||+||..|
T Consensus         7 ~~~cpnc~g~i   17 (1176)
T PRK09401          7 KNSCPNCGGDI   17 (1176)
T ss_pred             cccCCCCCCcC
Confidence            34699999765


No 412
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional
Probab=27.10  E-value=8.4  Score=24.74  Aligned_cols=14  Identities=29%  Similarity=0.622  Sum_probs=10.9

Q ss_pred             ceecCCCCCeEEEe
Q 035423           10 VIQCRECGYRILYK   23 (35)
Q Consensus        10 ~irC~~CG~RIlyK   23 (35)
                      .--|+-||+++.++
T Consensus        18 ~~~C~GCg~~~~~~   31 (299)
T PRK11865         18 HRACAGCGAAIAMR   31 (299)
T ss_pred             CCCCcCCCcHHHHH
Confidence            34699999997665


No 413
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=27.01  E-value=21  Score=22.79  Aligned_cols=17  Identities=41%  Similarity=0.849  Sum_probs=10.9

Q ss_pred             CCCceecCCCCCeEEEee
Q 035423            7 PGDVIQCRECGYRILYKK   24 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK~   24 (35)
                      .+--++||.|+.- +|++
T Consensus        24 ~~~~~~c~~c~~~-~~~~   40 (292)
T PRK05654         24 EGLWTKCPSCGQV-LYRK   40 (292)
T ss_pred             CCCeeECCCccch-hhHH
Confidence            3346788888875 4443


No 414
>TIGR02116 toxin_Txe_YoeB toxin-antitoxin system, toxin component, Txe/YoeB family. The Axe-Txe pair in Enterococcus faecium and the homologous YefM-YoeB pair in Escherichia coli have been shown to act as an antitoxin-toxin pair. This model describes the toxin component. Nearly every example found is next to an identifiable antitoxin, as indicated by matches to TIGR01552 and/or pfam02604.
Probab=26.88  E-value=95  Score=15.52  Aligned_cols=24  Identities=17%  Similarity=0.253  Sum_probs=18.0

Q ss_pred             eecCCC-CCeEEEeecCCceEEEEe
Q 035423           11 IQCREC-GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        11 irC~~C-G~RIlyK~R~~~~~~~~A   34 (35)
                      -+|.-- .|||+|..-.+.+.-+.+
T Consensus        52 ~r~rig~dyRIIY~i~~~~~~i~~~   76 (80)
T TIGR02116        52 WSRRITDEHRLVYRVTDDEVLILAA   76 (80)
T ss_pred             EEEEcCCCeEEEEEEECCEEEEEEe
Confidence            477766 699999988877666654


No 415
>cd02755 MopB_Thiosulfate-R-like The MopB_Thiosulfate-R-like CD contains thiosulfate-, sulfur-, and polysulfide-reductases, and other related proteins. Thiosulfate reductase catalyzes the cleavage of sulfur-sulfur bonds in thiosulfate. Polysulfide reductase is a membrane-bound enzyme that catalyzes the reduction of polysulfide using either hydrogen or formate as the electron donor. Members of the MopB_Thiosulfate-R-like CD belong to the molybdopterin_binding (MopB) superfamily of proteins.
Probab=26.71  E-value=90  Score=20.17  Aligned_cols=22  Identities=27%  Similarity=0.575  Sum_probs=16.3

Q ss_pred             ecCCC--CCeEEEeecCCceEEEE
Q 035423           12 QCREC--GYRILYKKRTRRIVQYE   33 (35)
Q Consensus        12 rC~~C--G~RIlyK~R~~~~~~~~   33 (35)
                      -|++|  |+-|+...+.-+++.++
T Consensus         4 ~C~~C~~~C~l~v~v~dG~v~~v~   27 (454)
T cd02755           4 ICEMCSSRCGILARVEDGRVVKID   27 (454)
T ss_pred             cCcCcccCCCcEEEEECCEEEEEE
Confidence            58888  57788887777776665


No 416
>PRK05417 glutathione-dependent formaldehyde-activating enzyme; Provisional
Probab=26.67  E-value=29  Score=21.09  Aligned_cols=12  Identities=33%  Similarity=1.010  Sum_probs=9.9

Q ss_pred             ecCCCCCeEEEe
Q 035423           12 QCRECGYRILYK   23 (35)
Q Consensus        12 rC~~CG~RIlyK   23 (35)
                      -|+.||..+.+.
T Consensus        95 FC~~CGS~L~~~  106 (191)
T PRK05417         95 ACKECGVHMYGR  106 (191)
T ss_pred             eCCCCCCccccc
Confidence            499999997664


No 417
>TIGR02174 CXXU_selWTH selT/selW/selH selenoprotein domain. This model represents a domain found in both bacteria and animals, including animal proteins SelT, SelW, and SelH, all of which are selenoproteins. In a CXXC motif near the N-terminus of the domain, selenocysteine may replace the second Cys. Proteins with this domain may include an insert of about 70 amino acids. This model is broader than the current SelW model pfam05169 in Pfam.
Probab=26.58  E-value=30  Score=17.47  Aligned_cols=9  Identities=44%  Similarity=1.291  Sum_probs=6.5

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      .-|..|||+
T Consensus         4 eyC~~C~y~   12 (72)
T TIGR02174         4 EYCGSCGYK   12 (72)
T ss_pred             EECCCCCCh
Confidence            458899954


No 418
>PF01907 Ribosomal_L37e:  Ribosomal protein L37e;  InterPro: IPR001569 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families consists of proteins of 56 to 96 amino-acid residues that share a highly conserved region located in the N-terminal part.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A19_A 4A1D_A 4A18_A 4A1B_A 1S1I_Y 3O5H_d 3IZS_l 3O58_d 2ZKR_2 3IZR_l ....
Probab=26.57  E-value=57  Score=16.60  Aligned_cols=13  Identities=38%  Similarity=0.810  Sum_probs=9.1

Q ss_pred             CceecCCCCCeEE
Q 035423            9 DVIQCRECGYRIL   21 (35)
Q Consensus         9 ~~irC~~CG~RIl   21 (35)
                      .-+.|+-||.+-+
T Consensus        14 tH~~CrRCG~~sy   26 (55)
T PF01907_consen   14 THTLCRRCGRRSY   26 (55)
T ss_dssp             SEEE-TTTSSEEE
T ss_pred             cEeeecccCCeee
Confidence            5688999998843


No 419
>PF01930 Cas_Cas4:  Domain of unknown function DUF83;  InterPro: IPR022765 This entry represents an uncharacterised domain found in several proteins, including DNA replication helicase Dna2, clustered regularly interspaced short palindromic repeats (CRISPR)-associated exonuclease Cas4 and putative RecB family exonuclease proteins. 
Probab=26.57  E-value=40  Score=18.56  Aligned_cols=12  Identities=42%  Similarity=1.132  Sum_probs=9.1

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ...-+|..|+|+
T Consensus       146 ~~~~~C~~C~y~  157 (162)
T PF01930_consen  146 ENSKKCRRCSYR  157 (162)
T ss_pred             CCCCCCCCCCCc
Confidence            334589999987


No 420
>PF00098 zf-CCHC:  Zinc knuckle;  InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (CCHC) type zinc finger domains, and have the sequence:  C-X2-C-X4-H-X4-C  where X can be any amino acid, and number indicates the number of residues. These 18 residues CCHC zinc finger domains are mainly found in the nucleocapsid protein of retroviruses. It is required for viral genome packaging and for early infection process [, , ]. It is also found in eukaryotic proteins involved in RNA binding or single-stranded DNA binding []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 2L44_A 1A1T_A 1WWG_A 1U6P_A 1WWD_A 1WWE_A 1A6B_B 1F6U_A 1MFS_A 1NCP_C ....
Probab=26.49  E-value=32  Score=13.45  Aligned_cols=7  Identities=43%  Similarity=1.241  Sum_probs=5.0

Q ss_pred             ecCCCCC
Q 035423           12 QCRECGY   18 (35)
Q Consensus        12 rC~~CG~   18 (35)
                      +|-+||-
T Consensus         2 ~C~~C~~    8 (18)
T PF00098_consen    2 KCFNCGE    8 (18)
T ss_dssp             BCTTTSC
T ss_pred             cCcCCCC
Confidence            6788874


No 421
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=26.44  E-value=39  Score=18.81  Aligned_cols=10  Identities=40%  Similarity=0.996  Sum_probs=7.9

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      =|.|++||..
T Consensus        80 yVlC~~C~sp   89 (110)
T smart00653       80 YVLCPECGSP   89 (110)
T ss_pred             cEECCCCCCC
Confidence            3889999874


No 422
>cd04792 LanM-like LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
Probab=26.34  E-value=36  Score=23.56  Aligned_cols=12  Identities=33%  Similarity=0.780  Sum_probs=10.0

Q ss_pred             CCeEEEeecCCc
Q 035423           17 GYRILYKKRTRR   28 (35)
Q Consensus        17 G~RIlyK~R~~~   28 (35)
                      |.+|+||+|+-.
T Consensus       113 g~kivYKPr~l~  124 (825)
T cd04792         113 GLKLVYKPRSLS  124 (825)
T ss_pred             CCEEEECCCCch
Confidence            789999999753


No 423
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=25.90  E-value=50  Score=14.46  Aligned_cols=11  Identities=36%  Similarity=0.921  Sum_probs=5.5

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ...+||.||-+
T Consensus        12 ~kY~Cp~C~~~   22 (30)
T PF04438_consen   12 AKYRCPRCGAR   22 (30)
T ss_dssp             ESEE-TTT--E
T ss_pred             CEEECCCcCCc
Confidence            34688888865


No 424
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=25.82  E-value=42  Score=13.32  Aligned_cols=9  Identities=44%  Similarity=1.232  Sum_probs=6.6

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      -.|..|+-.
T Consensus         2 ~~C~~C~~~   10 (27)
T PF13912_consen    2 FECDECGKT   10 (27)
T ss_dssp             EEETTTTEE
T ss_pred             CCCCccCCc
Confidence            478999854


No 425
>PF10164 DUF2367:  Uncharacterized conserved protein (DUF2367);  InterPro: IPR019317  This is a highly conserved set of proteins which contains three pairs of cysteine residues within a length of 42 amino acids and is rich in proline residues towards the N terminus. It includes a membrane protein that has been found to be highly expressed in the mouse brain and consequently, several members have been assigned as brain protein i3 (Bri3). Their function is unknown.
Probab=25.77  E-value=32  Score=19.41  Aligned_cols=10  Identities=30%  Similarity=0.836  Sum_probs=7.6

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .-||.+||..
T Consensus        88 ~~rC~nCG~~   97 (98)
T PF10164_consen   88 ERRCSNCGAT   97 (98)
T ss_pred             ccccCCCCcc
Confidence            4689999863


No 426
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.50  E-value=32  Score=18.90  Aligned_cols=13  Identities=23%  Similarity=0.741  Sum_probs=9.7

Q ss_pred             ecCCCCCeEEEee
Q 035423           12 QCRECGYRILYKK   24 (35)
Q Consensus        12 rC~~CG~RIlyK~   24 (35)
                      -||+||.-++-..
T Consensus        43 ~CPnCGGelv~RP   55 (84)
T COG3813          43 LCPNCGGELVARP   55 (84)
T ss_pred             cCCCCCchhhcCc
Confidence            5999998866443


No 427
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E. coli CobB; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. CobB is a bacterial sirtuin that deacetylates acetyl-CoA synthetase at an active site lysine to stimulate its enzymatic activity.
Probab=25.32  E-value=33  Score=20.22  Aligned_cols=11  Identities=27%  Similarity=0.821  Sum_probs=8.3

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..-+||.||..
T Consensus       129 ~~p~C~~Cgg~  139 (224)
T cd01412         129 ELPRCPKCGGL  139 (224)
T ss_pred             CCCCCCCCCCc
Confidence            34689999975


No 428
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown]
Probab=25.28  E-value=8.1  Score=25.16  Aligned_cols=13  Identities=31%  Similarity=0.795  Sum_probs=10.3

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      ...|++||.++|.
T Consensus        22 ~lnC~HCg~~~L~   34 (275)
T COG1856          22 SLNCPHCGRHYLE   34 (275)
T ss_pred             EecChHHHHHHHH
Confidence            4679999988763


No 429
>cd01675 RNR_III Class III ribonucleotide reductase. Ribonucleotide reductase (RNR) catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs, found in eukaryotes, bacteria, and bacteriophage, use a diiron-tyrosyl radical. Class II RNRs, found in bacteria, bacteriophage, algae and archaea, use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs, found in strict or facultative anaerobic bacteria, bacteriophage, and archaea, use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. Many organisms have more than one class of RNR present in their genomes. All three RNRs have a ten-stranded alpha-beta barrel domain that is structurally similar to the domain of PFL (pyruvate formate lyase). The class III enzyme from phage T4 consists of two subunits, this model covers the larger subunit w
Probab=25.08  E-value=31  Score=23.62  Aligned_cols=12  Identities=33%  Similarity=1.024  Sum_probs=8.7

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      +..-.||.||.+
T Consensus       530 ~~~~~CP~CGs~  541 (555)
T cd01675         530 GEGFKCPKCGSE  541 (555)
T ss_pred             CCCCCCcCCCCc
Confidence            344689999965


No 430
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=25.05  E-value=34  Score=18.09  Aligned_cols=10  Identities=30%  Similarity=0.796  Sum_probs=7.8

Q ss_pred             CceecCCCCC
Q 035423            9 DVIQCRECGY   18 (35)
Q Consensus         9 ~~irC~~CG~   18 (35)
                      ...|||.|+-
T Consensus        43 ~VArCPSCSL   52 (67)
T COG5216          43 VVARCPSCSL   52 (67)
T ss_pred             eEEEcCCceE
Confidence            4569999984


No 431
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=24.99  E-value=27  Score=22.29  Aligned_cols=12  Identities=25%  Similarity=0.678  Sum_probs=8.2

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      --++||+||.-|
T Consensus        25 ~~~~c~~c~~~~   36 (285)
T TIGR00515        25 VWTKCPKCGQVL   36 (285)
T ss_pred             CeeECCCCcchh
Confidence            357888887653


No 432
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=24.69  E-value=46  Score=15.25  Aligned_cols=11  Identities=36%  Similarity=0.948  Sum_probs=9.0

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      +..|++||..-
T Consensus        12 ~f~C~~C~~~F   22 (39)
T smart00154       12 GFKCRHCGNLF   22 (39)
T ss_pred             CeECCccCCcc
Confidence            78999999754


No 433
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=24.59  E-value=33  Score=15.62  Aligned_cols=7  Identities=43%  Similarity=1.246  Sum_probs=4.4

Q ss_pred             ecCCCCC
Q 035423           12 QCRECGY   18 (35)
Q Consensus        12 rC~~CG~   18 (35)
                      .|+.||.
T Consensus         3 ~C~~Cg~    9 (36)
T PF05191_consen    3 ICPKCGR    9 (36)
T ss_dssp             EETTTTE
T ss_pred             CcCCCCC
Confidence            4777773


No 434
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=24.50  E-value=33  Score=19.45  Aligned_cols=9  Identities=44%  Similarity=1.147  Sum_probs=7.0

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      |.|+.||..
T Consensus        94 VlC~~C~sp  102 (125)
T PF01873_consen   94 VLCPECGSP  102 (125)
T ss_dssp             SSCTSTSSS
T ss_pred             EEcCCCCCC
Confidence            778888863


No 435
>KOG3456 consensus NADH:ubiquinone oxidoreductase, NDUFS6/13 kDa subunit [Energy production and conversion]
Probab=24.30  E-value=35  Score=19.88  Aligned_cols=13  Identities=31%  Similarity=0.580  Sum_probs=9.9

Q ss_pred             CCCceecCCCCCe
Q 035423            7 PGDVIQCRECGYR   19 (35)
Q Consensus         7 ~~~~irC~~CG~R   19 (35)
                      .-.+-.|.|||-|
T Consensus       101 k~~~~~CgYCGlr  113 (120)
T KOG3456|consen  101 KPGPHICGYCGLR  113 (120)
T ss_pred             CCCCcccccchhh
Confidence            3445789999988


No 436
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=24.15  E-value=56  Score=14.34  Aligned_cols=10  Identities=40%  Similarity=0.936  Sum_probs=7.6

Q ss_pred             cCCCCCeEEE
Q 035423           13 CRECGYRILY   22 (35)
Q Consensus        13 C~~CG~RIly   22 (35)
                      |..||--|..
T Consensus         6 C~~CGe~I~~   15 (36)
T PF01258_consen    6 CEDCGEPIPE   15 (36)
T ss_dssp             -TTTSSBEEH
T ss_pred             ccccCChHHH
Confidence            9999998864


No 437
>PRK00893 aspartate carbamoyltransferase regulatory subunit; Reviewed
Probab=24.15  E-value=57  Score=19.44  Aligned_cols=14  Identities=14%  Similarity=0.434  Sum_probs=10.9

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      .....||.||+.-+
T Consensus       131 ~~~~~rC~YCe~~~  144 (152)
T PRK00893        131 EPIKLRCKYCEKEF  144 (152)
T ss_pred             CCCEEEeeCCCCEe
Confidence            44578999999864


No 438
>PRK02048 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Provisional
Probab=23.95  E-value=46  Score=23.85  Aligned_cols=18  Identities=33%  Similarity=0.748  Sum_probs=13.4

Q ss_pred             ccCCCCceecCCCCCeEEE
Q 035423            4 TLKPGDVIQCRECGYRILY   22 (35)
Q Consensus         4 ~lk~~~~irC~~CG~RIly   22 (35)
                      .+...+=|.||.||-- ||
T Consensus       512 R~sKTEyISCPsCGRT-Lf  529 (611)
T PRK02048        512 RTSKTEYISCPGCGRT-LY  529 (611)
T ss_pred             ccccceEEECCCCCcc-hh
Confidence            3556778999999954 54


No 439
>COG4307 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.81  E-value=48  Score=22.23  Aligned_cols=15  Identities=27%  Similarity=0.968  Sum_probs=12.0

Q ss_pred             eecCCCCCeEEEeec
Q 035423           11 IQCRECGYRILYKKR   25 (35)
Q Consensus        11 irC~~CG~RIlyK~R   25 (35)
                      ..|+.||-++.|-.+
T Consensus         4 FhC~~CgQ~v~FeN~   18 (349)
T COG4307           4 FHCPNCGQRVAFENS   18 (349)
T ss_pred             ccCCCCCCeeeecch
Confidence            579999999887643


No 440
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=23.76  E-value=43  Score=16.49  Aligned_cols=12  Identities=25%  Similarity=0.634  Sum_probs=7.7

Q ss_pred             CCCceecCCCCC
Q 035423            7 PGDVIQCRECGY   18 (35)
Q Consensus         7 ~~~~irC~~CG~   18 (35)
                      ..++|+...|||
T Consensus        21 ~~~PV~s~~C~H   32 (57)
T PF11789_consen   21 FEDPVKSKKCGH   32 (57)
T ss_dssp             -SSEEEESSS--
T ss_pred             hhCCcCcCCCCC
Confidence            457899999998


No 441
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=23.54  E-value=35  Score=21.82  Aligned_cols=10  Identities=40%  Similarity=1.002  Sum_probs=7.6

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      ..||+||.--
T Consensus         2 ~~CpeCg~~~   11 (285)
T COG1405           2 MSCPECGSTN   11 (285)
T ss_pred             CCCCCCCCcc
Confidence            4699999763


No 442
>COG5319 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.46  E-value=42  Score=20.06  Aligned_cols=12  Identities=25%  Similarity=0.797  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ...+-||-||+-
T Consensus        30 rgLv~CPvCgs~   41 (142)
T COG5319          30 RGLVTCPVCGST   41 (142)
T ss_pred             cCceeCCCCCcH
Confidence            456899999984


No 443
>cd01411 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=23.43  E-value=43  Score=20.09  Aligned_cols=10  Identities=20%  Similarity=0.205  Sum_probs=7.7

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .-+|+.||..
T Consensus       136 ~p~C~~Cgg~  145 (225)
T cd01411         136 SPYHAKCGGV  145 (225)
T ss_pred             CCCCCCCCCE
Confidence            3579999975


No 444
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]
Probab=23.40  E-value=31  Score=23.62  Aligned_cols=17  Identities=29%  Similarity=0.761  Sum_probs=13.7

Q ss_pred             cccCCCCceecCCCCCe
Q 035423            3 NTLKPGDVIQCRECGYR   19 (35)
Q Consensus         3 ~~lk~~~~irC~~CG~R   19 (35)
                      ..|...|+-+||.||-.
T Consensus       277 e~L~g~d~W~CpkC~~k  293 (415)
T COG5533         277 EKLEGKDAWRCPKCGRK  293 (415)
T ss_pred             HhhcCcccccCchhccc
Confidence            34778899999999954


No 445
>PTZ00033 60S ribosomal protein L24; Provisional
Probab=23.38  E-value=36  Score=19.87  Aligned_cols=11  Identities=18%  Similarity=0.549  Sum_probs=8.6

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      ...|-+||+.|
T Consensus         3 ~~~C~Fsg~~I   13 (125)
T PTZ00033          3 TIACEFSHFAV   13 (125)
T ss_pred             eeEecCcCCcc
Confidence            35799999886


No 446
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=23.31  E-value=1.1e+02  Score=17.48  Aligned_cols=9  Identities=33%  Similarity=0.977  Sum_probs=6.4

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      .+||.||..
T Consensus        87 ~~CP~C~s~   95 (115)
T COG0375          87 YRCPKCGSI   95 (115)
T ss_pred             eECCCCCCC
Confidence            349999854


No 447
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=23.26  E-value=66  Score=18.08  Aligned_cols=15  Identities=20%  Similarity=0.408  Sum_probs=10.6

Q ss_pred             ceecCCCCCeEEEeec
Q 035423           10 VIQCRECGYRILYKKR   25 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R   25 (35)
                      ..||+.|+.. |-+..
T Consensus        91 ~sRC~~CN~~-L~~v~  105 (147)
T PF01927_consen   91 FSRCPKCNGP-LRPVS  105 (147)
T ss_pred             CCccCCCCcE-eeech
Confidence            5799999995 54443


No 448
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=23.25  E-value=32  Score=23.48  Aligned_cols=14  Identities=21%  Similarity=0.529  Sum_probs=9.3

Q ss_pred             cCCCCc--eecCCCCC
Q 035423            5 LKPGDV--IQCRECGY   18 (35)
Q Consensus         5 lk~~~~--irC~~CG~   18 (35)
                      |..+..  .+||||--
T Consensus       367 LS~ng~~sfKCPYCP~  382 (394)
T KOG2817|consen  367 LSKNGSQSFKCPYCPV  382 (394)
T ss_pred             HhhCCCeeeeCCCCCc
Confidence            334444  89999964


No 449
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=23.24  E-value=37  Score=22.13  Aligned_cols=8  Identities=50%  Similarity=1.107  Sum_probs=3.5

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      -+||.||.
T Consensus        15 g~cp~c~~   22 (372)
T cd01121          15 GKCPECGE   22 (372)
T ss_pred             EECcCCCC
Confidence            03555554


No 450
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=23.24  E-value=62  Score=16.20  Aligned_cols=15  Identities=20%  Similarity=0.574  Sum_probs=10.8

Q ss_pred             CCCceecCCCCCeEE
Q 035423            7 PGDVIQCRECGYRIL   21 (35)
Q Consensus         7 ~~~~irC~~CG~RIl   21 (35)
                      +..-..|+.|+-.|.
T Consensus         4 ks~Ra~Ck~C~~~I~   18 (82)
T PF00645_consen    4 KSGRAKCKGCKKKIA   18 (82)
T ss_dssp             SSSTEBETTTSCBE-
T ss_pred             CCCCccCcccCCcCC
Confidence            345578999998874


No 451
>PRK05776 DNA topoisomerase I; Provisional
Probab=23.14  E-value=58  Score=22.93  Aligned_cols=11  Identities=36%  Similarity=0.842  Sum_probs=9.1

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      ...||.||...
T Consensus       596 ~~~Cp~Cg~~l  606 (670)
T PRK05776        596 VGKCKICGREA  606 (670)
T ss_pred             CCcCCCCCCcc
Confidence            45899999876


No 452
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=23.13  E-value=34  Score=21.14  Aligned_cols=11  Identities=27%  Similarity=0.537  Sum_probs=7.9

Q ss_pred             ecCCCCCeEEE
Q 035423           12 QCRECGYRILY   22 (35)
Q Consensus        12 rC~~CG~RIly   22 (35)
                      -|+.||.....
T Consensus       101 fC~~CG~~~~~  111 (256)
T PRK00241        101 FCGYCGHPMHP  111 (256)
T ss_pred             cccccCCCCee
Confidence            58888887543


No 453
>PTZ00074 60S ribosomal protein L34; Provisional
Probab=23.13  E-value=48  Score=19.49  Aligned_cols=15  Identities=27%  Similarity=0.647  Sum_probs=11.2

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      +....-+|..||-++
T Consensus        37 K~~~~pkC~~cg~~L   51 (135)
T PTZ00074         37 KKSSGPKCGDCGKVL   51 (135)
T ss_pred             cCCCCCCCCCCCCcc
Confidence            345667899999874


No 454
>PHA02325 hypothetical protein
Probab=23.02  E-value=63  Score=17.31  Aligned_cols=13  Identities=46%  Similarity=0.905  Sum_probs=9.6

Q ss_pred             CceecCCCCCeEE
Q 035423            9 DVIQCRECGYRIL   21 (35)
Q Consensus         9 ~~irC~~CG~RIl   21 (35)
                      +.-.||.||-+-|
T Consensus         2 ~~k~CPkC~A~Wl   14 (72)
T PHA02325          2 DTKICPKCGARWL   14 (72)
T ss_pred             CccccCccCCEeE
Confidence            3457999998754


No 455
>PF11331 DUF3133:  Protein of unknown function (DUF3133);  InterPro: IPR021480  This eukaryotic family of proteins has no known function. 
Probab=22.89  E-value=84  Score=15.29  Aligned_cols=18  Identities=11%  Similarity=0.429  Sum_probs=14.4

Q ss_pred             CCceecCCCCCeEEEeec
Q 035423            8 GDVIQCRECGYRILYKKR   25 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK~R   25 (35)
                      ...+||-.|+.=|-|+.|
T Consensus        29 ~~klrCGaCs~vl~~s~~   46 (46)
T PF11331_consen   29 QQKLRCGACSEVLSFSLP   46 (46)
T ss_pred             eeEEeCCCCceeEEEecC
Confidence            457899999998888754


No 456
>PRK07219 DNA topoisomerase I; Validated
Probab=22.86  E-value=52  Score=23.58  Aligned_cols=16  Identities=25%  Similarity=0.696  Sum_probs=12.8

Q ss_pred             ceecCCCCCeEEEeec
Q 035423           10 VIQCRECGYRILYKKR   25 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R   25 (35)
                      ...||.||..++++.-
T Consensus       602 ~~~CP~Cg~~l~~r~~  617 (822)
T PRK07219        602 IGKCPECGGDLIIIRT  617 (822)
T ss_pred             cCcCCCCCCcceeeec
Confidence            4689999998887753


No 457
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=22.77  E-value=47  Score=19.58  Aligned_cols=11  Identities=36%  Similarity=0.869  Sum_probs=8.5

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..-+||.||..
T Consensus       132 ~~p~C~~Cg~~  142 (218)
T cd01407         132 EVPRCPKCGGL  142 (218)
T ss_pred             CCCcCCCCCCc
Confidence            45689999976


No 458
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=22.76  E-value=36  Score=21.13  Aligned_cols=12  Identities=25%  Similarity=0.639  Sum_probs=9.2

Q ss_pred             ceecCCCCCeEE
Q 035423           10 VIQCRECGYRIL   21 (35)
Q Consensus        10 ~irC~~CG~RIl   21 (35)
                      ...||-|+.+|=
T Consensus       167 ~~~CP~C~kkIt  178 (187)
T KOG0320|consen  167 TNKCPTCRKKIT  178 (187)
T ss_pred             CCCCCCcccccc
Confidence            568999998763


No 459
>TIGR00433 bioB biotin synthetase. Catalyzes the last step of the biotin biosynthesis pathway.
Probab=22.72  E-value=31  Score=20.69  Aligned_cols=16  Identities=25%  Similarity=0.389  Sum_probs=12.5

Q ss_pred             CCceecCCCCCeEEEe
Q 035423            8 GDVIQCRECGYRILYK   23 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK   23 (35)
                      +=+.+|.+|+....++
T Consensus        38 ~C~~~C~fC~~~~~~~   53 (296)
T TIGR00433        38 GCPEDCKYCSQSSRSK   53 (296)
T ss_pred             CCCCCCcCCCCcccCC
Confidence            3467899999988774


No 460
>PF10238 Eapp_C:  E2F-associated phosphoprotein;  InterPro: IPR019370 This entry represents E2F binding proteins. E2F transcription factors play an essential role in cell proliferation and apoptosis and their activity is frequently deregulated in human cancers. E2F activity is regulated by a variety of mechanisms, frequently mediated by proteins binding to individual members or a subgroup of the family. E2F-associated phosphoprotein (EAPP)interacts with a subset of E2F factors and influences E2F-dependent promoter activity. EAPP is present throughout the cell cycle but disappears during mitosis []. 
Probab=22.61  E-value=54  Score=19.06  Aligned_cols=20  Identities=15%  Similarity=0.463  Sum_probs=15.6

Q ss_pred             CCCCceecCCCCCeEEEeec
Q 035423            6 KPGDVIQCRECGYRILYKKR   25 (35)
Q Consensus         6 k~~~~irC~~CG~RIlyK~R   25 (35)
                      ...-+|.|..|+.-|=+--.
T Consensus       105 e~yhPV~Cs~C~TeVaV~D~  124 (136)
T PF10238_consen  105 ETYHPVKCSECSTEVAVYDK  124 (136)
T ss_pred             ccEeceecccCCCEEEEEec
Confidence            35668999999998876653


No 461
>TIGR01051 topA_bact DNA topoisomerase I, bacterial. This model describes DNA topoisomerase I among the members of bacteria. DNA topoisomerase I transiently cleaves one DNA strand and thus relaxes negatively supercoiled DNA during replication, transcription and recombination events.
Probab=22.54  E-value=64  Score=22.29  Aligned_cols=14  Identities=29%  Similarity=0.631  Sum_probs=10.7

Q ss_pred             eecCCCCCeEEEee
Q 035423           11 IQCRECGYRILYKK   24 (35)
Q Consensus        11 irC~~CG~RIlyK~   24 (35)
                      ..||.||..++.++
T Consensus       575 ~~CP~Cg~~~~~~~  588 (610)
T TIGR01051       575 QDCPLCGRPMVVKL  588 (610)
T ss_pred             CCCCCCCCeeEEEe
Confidence            57999999876433


No 462
>PRK07220 DNA topoisomerase I; Validated
Probab=22.52  E-value=62  Score=23.00  Aligned_cols=15  Identities=20%  Similarity=0.749  Sum_probs=11.4

Q ss_pred             ceecCCCCCeEEEee
Q 035423           10 VIQCRECGYRILYKK   24 (35)
Q Consensus        10 ~irC~~CG~RIlyK~   24 (35)
                      ...||.||..++.+.
T Consensus       589 ~~~CP~Cg~~l~~r~  603 (740)
T PRK07220        589 IGKCPLCGSDLMVRR  603 (740)
T ss_pred             ccccccCCCeeeEEe
Confidence            358999998877653


No 463
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=22.45  E-value=42  Score=18.47  Aligned_cols=11  Identities=45%  Similarity=0.884  Sum_probs=8.0

Q ss_pred             eecCCCCCeEE
Q 035423           11 IQCRECGYRIL   21 (35)
Q Consensus        11 irC~~CG~RIl   21 (35)
                      -.|..||..||
T Consensus        70 GiCamCGKki~   80 (90)
T PF10235_consen   70 GICAMCGKKIL   80 (90)
T ss_pred             CcccccCCeec
Confidence            36788888775


No 464
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=22.36  E-value=51  Score=18.94  Aligned_cols=10  Identities=40%  Similarity=0.969  Sum_probs=7.7

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      =|-|+.||..
T Consensus        97 yVlC~~C~sP  106 (133)
T TIGR00311        97 YVICRECNRP  106 (133)
T ss_pred             eEECCCCCCC
Confidence            4789999874


No 465
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=22.29  E-value=35  Score=22.47  Aligned_cols=16  Identities=38%  Similarity=0.821  Sum_probs=11.1

Q ss_pred             CCCceecCCCCCeEEEe
Q 035423            7 PGDVIQCRECGYRILYK   23 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK   23 (35)
                      .+--++||.||.= ||.
T Consensus        25 e~lw~KCp~c~~~-~y~   40 (294)
T COG0777          25 EGLWTKCPSCGEM-LYR   40 (294)
T ss_pred             CCceeECCCccce-eeH
Confidence            3445799999985 443


No 466
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=22.25  E-value=78  Score=15.59  Aligned_cols=13  Identities=23%  Similarity=1.124  Sum_probs=9.9

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      .+.|..||..-++
T Consensus         4 ~l~C~dCg~~Fvf   16 (49)
T PF13451_consen    4 TLTCKDCGAEFVF   16 (49)
T ss_pred             eEEcccCCCeEEE
Confidence            5789999987554


No 467
>PF01430 HSP33:  Hsp33 protein;  InterPro: IPR000397 Hsp33 is a molecular chaperone, distinguished from all other known chaperones by its mode of functional regulation. Its activity is redox regulated. Hsp33 is a cytoplasmically localized protein with highly reactive cysteines that respond quickly to changes in the redox environment. Oxidizing conditions like H2O2 cause disulphide bonds to form in Hsp33, a process that leads to the activation of its chaperone function [].; GO: 0051082 unfolded protein binding, 0006457 protein folding, 0005737 cytoplasm; PDB: 1VZY_B 1VQ0_A 1I7F_A 3M7M_X 1XJH_A 1HW7_A.
Probab=22.20  E-value=63  Score=20.00  Aligned_cols=14  Identities=21%  Similarity=0.626  Sum_probs=8.4

Q ss_pred             CceecCCCCCeEEE
Q 035423            9 DVIQCRECGYRILY   22 (35)
Q Consensus         9 ~~irC~~CG~RIly   22 (35)
                      -.|.|.+||.+-.|
T Consensus       265 iev~C~fC~~~Y~f  278 (280)
T PF01430_consen  265 IEVTCEFCGKKYRF  278 (280)
T ss_dssp             EEEE-TTT--EEEE
T ss_pred             EEEEeeCCCCEEEe
Confidence            46899999988655


No 468
>PF04135 Nop10p:  Nucleolar RNA-binding protein, Nop10p family;  InterPro: IPR007264 H/ACA ribonucleoprotein particles (RNPs) are a family of RNA pseudouridine synthases that specify modification sites through guide RNAs. More than 100 mammalian H/ACA RNAs form an equal number of ribonucleoproteins (RNPs) by associating with the same four core proteins: Cbf5, Gar1, Nhp2 and Nop10. The function of these H/ACA RNPs is essential for biogenesis of the ribosome, splicing of precursor mRNAs (pre-mRNAs), maintenance of telomeres and probably for additional cellular processes []. Recent crystal structures of archaeal H/ACA protein complexes show how the same four proteins accommodate >100 distinct but related H/ACA RNAs []. The complex contains a stable core composed of Cbf5 and Nop10, to which Gar1 and Nhp2 subsequently bind, the complex interacts with snoRNAs []. In eukaryotes Nop10 is a nucleolar protein that is specifically associated with H/ACA snoRNAs. It is essential for normal 18S rRNA production and rRNA pseudouridylation by the ribonucleoprotein particles containing H/ACA snoRNAs (H/ACA snoRNPs). Nop10 is probably necessary for the stability of these RNPs [].; PDB: 2RFK_B 3LWR_B 2HVY_C 3HAX_C 3MQK_B 3LWO_B 3LWV_B 3HAY_C 3HJY_B 2EY4_E ....
Probab=22.13  E-value=44  Score=16.73  Aligned_cols=8  Identities=38%  Similarity=1.032  Sum_probs=6.4

Q ss_pred             ecCCCCCe
Q 035423           12 QCRECGYR   19 (35)
Q Consensus        12 rC~~CG~R   19 (35)
                      .||.||.-
T Consensus        19 ~cp~cG~~   26 (53)
T PF04135_consen   19 KCPPCGGP   26 (53)
T ss_dssp             BBTTTSSB
T ss_pred             ccCCCCCC
Confidence            79999964


No 469
>PF04060 FeS:  Putative Fe-S cluster;  InterPro: IPR007202 These proteins contain a domain with four conserved cysteines that probably form an Fe-S redox cluster.; GO: 0051536 iron-sulfur cluster binding; PDB: 2YCL_A 4DJF_E 4DJD_C 4DJE_C.
Probab=21.96  E-value=42  Score=15.09  Aligned_cols=11  Identities=36%  Similarity=0.957  Sum_probs=4.7

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      +..-|-.|||.
T Consensus         3 P~~nCg~CG~~   13 (35)
T PF04060_consen    3 PGTNCGACGYP   13 (35)
T ss_dssp             -S----TTSSS
T ss_pred             CCCcCCCCCCc
Confidence            45679999985


No 470
>PRK12495 hypothetical protein; Provisional
Probab=21.87  E-value=34  Score=21.76  Aligned_cols=12  Identities=42%  Similarity=0.927  Sum_probs=10.1

Q ss_pred             ceecCCCCCeEE
Q 035423           10 VIQCRECGYRIL   21 (35)
Q Consensus        10 ~irC~~CG~RIl   21 (35)
                      ...|+.||.-|.
T Consensus        42 a~hC~~CG~PIp   53 (226)
T PRK12495         42 NAHCDECGDPIF   53 (226)
T ss_pred             hhhcccccCccc
Confidence            457999999987


No 471
>KOG3125 consensus Thymidine kinase [Nucleotide transport and metabolism]
Probab=21.84  E-value=56  Score=20.95  Aligned_cols=24  Identities=25%  Similarity=0.452  Sum_probs=19.2

Q ss_pred             ceecCCCCCeEEEeecCCceEEEE
Q 035423           10 VIQCRECGYRILYKKRTRRIVQYE   33 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R~~~~~~~~   33 (35)
                      .++|-+||++-.|-.|...-+.++
T Consensus       165 tavC~~Cg~~a~Ft~R~~~~K~ve  188 (234)
T KOG3125|consen  165 TAVCEECGADARFTLRKTNDKEVE  188 (234)
T ss_pred             hhhhhhhcccceeEeeecCCceeE
Confidence            378999999999999987655543


No 472
>COG4469 CoiA Competence protein CoiA-like family, contains a predicted nuclease    domain [General function prediction only]
Probab=21.75  E-value=52  Score=22.09  Aligned_cols=20  Identities=25%  Similarity=0.617  Sum_probs=15.6

Q ss_pred             ceecCCCCCeEEEeecCCce
Q 035423           10 VIQCRECGYRILYKKRTRRI   29 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R~~~~   29 (35)
                      ...||.||..++.|.=+.++
T Consensus        25 ~ffCPaC~~~l~lK~G~~k~   44 (342)
T COG4469          25 RFFCPACGSQLILKQGLIKI   44 (342)
T ss_pred             ccccCCCCCeeeeecCcccc
Confidence            47899999999988654443


No 473
>cd00296 SIR2 SIR2 superfamily of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer. Also included in this superfamily is a group of uncharacterized Sir2-like proteins which lack certain key catalytic
Probab=21.75  E-value=41  Score=19.37  Aligned_cols=11  Identities=27%  Similarity=0.646  Sum_probs=8.0

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..-+|+.||..
T Consensus       133 ~~p~C~~C~~~  143 (222)
T cd00296         133 KPPRCPKCGGL  143 (222)
T ss_pred             CCCCCCCCCCc
Confidence            34579999875


No 474
>PRK04351 hypothetical protein; Provisional
Probab=21.65  E-value=1.1e+02  Score=17.68  Aligned_cols=15  Identities=33%  Similarity=0.795  Sum_probs=10.1

Q ss_pred             CceecCCCCCeEEEe
Q 035423            9 DVIQCRECGYRILYK   23 (35)
Q Consensus         9 ~~irC~~CG~RIlyK   23 (35)
                      -..+|..||+-++=.
T Consensus       111 y~Y~C~~Cg~~~~r~  125 (149)
T PRK04351        111 YLYECQSCGQQYLRK  125 (149)
T ss_pred             EEEECCCCCCEeeee
Confidence            346888888766543


No 475
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=21.64  E-value=42  Score=13.73  Aligned_cols=10  Identities=40%  Similarity=0.949  Sum_probs=6.7

Q ss_pred             ecCCCCCeEE
Q 035423           12 QCRECGYRIL   21 (35)
Q Consensus        12 rC~~CG~RIl   21 (35)
                      +|..|+..|.
T Consensus         1 ~C~~C~~~i~   10 (39)
T smart00132        1 KCAGCGKPIR   10 (39)
T ss_pred             CccccCCccc
Confidence            5777777654


No 476
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=21.41  E-value=42  Score=23.16  Aligned_cols=9  Identities=33%  Similarity=0.973  Sum_probs=7.1

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      -.||.||.+
T Consensus       539 ~~CP~Cgs~  547 (579)
T TIGR02487       539 DKCPKCGSH  547 (579)
T ss_pred             CcCcCCCCc
Confidence            379999964


No 477
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=21.19  E-value=68  Score=22.86  Aligned_cols=17  Identities=24%  Similarity=0.671  Sum_probs=14.1

Q ss_pred             CCceecCCCCCeEEEee
Q 035423            8 GDVIQCRECGYRILYKK   24 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK~   24 (35)
                      ..++-|+.||=|+.+..
T Consensus       138 ~~~~~C~~Cgp~l~l~~  154 (711)
T TIGR00143       138 AQPIACPRCGPQLNFVS  154 (711)
T ss_pred             CCCccCCCCCcEEEEEe
Confidence            47899999999987744


No 478
>COG1601 GCD7 Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain [Translation, ribosomal structure and biogenesis]
Probab=21.00  E-value=47  Score=19.64  Aligned_cols=9  Identities=44%  Similarity=1.387  Sum_probs=7.1

Q ss_pred             ceecCCCCC
Q 035423           10 VIQCRECGY   18 (35)
Q Consensus        10 ~irC~~CG~   18 (35)
                      -++|+.||.
T Consensus       105 yv~C~~c~s  113 (151)
T COG1601         105 YVKCKECGS  113 (151)
T ss_pred             eeEeccCCC
Confidence            478999986


No 479
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=20.98  E-value=46  Score=19.89  Aligned_cols=11  Identities=36%  Similarity=0.863  Sum_probs=8.3

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..-+||.||..
T Consensus       135 ~~p~C~~Cgg~  145 (222)
T cd01413         135 EVPRCPKCGGI  145 (222)
T ss_pred             CCCcCCCCCCc
Confidence            34689999975


No 480
>PF03470 zf-XS:  XS zinc finger domain;  InterPro: IPR005381 This domain is a putative nucleic acid binding zinc finger and is found at the N terminus of proteins that also contain an adjacent XS domain IPR005380 from INTERPRO and in some proteins a C-terminal XH domain IPR005379 from INTERPRO.
Probab=20.90  E-value=43  Score=16.25  Aligned_cols=7  Identities=29%  Similarity=0.728  Sum_probs=5.3

Q ss_pred             cCCCCCe
Q 035423           13 CRECGYR   19 (35)
Q Consensus        13 C~~CG~R   19 (35)
                      ||+|-.+
T Consensus         1 CP~C~~k    7 (43)
T PF03470_consen    1 CPFCPGK    7 (43)
T ss_pred             CCCCCCC
Confidence            8899664


No 481
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=20.86  E-value=44  Score=22.68  Aligned_cols=19  Identities=37%  Similarity=0.679  Sum_probs=13.6

Q ss_pred             cCCCCceecCCCCCeEEEee
Q 035423            5 LKPGDVIQCRECGYRILYKK   24 (35)
Q Consensus         5 lk~~~~irC~~CG~RIlyK~   24 (35)
                      |...-..||+.|.| ||.|.
T Consensus       293 L~~KrSkRC~~C~h-~L~KP  311 (483)
T PF05502_consen  293 LRTKRSKRCRQCRH-ILSKP  311 (483)
T ss_pred             eeceeehhhhcccC-ceECC
Confidence            44555679999987 56664


No 482
>PRK08780 DNA topoisomerase I; Provisional
Probab=20.74  E-value=77  Score=22.75  Aligned_cols=14  Identities=7%  Similarity=-0.073  Sum_probs=11.4

Q ss_pred             eecCCCCCeEEEee
Q 035423           11 IQCRECGYRILYKK   24 (35)
Q Consensus        11 irC~~CG~RIlyK~   24 (35)
                      -.||.||..++.+.
T Consensus       592 G~cP~CG~~l~~r~  605 (780)
T PRK08780        592 GTDPKSGKPVSVRI  605 (780)
T ss_pred             CCCCCCCCEEEEEe
Confidence            38999999987764


No 483
>PF08421 Methyltransf_13:  Putative zinc binding domain;  InterPro: IPR013630 This domain is found at the N terminus of bacterial methyltransferases. ; PDB: 4E2X_A 3NDJ_A 3NDI_A 4E32_A 4E33_A 4E31_A 4E2Y_A 4E2W_A 4E2Z_A 4E30_A.
Probab=20.61  E-value=83  Score=15.44  Aligned_cols=10  Identities=50%  Similarity=0.919  Sum_probs=5.3

Q ss_pred             cCCCCCeEEE
Q 035423           13 CRECGYRILY   22 (35)
Q Consensus        13 C~~CG~RIly   22 (35)
                      |+.||...|-
T Consensus         1 CR~Cgs~~l~   10 (62)
T PF08421_consen    1 CRICGSSDLK   10 (62)
T ss_dssp             -TTTS-E-EE
T ss_pred             CCCCCCCccc
Confidence            7889988653


No 484
>cd02757 MopB_Arsenate-R This CD includes the respiratory arsenate reductase, As(V), catalytic subunit (ArrA) and other related proteins. These members belong to the molybdopterin_binding (MopB) superfamily of proteins.
Probab=20.60  E-value=1.5e+02  Score=19.73  Aligned_cols=23  Identities=17%  Similarity=0.407  Sum_probs=16.6

Q ss_pred             ecCCCC--CeEEEeecCCceEEEEe
Q 035423           12 QCRECG--YRILYKKRTRRIVQYEA   34 (35)
Q Consensus        12 rC~~CG--~RIlyK~R~~~~~~~~A   34 (35)
                      -|+.|+  +-|+...+..+++.++.
T Consensus         5 ~C~~C~~~C~l~v~v~dg~v~kv~g   29 (523)
T cd02757           5 TCQGCTAWCGLQAYVEDGRVTKVEG   29 (523)
T ss_pred             cCcCCcCCCCeEEEEECCEEEEEEC
Confidence            477776  56888888777777653


No 485
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=20.59  E-value=43  Score=23.53  Aligned_cols=9  Identities=33%  Similarity=0.992  Sum_probs=6.8

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      -.||.||..
T Consensus       573 ~~CP~CG~~  581 (618)
T PRK14704        573 NECPSCGNE  581 (618)
T ss_pred             ccCcCCCCC
Confidence            379999963


No 486
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.56  E-value=34  Score=22.30  Aligned_cols=14  Identities=36%  Similarity=0.534  Sum_probs=11.3

Q ss_pred             CCCCceecCCCCCe
Q 035423            6 KPGDVIQCRECGYR   19 (35)
Q Consensus         6 k~~~~irC~~CG~R   19 (35)
                      -.++.+-||.|+|-
T Consensus        58 ~fY~VvvCP~C~yA   71 (267)
T COG1655          58 YFYDVVVCPICYYA   71 (267)
T ss_pred             ceeEEEEcchhhHH
Confidence            45678999999974


No 487
>KOG3940 consensus Uncharacterized conserved protein [Function unknown]
Probab=20.53  E-value=58  Score=22.00  Aligned_cols=11  Identities=45%  Similarity=1.126  Sum_probs=9.2

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      +.+.||+||-|
T Consensus       321 s~~~Cp~cg~r  331 (351)
T KOG3940|consen  321 SYVQCPHCGRR  331 (351)
T ss_pred             CcccCcccccc
Confidence            45899999987


No 488
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=20.40  E-value=57  Score=19.60  Aligned_cols=10  Identities=40%  Similarity=1.072  Sum_probs=7.3

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      =|.|++||.-
T Consensus        98 yV~C~~C~~p  107 (201)
T PRK12336         98 YVICSECGLP  107 (201)
T ss_pred             eEECCCCCCC
Confidence            4788888863


No 489
>PRK09129 NADH dehydrogenase subunit G; Validated
Probab=20.26  E-value=1.5e+02  Score=20.74  Aligned_cols=24  Identities=8%  Similarity=0.171  Sum_probs=18.1

Q ss_pred             eecCCC--CCeEEEeecCCceEEEEe
Q 035423           11 IQCREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        11 irC~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      --|++|  |+.|.+..+..+++.++.
T Consensus       220 t~C~~C~~gC~i~v~v~~g~i~rv~g  245 (776)
T PRK09129        220 SVSPHDSLGSNLVVHVKNNRVMRVVP  245 (776)
T ss_pred             ccCCCCCCCCCeEEEEECCEEEEeec
Confidence            359999  678888888777777653


No 490
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=20.23  E-value=45  Score=19.05  Aligned_cols=12  Identities=25%  Similarity=0.415  Sum_probs=9.1

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ++...||+|.++
T Consensus        78 ~~~~~Cp~C~sp   89 (105)
T COG4357          78 GMCGSCPYCQSP   89 (105)
T ss_pred             hhcCCCCCcCCC
Confidence            346789999876


No 491
>PF13597 NRDD:  Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A.
Probab=20.22  E-value=74  Score=21.81  Aligned_cols=13  Identities=31%  Similarity=0.588  Sum_probs=5.9

Q ss_pred             ceecCCCCCe-EEE
Q 035423           10 VIQCRECGYR-ILY   22 (35)
Q Consensus        10 ~irC~~CG~R-Ily   22 (35)
                      .-.||.||.. |-+
T Consensus       504 ~~~CP~CGs~~~~~  517 (546)
T PF13597_consen  504 GDKCPKCGSENIEV  517 (546)
T ss_dssp             EEE-CCC----EEE
T ss_pred             CCCCCCCCCcccce
Confidence            5579999988 443


No 492
>cd02763 MopB_2 The MopB_2 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. These members belong to the molybdopterin_binding (MopB) superfamily of proteins
Probab=20.03  E-value=1.4e+02  Score=21.11  Aligned_cols=23  Identities=17%  Similarity=0.330  Sum_probs=17.2

Q ss_pred             ecCCC--CCeEEEeecCCceEEEEe
Q 035423           12 QCREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        12 rC~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      -|++|  |+.|....|.-+++.++.
T Consensus         3 ~C~~C~~gCgi~v~v~dG~v~~I~g   27 (679)
T cd02763           3 TCYMCACRCGIRVHLRDGKVRYIKG   27 (679)
T ss_pred             cCCCCcCCCCeEEEEECCEEEEEEc
Confidence            37777  788888888777777663


No 493
>smart00532 LIGANc Ligase N family.
Probab=20.01  E-value=61  Score=21.85  Aligned_cols=14  Identities=21%  Similarity=0.619  Sum_probs=11.4

Q ss_pred             CceecCCCCCeEEE
Q 035423            9 DVIQCRECGYRILY   22 (35)
Q Consensus         9 ~~irC~~CG~RIly   22 (35)
                      .+-.||.||..+..
T Consensus       398 ~P~~CP~C~s~l~~  411 (441)
T smart00532      398 MPTHCPSCGSELVR  411 (441)
T ss_pred             CCCCCCCCCCEeEe
Confidence            47899999999753


Done!