Query         035423
Match_columns 35
No_of_seqs    100 out of 153
Neff          4.7 
Searched_HMMs 29240
Date          Mon Mar 25 04:02:17 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035423.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/035423hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3h0g_L DNA-directed RNA polyme  99.8 8.8E-21   3E-25   98.5   1.7   35    1-35     29-63  (63)
  2 1twf_L ABC10-alpha, DNA-direct  99.7 3.9E-19 1.3E-23   93.2   1.3   34    2-35     37-70  (70)
  3 4ayb_P DNA-directed RNA polyme  99.5 1.4E-14 4.9E-19   72.2   2.9   33    2-34     15-47  (48)
  4 3na7_A HP0958; flagellar bioge  96.0  0.0034 1.2E-07   37.2   2.1   19    7-26    219-237 (256)
  5 2odx_A Cytochrome C oxidase po  93.7   0.047 1.6E-06   28.6   2.4   15    5-19     51-65  (80)
  6 1v54_F VI, cytochrome C oxidas  92.9   0.055 1.9E-06   29.2   1.9   17    5-23     74-90  (98)
  7 2lcq_A Putative toxin VAPC6; P  91.8   0.077 2.6E-06   29.3   1.7   17    9-25    147-163 (165)
  8 2jvm_A Uncharacterized protein  91.7    0.11 3.6E-06   27.6   2.0   17    7-23     50-66  (80)
  9 2y69_F Cytochrome C oxidase su  91.1    0.11 3.9E-06   29.4   1.9   15    5-19    105-119 (129)
 10 2jrr_A Uncharacterized protein  90.6    0.13 4.5E-06   26.3   1.7   17    7-23     37-53  (67)
 11 2jz8_A Uncharacterized protein  90.5    0.13 4.4E-06   27.6   1.7   20    5-24     43-62  (87)
 12 2i5o_A DNA polymerase ETA; zin  88.5    0.29   1E-05   22.6   1.9   20    4-23      3-22  (39)
 13 1hxr_A Guanine nucleotide exch  87.0    0.35 1.2E-05   26.5   1.9   19    6-24      8-26  (115)
 14 1qyp_A RNA polymerase II; tran  86.5    0.31 1.1E-05   23.1   1.4   13   10-22     15-27  (57)
 15 1gh9_A 8.3 kDa protein (gene M  84.3    0.27 9.3E-06   25.1   0.6   18    9-27     20-37  (71)
 16 1tfi_A Transcriptional elongat  82.8    0.45 1.5E-05   22.6   1.0   14    8-21      7-20  (50)
 17 1pft_A TFIIB, PFTFIIBN; N-term  79.7     1.3 4.4E-05   20.3   1.9   15   11-25      6-21  (50)
 18 1rik_A E6APC1 peptide; E6-bind  78.0     1.1 3.8E-05   16.4   1.2   10   10-19      2-11  (29)
 19 1vq8_Z 50S ribosomal protein L  77.3    0.58   2E-05   24.4   0.3   21    4-24     21-41  (83)
 20 2kvh_A Zinc finger and BTB dom  76.9     1.2 4.3E-05   16.2   1.2   10   10-19      3-12  (27)
 21 1dl6_A Transcription factor II  76.4     1.2 4.1E-05   21.5   1.3   15    9-23     10-25  (58)
 22 3h0g_I DNA-directed RNA polyme  75.9     1.3 4.3E-05   23.7   1.5   10   10-19     72-81  (113)
 23 2kvf_A Zinc finger and BTB dom  73.9     1.7 5.9E-05   15.8   1.3   10   10-19      3-12  (28)
 24 3j20_Y 30S ribosomal protein S  73.1     2.7 9.1E-05   19.9   2.1   13   12-24     21-33  (50)
 25 2m0d_A Zinc finger and BTB dom  73.0     1.6 5.6E-05   15.8   1.1   10   10-19      3-12  (30)
 26 2gag_D Heterotetrameric sarcos  72.3    0.89   3E-05   24.7   0.3   10   10-19      3-12  (99)
 27 2kvg_A Zinc finger and BTB dom  71.9     1.4 4.9E-05   16.2   0.8   10   10-19      3-12  (27)
 28 2m0e_A Zinc finger and BTB dom  71.7     1.4 4.7E-05   15.9   0.7   10   10-19      2-11  (29)
 29 3o9x_A Uncharacterized HTH-typ  71.5     1.8 6.1E-05   22.4   1.3   12   11-22      3-14  (133)
 30 2lvu_A Zinc finger and BTB dom  73.3    0.88   3E-05   16.5   0.0   12   10-21      2-13  (26)
 31 2m0f_A Zinc finger and BTB dom  69.8     2.1 7.1E-05   15.4   1.1   10   10-19      2-11  (29)
 32 1znf_A 31ST zinc finger from X  69.7     1.8 6.1E-05   15.5   0.8    9   11-19      2-10  (27)
 33 1klr_A Zinc finger Y-chromosom  69.6     1.6 5.5E-05   15.8   0.7   10   10-19      2-11  (30)
 34 1paa_A Yeast transcription fac  68.7     1.9 6.3E-05   15.8   0.8   10   10-19      2-11  (30)
 35 1p7a_A BF3, BKLF, kruppel-like  68.5     1.9 6.6E-05   16.8   0.9   11    9-19     10-20  (37)
 36 3po3_S Transcription elongatio  67.9     1.6 5.5E-05   25.1   0.7   14    8-21    135-148 (178)
 37 1ard_A Yeast transcription fac  67.8     2.1 7.2E-05   15.5   0.9   10   10-19      2-11  (29)
 38 3j21_g 50S ribosomal protein L  67.1     2.3 7.7E-05   20.5   1.1   11    9-19     27-37  (51)
 39 2l8e_A Polyhomeotic-like prote  67.1     4.2 0.00014   19.3   2.1   12   11-22     19-30  (49)
 40 1kaf_A Transcription regulator  66.5       5 0.00017   22.2   2.5   18   18-35     35-52  (108)
 41 2elt_A Zinc finger protein 406  66.1     5.2 0.00018   15.2   2.1   12    8-19      7-18  (36)
 42 3r8s_0 50S ribosomal protein L  66.1     5.2 0.00018   19.3   2.3   16    5-20     21-37  (56)
 43 2poi_A Baculoviral IAP repeat-  66.0     3.2 0.00011   21.7   1.6   14    7-20     52-65  (94)
 44 2elx_A Zinc finger protein 406  65.9     3.1 0.00011   15.8   1.3   11    9-19      6-16  (35)
 45 2elq_A Zinc finger protein 406  65.8       3  0.0001   16.1   1.2   13    8-20      7-19  (36)
 46 2l7x_A Envelope glycoprotein;   65.4     1.8   6E-05   22.8   0.5   10   11-20     31-40  (77)
 47 1ef4_A Subunit N, DNA-directed  65.3     1.6 5.5E-05   21.6   0.3   12    9-20      2-13  (55)
 48 1lv3_A Hypothetical protein YA  65.2     4.3 0.00015   20.6   2.0   18    6-23      5-22  (68)
 49 1l8d_A DNA double-strand break  65.1     3.5 0.00012   21.2   1.6   11   10-20     47-57  (112)
 50 1srk_A Zinc finger protein ZFP  65.1     3.3 0.00011   15.8   1.3   12    9-20      6-17  (35)
 51 2els_A Zinc finger protein 406  65.1     4.8 0.00017   15.5   1.8   12    8-19      7-18  (36)
 52 2elp_A Zinc finger protein 406  64.3     3.4 0.00011   16.1   1.2   12    9-20      8-19  (37)
 53 3ga8_A HTH-type transcriptiona  64.1     3.2 0.00011   20.4   1.3   12   11-22      3-14  (78)
 54 1twf_I B12.6, DNA-directed RNA  63.5     2.9 9.8E-05   22.5   1.2   10   10-19     72-81  (122)
 55 2ct7_A Ring finger protein 31;  63.2     7.2 0.00024   19.5   2.6   15    7-21     21-36  (86)
 56 2kdx_A HYPA, hydrogenase/ureas  63.0     1.9 6.6E-05   22.8   0.4   13   10-22     89-102 (119)
 57 2gmg_A Hypothetical protein PF  62.4     2.9  0.0001   22.8   1.1   12    8-19     82-93  (105)
 58 2qkd_A Zinc finger protein ZPR  62.4     2.9 9.9E-05   27.0   1.2   10   10-19     41-50  (404)
 59 2elv_A Zinc finger protein 406  62.4       4 0.00014   15.7   1.3   12    8-19      7-18  (36)
 60 3d9t_A Baculoviral IAP repeat-  62.3     4.4 0.00015   21.1   1.8   14    7-20     45-58  (97)
 61 2elm_A Zinc finger protein 406  61.5     3.9 0.00013   16.1   1.2   12    9-20      8-19  (37)
 62 2qra_D XIAP, baculoviral IAP r  61.3     4.3 0.00015   22.0   1.6   15    6-20     68-82  (111)
 63 2kfq_A FP1; protein, de novo p  61.1     2.4 8.1E-05   16.3   0.4   10   10-19      2-11  (32)
 64 1twf_J DNA-directed RNA polyme  61.1     2.5 8.5E-05   21.7   0.6   12    9-20      3-14  (70)
 65 1dxg_A Desulforedoxin; non-hem  60.9       9 0.00031   16.6   2.4   17    6-22      2-18  (36)
 66 3a43_A HYPD, hydrogenase nicke  60.7       3  0.0001   22.9   0.9   13   10-22    107-119 (139)
 67 1rim_A E6APC2 peptide; E6-bind  59.8     3.2 0.00011   16.1   0.8   10   10-19      2-11  (33)
 68 3m1d_A Baculoviral IAP repeat-  59.8     5.3 0.00018   20.4   1.8   14    7-20     43-56  (85)
 69 3fac_A Putative uncharacterize  59.4      11 0.00039   19.4   3.0   15   11-25     68-82  (118)
 70 3v2d_5 50S ribosomal protein L  59.3     5.8  0.0002   19.4   1.8   14    5-18     25-38  (60)
 71 2lvt_A Zinc finger and BTB dom  63.5       2 6.8E-05   15.7   0.0   11   10-20      2-12  (29)
 72 2d9k_A FLN29 gene product; zin  58.7     5.8  0.0002   18.8   1.7   12    9-20     42-53  (75)
 73 6rxn_A Rubredoxin; electron tr  58.5     4.7 0.00016   18.9   1.3    8   11-18      5-12  (46)
 74 2k4x_A 30S ribosomal protein S  58.4     4.7 0.00016   19.3   1.3   17    8-24     34-50  (55)
 75 2lvr_A Zinc finger and BTB dom  62.8     2.1 7.2E-05   15.6   0.0   11   10-20      3-13  (30)
 76 1njq_A Superman protein; zinc-  57.9     5.2 0.00018   15.8   1.3   11    9-19      5-15  (39)
 77 2con_A RUH-035 protein, NIN on  57.6     3.9 0.00013   21.2   1.0   18    7-24     27-44  (79)
 78 2elo_A Zinc finger protein 406  57.2     3.4 0.00012   16.0   0.6   11    9-19      8-18  (37)
 79 2en2_A B-cell lymphoma 6 prote  57.1     5.4 0.00018   15.9   1.3   13    8-20      9-21  (42)
 80 1g73_C Inhibitors of apoptosis  57.1       6 0.00021   21.6   1.8   15    6-20     56-70  (121)
 81 3hl5_A Baculoviral IAP repeat-  57.0     6.2 0.00021   20.5   1.8   14    7-20     43-56  (95)
 82 2epc_A Zinc finger protein 32;  56.6     5.6 0.00019   15.7   1.3   12    8-19      9-20  (42)
 83 2elr_A Zinc finger protein 406  56.1     4.5 0.00015   15.4   0.9   12    8-19      7-18  (36)
 84 1lko_A Rubrerythrin all-iron(I  56.0     3.6 0.00012   23.4   0.7   10   10-19    155-164 (191)
 85 2vm5_A Baculoviral IAP repeat-  56.0       6 0.00021   21.0   1.6   15    6-20     52-66  (106)
 86 1qxf_A GR2, 30S ribosomal prot  55.5     4.7 0.00016   20.5   1.1   11    9-19      6-16  (66)
 87 1jd5_A DIAP1, apoptosis 1 inhi  55.3     7.5 0.00026   21.4   2.0   14    7-20     57-70  (124)
 88 3j20_W 30S ribosomal protein S  55.3     4.8 0.00016   20.3   1.1   11    9-19     14-24  (63)
 89 2emb_A Zinc finger protein 473  55.2       6 0.00021   15.9   1.3   11    9-19     11-21  (44)
 90 1se0_A Apoptosis 1 inhibitor;   54.9     6.9 0.00024   21.2   1.8   14    7-20     45-58  (116)
 91 2zjr_Z 50S ribosomal protein L  54.6     7.8 0.00027   18.9   1.8   15    5-19     25-39  (60)
 92 2akl_A PHNA-like protein PA012  54.6     4.7 0.00016   23.2   1.1   14    6-19     40-53  (138)
 93 2qfa_A Baculoviral IAP repeat-  54.4     6.9 0.00024   21.6   1.8   13    8-20     52-64  (142)
 94 2eow_A Zinc finger protein 347  54.3     6.4 0.00022   16.0   1.3   12    8-19     10-21  (46)
 95 3pwf_A Rubrerythrin; non heme   53.9     6.8 0.00023   22.1   1.7   12    8-19    136-147 (170)
 96 2ept_A Zinc finger protein 32;  53.8     6.6 0.00023   15.5   1.3   12    8-19      8-19  (41)
 97 1e8j_A Rubredoxin; iron-sulfur  53.7     6.8 0.00023   18.6   1.4    8   11-18      4-11  (52)
 98 3cng_A Nudix hydrolase; struct  53.6     5.7 0.00019   21.5   1.3   14   11-24      4-17  (189)
 99 2kn9_A Rubredoxin; metalloprot  53.4       7 0.00024   20.3   1.6   13    7-19     24-36  (81)
100 2epv_A Zinc finger protein 268  53.2     6.8 0.00023   15.9   1.3   12    8-19     10-21  (44)
101 2epq_A POZ-, at HOOK-, and zin  52.9     4.4 0.00015   16.5   0.6    8   10-17     38-45  (45)
102 2yrj_A Zinc finger protein 473  52.7       7 0.00024   15.8   1.3   12    8-19     10-21  (46)
103 2emj_A Zinc finger protein 28   52.5     6.8 0.00023   16.0   1.2   12    8-19     10-21  (46)
104 2yu5_A Zinc finger protein 473  52.5     6.9 0.00023   15.8   1.2   11    9-19     11-21  (44)
105 2riq_A Poly [ADP-ribose] polym  52.0     6.4 0.00022   22.6   1.4   17    8-24     76-92  (160)
106 3siq_A Apoptosis 1 inhibitor;   51.9       8 0.00027   21.8   1.8   14    7-20     67-80  (136)
107 1yuz_A Nigerythrin; rubrythrin  51.8       5 0.00017   23.2   0.9   11    9-19    170-180 (202)
108 2zjr_1 50S ribosomal protein L  51.7     9.2 0.00031   18.4   1.7   13   12-24     40-52  (55)
109 2ftc_P Mitochondrial ribosomal  51.2       9 0.00031   18.2   1.7   13   12-24     38-50  (52)
110 2yts_A Zinc finger protein 484  51.2     7.6 0.00026   15.7   1.3   12    8-19     10-21  (46)
111 1ffk_W Ribosomal protein L37AE  51.1     3.3 0.00011   21.2   0.1   16    3-18     20-35  (73)
112 2eoy_A Zinc finger protein 473  51.1     7.7 0.00026   15.8   1.3   11    9-19     11-21  (46)
113 2yto_A Zinc finger protein 484  51.0     7.7 0.00026   15.8   1.3   12    8-19     10-21  (46)
114 3mup_A Baculoviral IAP repeat-  51.0       8 0.00027   21.1   1.6   14    7-20     51-64  (122)
115 3qt1_I DNA-directed RNA polyme  50.9     3.2 0.00011   23.0   0.0   11   10-20     92-102 (133)
116 2eoz_A Zinc finger protein 473  50.8     5.7 0.00019   16.2   0.8   12    8-19     10-21  (46)
117 2ytb_A Zinc finger protein 32;  50.6     5.9  0.0002   15.7   0.8   11    9-19     10-20  (42)
118 2ytp_A Zinc finger protein 484  50.6     7.9 0.00027   15.8   1.3   12    8-19     10-21  (46)
119 2eme_A Zinc finger protein 473  50.5       8 0.00027   15.6   1.3   12    8-19     10-21  (46)
120 2em4_A Zinc finger protein 28   50.4       8 0.00027   15.8   1.3   11    9-19     11-21  (46)
121 2eos_A B-cell lymphoma 6 prote  50.2     6.2 0.00021   15.7   0.9   11    9-19     10-20  (42)
122 2v3b_B Rubredoxin 2, rubredoxi  50.2     7.3 0.00025   18.6   1.2    8   11-18      4-11  (55)
123 2en3_A ZFP-95, zinc finger pro  50.2     8.1 0.00028   15.7   1.3   12    8-19     10-21  (46)
124 2c6a_A Ubiquitin-protein ligas  50.2     6.3 0.00022   18.9   1.0   17    2-18      5-21  (46)
125 2el5_A Zinc finger protein 268  50.1     8.2 0.00028   15.3   1.3   12    8-19      8-19  (42)
126 3m7n_A Putative uncharacterize  50.0     7.2 0.00025   21.9   1.4   14    7-20    153-166 (179)
127 1fv5_A First zinc finger of U-  49.9     8.5 0.00029   16.4   1.3   13    7-19      5-17  (36)
128 2eor_A Zinc finger protein 224  49.8     8.2 0.00028   15.6   1.3   12    8-19     10-21  (46)
129 2i3h_A Baculoviral IAP repeat-  49.7     8.4 0.00029   21.5   1.6   15    6-20     78-92  (133)
130 2em2_A Zinc finger protein 28   49.5     8.4 0.00029   15.7   1.3   12    8-19     10-21  (46)
131 2ep3_A Zinc finger protein 484  49.1     8.6 0.00029   15.6   1.3   12    8-19     10-21  (46)
132 2emi_A Zinc finger protein 484  49.1     8.6 0.00029   15.6   1.3   12    8-19     10-21  (46)
133 2em9_A Zinc finger protein 224  49.1     8.6  0.0003   15.5   1.3   12    8-19     10-21  (46)
134 1wii_A Hypothetical UPF0222 pr  49.0     5.4 0.00019   20.8   0.7   11    9-19     22-32  (85)
135 2ytj_A Zinc finger protein 484  49.0     8.7  0.0003   15.6   1.3   12    8-19     10-21  (46)
136 2enf_A Zinc finger protein 347  48.9     6.7 0.00023   15.9   0.9   12    8-19     10-21  (46)
137 3v2d_6 50S ribosomal protein L  48.7     9.4 0.00032   18.4   1.5   12   13-24     40-51  (54)
138 2ytf_A Zinc finger protein 268  48.7     8.8  0.0003   15.5   1.3   12    8-19     10-21  (46)
139 2eq0_A Zinc finger protein 347  48.7     8.8  0.0003   15.6   1.3   12    8-19     10-21  (46)
140 2epw_A Zinc finger protein 268  48.4       9 0.00031   15.5   1.3   11    9-19     11-21  (46)
141 2emf_A Zinc finger protein 484  48.2     9.1 0.00031   15.6   1.3   12    8-19     10-21  (46)
142 1yk4_A Rubredoxin, RD; electro  48.1     5.9  0.0002   18.8   0.7    8   11-18      3-10  (52)
143 2eon_A ZFP-95, zinc finger pro  48.1       7 0.00024   16.0   0.9   12    8-19     10-21  (46)
144 2emx_A Zinc finger protein 268  48.1     8.9  0.0003   15.4   1.2   12    8-19      8-19  (44)
145 2emy_A Zinc finger protein 268  48.1     9.2 0.00031   15.5   1.3   12    8-19     10-21  (46)
146 2em7_A Zinc finger protein 224  47.9     9.2 0.00031   15.5   1.3   11    9-19     11-21  (46)
147 2ema_A Zinc finger protein 347  47.9     9.2 0.00032   15.5   1.3   12    8-19     10-21  (46)
148 2eoj_A Zinc finger protein 268  47.9     5.8  0.0002   15.9   0.6   11    9-19     11-21  (44)
149 2eof_A Zinc finger protein 268  47.9     9.2 0.00032   15.2   1.3   12    8-19     10-21  (44)
150 1yui_A GAGA-factor; complex (D  47.9     8.9  0.0003   16.3   1.3   11    9-19     23-33  (54)
151 2yte_A Zinc finger protein 473  47.9     7.1 0.00024   15.4   0.9   11    9-19      9-19  (42)
152 3uk3_C Zinc finger protein 217  47.8     8.8  0.0003   16.1   1.2   11    9-19     31-41  (57)
153 3iuf_A Zinc finger protein UBI  47.3     9.3 0.00032   16.1   1.3   11    9-19      6-16  (48)
154 2emp_A Zinc finger protein 347  47.1     9.7 0.00033   15.4   1.3   12    8-19     10-21  (46)
155 2em3_A Zinc finger protein 28   47.1     9.7 0.00033   15.4   1.3   12    8-19     10-21  (46)
156 1i4o_C X-linked IAP, baculovir  46.7     8.8  0.0003   21.5   1.4   14    7-20     75-88  (141)
157 2ct0_A Non-SMC element 1 homol  46.7      11 0.00037   18.8   1.6   12    9-20     27-38  (74)
158 2yu8_A Zinc finger protein 347  46.7     9.9 0.00034   15.4   1.3   12    8-19     10-21  (46)
159 2eq3_A Zinc finger protein 347  46.7     5.9  0.0002   16.1   0.5   12    8-19     10-21  (46)
160 2emm_A ZFP-95, zinc finger pro  46.5      10 0.00034   15.3   1.3   12    8-19     10-21  (46)
161 3r8s_1 50S ribosomal protein L  46.5     9.5 0.00032   18.1   1.3   13   12-24     36-48  (50)
162 2enh_A Zinc finger protein 28   46.5     7.6 0.00026   15.8   0.9   11    9-19     11-21  (46)
163 2emg_A Zinc finger protein 484  46.3     7.7 0.00026   15.7   0.9   11    9-19     11-21  (46)
164 2ytg_A ZFP-95, zinc finger pro  46.3      10 0.00034   15.4   1.3   12    8-19     10-21  (46)
165 2em5_A ZFP-95, zinc finger pro  46.2      10 0.00035   15.4   1.3   12    8-19     10-21  (46)
166 2ene_A Zinc finger protein 347  46.2      10 0.00035   15.3   1.3   12    8-19     10-21  (46)
167 2ytk_A Zinc finger protein 347  46.1      10 0.00035   15.3   1.3   12    8-19     10-21  (46)
168 2eox_A Zinc finger protein 473  46.0     7.5 0.00026   15.6   0.8   11    9-19     11-21  (44)
169 1zfo_A LAsp-1; LIM domain, zin  45.8       7 0.00024   16.3   0.7   12   10-21      3-14  (31)
170 2epu_A Zinc finger protein 32;  45.8     7.6 0.00026   15.7   0.8   12    8-19     10-21  (45)
171 2adr_A ADR1; transcription reg  45.6      10 0.00035   16.1   1.3   11    9-19     29-39  (60)
172 2lo3_A SAGA-associated factor   45.6     6.4 0.00022   18.7   0.6   16    7-22     14-29  (44)
173 2enc_A Zinc finger protein 224  45.5      11 0.00036   15.3   1.3   11    9-19     11-21  (46)
174 1dx8_A Rubredoxin; electron tr  45.5     9.6 0.00033   19.0   1.3    9   10-18      7-15  (70)
175 2qgp_A HNH endonuclease; Q39X4  45.2     6.6 0.00022   20.6   0.7   12    9-20     34-45  (112)
176 3mkr_B Coatomer subunit alpha;  45.1      11 0.00037   23.7   1.7   12    8-19    276-287 (320)
177 2eoh_A Zinc finger protein 28   45.0     7.6 0.00026   15.8   0.8   11    9-19     11-21  (46)
178 3u5c_b RP61, YS20, 40S ribosom  45.0     8.7  0.0003   20.2   1.1   11    9-19     33-43  (82)
179 2em6_A Zinc finger protein 224  44.9     8.4 0.00029   15.7   0.9   12    8-19     10-21  (46)
180 2yti_A Zinc finger protein 347  44.9     6.6 0.00023   16.0   0.5   12    8-19     10-21  (46)
181 2en7_A Zinc finger protein 268  44.9     7.2 0.00025   15.6   0.7   11    9-19     11-21  (44)
182 3jyw_9 60S ribosomal protein L  44.8     2.1 7.2E-05   22.0  -1.3   16    4-19     20-35  (72)
183 2eml_A Zinc finger protein 28   44.8      11 0.00038   15.2   1.3   12    8-19     10-21  (46)
184 2emh_A Zinc finger protein 484  44.7      11 0.00037   15.2   1.3   12    8-19     10-21  (46)
185 2ayj_A 50S ribosomal protein L  44.7     8.2 0.00028   19.1   0.9   14    8-21     31-44  (56)
186 3q87_A Putative uncharacterize  44.4     7.5 0.00025   21.6   0.8   18   10-27     99-116 (125)
187 2en8_A Zinc finger protein 224  44.4      11 0.00038   15.1   1.3   12    8-19     10-21  (46)
188 3j21_i 50S ribosomal protein L  44.4     2.2 7.6E-05   22.5  -1.3   16    4-19     29-44  (83)
189 2yth_A Zinc finger protein 224  44.1     8.7  0.0003   15.6   0.9   11    9-19     11-21  (46)
190 1k81_A EIF-2-beta, probable tr  44.1     5.7  0.0002   17.5   0.3   10   10-19     21-30  (36)
191 1bbo_A Human enhancer-binding   44.1      11 0.00037   15.8   1.2   11    9-19     28-38  (57)
192 2em8_A Zinc finger protein 224  44.0      11 0.00039   15.2   1.3   12    8-19     10-21  (46)
193 2el4_A Zinc finger protein 268  44.0      11 0.00038   15.1   1.2   12    8-19     10-21  (46)
194 3mv2_A Coatomer subunit alpha;  44.0      12 0.00039   23.7   1.7   12    8-19    285-296 (325)
195 2yso_A ZFP-95, zinc finger pro  43.8      12 0.00039   15.1   1.3   12    8-19     10-21  (46)
196 1s24_A Rubredoxin 2; electron   43.8     8.9  0.0003   20.1   1.0   12    7-18     32-43  (87)
197 2k5c_A Uncharacterized protein  43.7     7.6 0.00026   21.0   0.8   10   10-19     51-60  (95)
198 2eoo_A ZFP-95, zinc finger pro  43.7      12  0.0004   15.2   1.3   12    8-19     10-21  (46)
199 2eq1_A Zinc finger protein 347  43.7       8 0.00027   15.7   0.7   11    9-19     11-21  (46)
200 2ytn_A Zinc finger protein 347  43.6       9 0.00031   15.5   0.9   12    8-19     10-21  (46)
201 1vd4_A Transcription initiatio  43.6      11 0.00038   16.7   1.3   10   10-19     39-48  (62)
202 2eov_A Zinc finger protein 484  43.4     9.2 0.00031   15.4   0.9   11    9-19     11-21  (46)
203 2drp_A Protein (tramtrack DNA-  43.3      17 0.00057   15.7   1.8   12    8-19     38-49  (66)
204 2ep2_A Zinc finger protein 484  43.1      12 0.00042   15.1   1.3   12    8-19     10-21  (46)
205 2epx_A Zinc finger protein 28   42.9     9.3 0.00032   15.4   0.9   11    9-19     11-21  (47)
206 2ytd_A Zinc finger protein 473  42.6      12 0.00043   15.0   1.3   11    9-19     11-21  (46)
207 2xzm_6 RPS27E; ribosome, trans  42.4     9.9 0.00034   20.0   1.1   11    9-19     31-41  (81)
208 2en9_A Zinc finger protein 28   42.3     9.7 0.00033   15.5   0.9   11    9-19     11-21  (46)
209 1nc8_A Nucleocapsid protein; H  42.3      12 0.00041   15.3   1.2   12    7-18      3-14  (29)
210 2eod_A TNF receptor-associated  42.3      18 0.00061   15.9   1.9   11    9-19      9-19  (66)
211 2eq2_A Zinc finger protein 347  42.3     8.2 0.00028   15.6   0.6   12    8-19     10-21  (46)
212 3nw0_A Non-structural maintena  42.0      13 0.00043   21.9   1.6   11   10-20    193-203 (238)
213 2ely_A Zinc finger protein 224  41.8     9.9 0.00034   15.4   0.9   11    9-19     11-21  (46)
214 2yrm_A B-cell lymphoma 6 prote  41.7      10 0.00034   15.3   0.9   11    9-19      9-19  (43)
215 4rxn_A Rubredoxin; electron tr  41.7      12 0.00042   17.9   1.3    7   12-18      5-11  (54)
216 2emz_A ZFP-95, zinc finger pro  41.6     9.2 0.00032   15.5   0.8   11    9-19     11-21  (46)
217 2ytq_A Zinc finger protein 268  41.6      10 0.00035   15.4   0.9   11    9-19     11-21  (46)
218 2el6_A Zinc finger protein 268  41.4      13 0.00044   15.0   1.2   11    9-19     11-21  (46)
219 1u6p_A GAG polyprotein; MLV, A  41.0      11 0.00036   18.2   1.0   12    7-18     20-31  (56)
220 2eq4_A Zinc finger protein 224  40.9     9.2 0.00031   15.4   0.7   11    9-19     11-21  (46)
221 2nap_A Protein (periplasmic ni  40.8      29   0.001   22.5   3.3   33    2-34      2-36  (723)
222 2elz_A Zinc finger protein 224  40.6      11 0.00037   15.3   0.9   12    8-19     10-21  (46)
223 2eoq_A Zinc finger protein 224  40.6     9.8 0.00033   15.4   0.8   11    9-19     11-21  (46)
224 1f2i_G Fusion of N-terminal 17  40.5      13 0.00045   16.4   1.3   10   10-19     49-58  (73)
225 3j21_V 50S ribosomal protein L  40.5     8.5 0.00029   19.3   0.6   10   11-20      5-14  (66)
226 1x6m_A GFA, glutathione-depend  40.4      13 0.00044   21.1   1.4   16   11-26     99-114 (196)
227 2ep1_A Zinc finger protein 484  40.4     9.3 0.00032   15.4   0.7   12    8-19     10-21  (46)
228 3iz6_X 40S ribosomal protein S  40.3      11 0.00038   20.0   1.1   10   10-19     36-45  (86)
229 1pqv_S STP-alpha, transcriptio  40.3      12 0.00041   22.8   1.4   14    9-22    267-280 (309)
230 2eom_A ZFP-95, zinc finger pro  40.1      10 0.00034   15.5   0.8   11    9-19     11-21  (46)
231 2eou_A Zinc finger protein 473  39.7      10 0.00035   15.2   0.7   12    8-19     10-21  (44)
232 2ep0_A Zinc finger protein 28   39.6      15 0.00051   14.8   1.3   12    8-19     10-21  (46)
233 3mhs_C SAGA-associated factor   39.5      18 0.00063   19.5   1.9   15    6-20     66-80  (99)
234 2ysp_A Zinc finger protein 224  39.5      11 0.00037   15.2   0.8   12    8-19     10-21  (46)
235 2ytr_A Zinc finger protein 347  39.4     8.9 0.00031   15.5   0.5   11    9-19     11-21  (46)
236 2eop_A Zinc finger protein 268  39.3      12 0.00039   15.1   0.9   12    8-19     10-21  (46)
237 2ytm_A Zinc finger protein 28   39.3       9 0.00031   15.6   0.5   11    9-19     11-21  (46)
238 4avr_A PA4485; unknown functio  39.2      14 0.00046   19.6   1.3   10   12-21     60-69  (95)
239 2apo_B Ribosome biogenesis pro  39.2     9.6 0.00033   18.8   0.7    9   11-19     19-27  (60)
240 2epz_A Zinc finger protein 28   39.1      11 0.00039   15.2   0.9   11    9-19     11-21  (46)
241 1wd2_A Ariadne-1 protein homol  39.0     8.8  0.0003   18.4   0.5   11   10-20      6-16  (60)
242 3iz5_m 60S ribosomal protein L  38.5     3.1 0.00011   22.3  -1.3   16    4-19     30-45  (92)
243 2emk_A Zinc finger protein 28   38.1      12 0.00043   15.1   0.9   12    8-19     10-21  (46)
244 2en6_A Zinc finger protein 268  38.1      12  0.0004   15.1   0.8   12    8-19     10-21  (46)
245 2fiy_A Protein FDHE homolog; F  38.0     8.3 0.00028   23.8   0.4   10   10-19    222-231 (309)
246 1x6e_A Zinc finger protein 24;  38.0      15 0.00053   16.3   1.3   11    9-19     41-51  (72)
247 2xzm_9 RPS31E; ribosome, trans  37.9      11 0.00039   21.9   0.9   14   11-24    114-127 (189)
248 2em0_A Zinc finger protein 224  37.8      11 0.00039   15.2   0.8   11    9-19     11-21  (46)
249 2nn6_I 3'-5' exoribonuclease C  37.7      13 0.00044   21.5   1.2   11    9-19    184-194 (209)
250 3oei_C RELK (toxin RV3358); to  37.7      38  0.0013   17.5   2.9   18   17-34     75-92  (96)
251 4a17_Y RPL37A, 60S ribosomal p  37.6     3.8 0.00013   22.4  -1.0   16    4-19     30-45  (103)
252 2js4_A UPF0434 protein BB2007;  37.4      28 0.00095   17.3   2.3   17    7-23      5-21  (70)
253 2fnf_X Putative RAS effector N  37.3      20 0.00068   17.5   1.7   14    7-20     46-59  (72)
254 3u5c_a 40S ribosomal protein S  37.2      17 0.00059   20.2   1.6   13    8-20     18-30  (119)
255 3k1f_M Transcription initiatio  37.2      20 0.00069   21.5   2.0   14    9-22     20-36  (197)
256 2en1_A Zinc finger protein 224  37.1      12 0.00043   15.0   0.8   12    8-19     10-21  (46)
257 2kpi_A Uncharacterized protein  37.1      32  0.0011   16.2   2.4   19    5-23      5-23  (56)
258 1nkw_1 50S ribosomal protein L  37.0      19 0.00065   18.8   1.7   13   12-24     67-79  (82)
259 3u6p_A Formamidopyrimidine-DNA  36.8      28 0.00097   20.8   2.6   22   10-31    245-266 (273)
260 1a6b_B Momulv, zinc finger pro  36.7      14 0.00049   16.6   1.0   12    7-18      7-18  (40)
261 3izc_m 60S ribosomal protein R  36.5     3.3 0.00011   22.2  -1.4   16    4-19     30-45  (92)
262 2jr6_A UPF0434 protein NMA0874  36.3      23 0.00079   17.5   1.9   17    7-23      5-21  (68)
263 3izc_Z 60S ribosomal protein R  36.2      14 0.00047   21.4   1.1   10   11-20      4-13  (155)
264 1vq8_U 50S ribosomal protein L  36.0      11 0.00037   18.9   0.6   10   11-20      4-13  (66)
265 1i7d_A DNA topoisomerase III;   35.9     8.5 0.00029   25.9   0.2   17   10-26    616-632 (659)
266 1ptq_A Protein kinase C delta   35.9      21 0.00072   15.6   1.6   12    8-19     26-37  (50)
267 3irb_A Uncharacterized protein  35.9      13 0.00044   20.3   0.9   13   10-22     47-59  (145)
268 4a17_T RPL24, 60S ribosomal pr  35.8      14 0.00047   21.4   1.1   10   11-20      6-15  (158)
269 2eoe_A Zinc finger protein 347  35.6      11 0.00038   15.1   0.5   12    8-19     10-21  (46)
270 2epr_A POZ-, at HOOK-, and zin  35.3      26 0.00091   14.2   1.8   13    7-19      9-21  (48)
271 2d9h_A Zinc finger protein 692  35.2      18 0.00061   16.2   1.3   11    9-19     37-47  (78)
272 2ct1_A Transcriptional repress  35.1      17  0.0006   16.2   1.2   11    9-19     44-54  (77)
273 2rsd_A E3 SUMO-protein ligase   35.1      21 0.00073   17.0   1.6   17    2-19      2-18  (68)
274 1rfh_A RAS association (ralgds  34.7      24 0.00081   16.5   1.7   13    7-19     33-45  (59)
275 2ytt_A Zinc finger protein 473  34.5      12 0.00041   15.1   0.5   12    8-19     10-21  (46)
276 4bbr_M Transcription initiatio  34.2      17 0.00059   22.3   1.4   14   10-23     21-37  (345)
277 3j21_d 50S ribosomal protein L  34.2      17 0.00059   19.1   1.2   15    6-20     29-43  (89)
278 2xzf_A Formamidopyrimidine-DNA  34.2      33  0.0011   20.3   2.6   22   11-32    243-264 (271)
279 3eqt_A ATP-dependent RNA helic  34.1     7.4 0.00025   22.1  -0.2   14    6-19     65-78  (145)
280 3lpe_B DNA-directed RNA polyme  34.0      13 0.00045   18.1   0.7    7   12-18     15-21  (59)
281 1x5w_A Zinc finger protein 64,  34.0      27 0.00091   15.3   1.8   10   10-19      9-18  (70)
282 1ee8_A MUTM (FPG) protein; bet  34.0      35  0.0012   20.3   2.7   22   11-32    236-257 (266)
283 1nui_A DNA primase/helicase; z  33.9      13 0.00045   21.2   0.8    9   10-18     14-22  (255)
284 1k3x_A Endonuclease VIII; hydr  33.9      34  0.0012   20.2   2.6   22   11-32    235-256 (262)
285 1k82_A Formamidopyrimidine-DNA  33.8      34  0.0012   20.3   2.6   22   11-32    241-262 (268)
286 3iz5_i 60S ribosomal protein L  33.6      14 0.00047   20.5   0.8   15    6-20     37-51  (119)
287 4esj_A Type-2 restriction enzy  33.6     8.8  0.0003   23.9  -0.0   14   10-23     34-47  (257)
288 3u5e_g 60S ribosomal protein L  33.3      18  0.0006   20.1   1.2   15    6-20     37-51  (121)
289 2djr_A Zinc finger BED domain-  33.1      15 0.00051   18.6   0.8   12    9-20     27-38  (76)
290 2gvi_A Conserved hypothetical   33.1      30   0.001   19.8   2.2   15    7-21    169-183 (204)
291 1kbe_A Kinase suppressor of RA  33.0      15 0.00051   17.1   0.8   11   10-20     27-37  (49)
292 3iz5_Z 60S ribosomal protein L  32.9      17 0.00057   21.2   1.1   11   10-20      5-15  (162)
293 2eps_A POZ-, at HOOK-, and zin  32.6      22 0.00074   15.0   1.3   12    8-19     10-21  (54)
294 2ab3_A ZNF29; zinc finger prot  31.6      19 0.00067   12.5   0.9   10   10-19      2-13  (29)
295 2gnr_A Conserved hypothetical   31.5      17 0.00057   20.0   0.9   13    9-21     46-58  (145)
296 2odd_A Protein CBFA2T1; MYND z  31.0      14 0.00047   17.3   0.5    8   12-19     19-26  (64)
297 2lce_A B-cell lymphoma 6 prote  31.0      23 0.00079   15.7   1.3   10   10-19     45-54  (74)
298 4gzn_C ZFP-57, zinc finger pro  31.0      23 0.00078   16.2   1.3   10   10-19      4-13  (60)
299 2kwq_A Protein MCM10 homolog;   31.0      21 0.00073   18.8   1.3   16    4-19     59-74  (92)
300 4ayb_N DNA-directed RNA polyme  31.0      16 0.00055   18.5   0.7   11   10-20      4-14  (66)
301 2epp_A POZ-, at HOOK-, and zin  30.8      24 0.00083   16.7   1.4   14    6-19      9-22  (66)
302 3k7a_M Transcription initiatio  30.8      20 0.00067   21.8   1.2   10    9-18     20-29  (345)
303 2kmk_A Zinc finger protein GFI  30.7      23 0.00078   15.6   1.2   11    9-19     56-66  (82)
304 2enz_A NPKC-theta, protein kin  30.7      29 0.00099   16.2   1.6   12    8-19     38-49  (65)
305 1x6h_A Transcriptional repress  30.6      24 0.00082   15.7   1.3   11    9-19     46-56  (86)
306 1faq_A RAF-1; transferase, ser  30.3      21 0.00072   15.8   1.0   11    9-19     26-36  (52)
307 2ecw_A Tripartite motif-contai  30.3      22 0.00074   16.3   1.1   13    8-20     57-69  (85)
308 2jsp_A Transcriptional regulat  30.1      23 0.00079   18.6   1.3   12    8-19     19-30  (87)
309 2xzm_5 Ribosomal protein S26E   30.1      27 0.00091   19.5   1.6   13    8-20     18-30  (119)
310 3hxi_C Eukaryotic translation   30.0      22 0.00074   14.5   0.9    7   17-23      3-9   (21)
311 4a18_C 60S ribosomal protein L  29.8      27 0.00091   19.1   1.6   14   10-23     69-82  (109)
312 1yc5_A NAD-dependent deacetyla  29.8      27 0.00092   20.2   1.7   11    9-19    144-154 (246)
313 2cot_A Zinc finger protein 435  29.6      25 0.00087   15.7   1.3   11    9-19     45-55  (77)
314 1vq8_1 50S ribosomal protein L  29.5      24 0.00083   17.4   1.2   13    8-20     15-27  (57)
315 1m2k_A Silent information regu  29.4      27 0.00093   20.3   1.6   11   10-20    142-152 (249)
316 1ryq_A DNA-directed RNA polyme  29.3      16 0.00056   18.5   0.6   11    9-19     22-32  (69)
317 2jny_A Uncharacterized BCR; st  29.2      34  0.0012   16.9   1.8   17    7-23      7-23  (67)
318 1sp2_A SP1F2; zinc finger, tra  29.2      22 0.00077   12.8   0.9   10   10-19      2-13  (31)
319 2yuc_A TNF receptor-associated  29.1      17  0.0006   17.0   0.7   14    8-21     14-28  (76)
320 3p8b_A DNA-directed RNA polyme  29.0      18 0.00061   18.9   0.7    8   12-19     37-44  (81)
321 2ysl_A Tripartite motif-contai  29.0      21 0.00073   16.2   0.9   12    9-20     56-67  (73)
322 3f2g_A Alkylmercury lyase; MER  28.9      77  0.0026   18.8   3.6   21   11-31    115-135 (220)
323 2e7z_A Acetylene hydratase AHY  28.9      69  0.0024   20.8   3.6   24   11-34      4-30  (727)
324 3f6q_B LIM and senescent cell   28.7      28 0.00096   15.6   1.3   16    6-21      7-22  (72)
325 1a1h_A QGSR zinc finger peptid  28.1      28 0.00094   15.7   1.3   11    9-19     61-71  (90)
326 3d00_A Tungsten formylmethanof  28.1      41  0.0014   19.2   2.2   15    7-21    160-174 (191)
327 2zet_C Melanophilin; complex,   27.9      33  0.0011   19.2   1.7   14    7-20     82-95  (153)
328 2zkr_u 60S ribosomal protein L  27.9      17 0.00059   20.9   0.6   10   11-20      4-13  (157)
329 2ctu_A Zinc finger protein 483  27.5      29 0.00098   14.9   1.2   13    8-20     16-28  (73)
330 2dlk_A Novel protein; ZF-C2H2   27.4      20 0.00068   15.9   0.7    8   11-18     69-76  (79)
331 2hl7_A Cytochrome C-type bioge  27.4      22 0.00076   18.3   0.9   11    9-19     25-35  (84)
332 2co8_A NEDD9 interacting prote  27.3      27 0.00091   16.7   1.2   16    6-21     11-26  (82)
333 3hcs_A TNF receptor-associated  27.3      23 0.00078   18.9   1.0   13   10-22    137-149 (170)
334 1g47_A Pinch protein; LIM doma  27.3      31  0.0011   15.8   1.4   16    6-21      7-22  (77)
335 2jrp_A Putative cytoplasmic pr  27.2      18 0.00062   18.7   0.6    9   12-20     33-41  (81)
336 1q1a_A HST2 protein; ternary c  27.2      23  0.0008   21.0   1.1   11    9-19    162-172 (289)
337 3cc2_Z 50S ribosomal protein L  27.0      16 0.00055   20.2   0.3   16    4-19     54-69  (116)
338 2dmd_A Zinc finger protein 64,  26.9      29 0.00099   15.8   1.2   11    9-19     63-73  (96)
339 2yrc_A Protein transport prote  26.8      26  0.0009   16.8   1.1   12    7-18      6-19  (59)
340 3j21_j 50S ribosomal protein L  26.7      21 0.00073   19.0   0.8   16    8-23     66-81  (94)
341 1g25_A CDK-activating kinase a  26.7      20 0.00069   16.1   0.6   11   10-20     43-53  (65)
342 1zbd_B Rabphilin-3A; G protein  26.7      36  0.0012   18.6   1.7   13    8-20     70-82  (134)
343 2yt9_A Zinc finger-containing   26.7      41  0.0014   15.3   1.8   10   10-19      7-16  (95)
344 2egp_A Tripartite motif-contai  26.3      28 0.00095   15.9   1.1   13    8-20     51-63  (79)
345 2iv2_X Formate dehydrogenase H  26.3      80  0.0027   20.5   3.5   24   11-34      6-31  (715)
346 2ghf_A ZHX1, zinc fingers and   26.2      38  0.0013   17.1   1.7   10   10-19     18-27  (102)
347 2zkr_2 60S ribosomal protein L  26.1      20 0.00069   19.3   0.6   16    8-23     14-29  (97)
348 2pk7_A Uncharacterized protein  26.1      23 0.00078   17.5   0.8   14    9-22      7-20  (69)
349 2ctd_A Zinc finger protein 512  26.0      32  0.0011   16.7   1.4   11    9-19     33-43  (96)
350 4b6d_A RAC GTPase-activating p  26.0      36  0.0012   16.2   1.5   12    9-20     18-29  (61)
351 2owo_A DNA ligase; protein-DNA  25.9      26  0.0009   23.8   1.3   14    8-21    403-416 (671)
352 2iyb_E Testin, TESS, TES; LIM   25.8      36  0.0012   15.4   1.5   11   11-21      3-13  (65)
353 2ecv_A Tripartite motif-contai  25.8      22 0.00076   16.3   0.7   13    9-21     58-70  (85)
354 1x0t_A Ribonuclease P protein   25.7      25 0.00084   18.8   0.9   15    9-23     93-107 (120)
355 2dj7_A Actin-binding LIM prote  25.7      33  0.0011   16.4   1.3   17    5-21     10-26  (80)
356 2hf1_A Tetraacyldisaccharide-1  25.7      23  0.0008   17.5   0.8   14    9-22      7-20  (68)
357 2yre_A F-box only protein 30;   25.6      40  0.0014   18.0   1.8   12    9-20     36-48  (100)
358 3t6p_A Baculoviral IAP repeat-  25.5      34  0.0011   21.2   1.6   15    6-20     36-50  (345)
359 2dlq_A GLI-kruppel family memb  25.3      33  0.0011   16.3   1.3   10   10-19     94-103 (124)
360 1llm_C Chimera of ZIF23-GCN4;   25.3      33  0.0011   15.7   1.3   10   10-19      3-12  (88)
361 3mqg_A Lipopolysaccharides bio  25.3      56  0.0019   17.3   2.4   19    5-23    167-185 (192)
362 2enn_A NPKC-theta, protein kin  25.2      44  0.0015   16.2   1.8   13    8-20     49-61  (77)
363 1vzi_A Desulfoferrodoxin; ferr  25.1      37  0.0013   18.3   1.6   16    6-21      3-18  (126)
364 2kw0_A CCMH protein; oxidoredu  24.5      24  0.0008   18.6   0.7   11    9-19     22-32  (90)
365 2ebt_A Krueppel-like factor 5;  24.3      28 0.00096   16.0   0.9   11    9-19     74-84  (100)
366 2k2d_A Ring finger and CHY zin  24.0      24 0.00083   17.8   0.7    7   12-18     57-63  (79)
367 3uej_A NPKC-delta, protein kin  23.9      43  0.0015   15.5   1.6   11    9-19     36-46  (65)
368 1vq8_3 50S ribosomal protein L  23.9      29 0.00099   18.5   1.0   13   10-22     68-80  (92)
369 1y8f_A UNC-13 homolog A, MUNC1  23.7      33  0.0011   16.1   1.1   11    9-19     40-50  (66)
370 3bbo_3 Ribosomal protein L33;   23.6      15  0.0005   18.4  -0.2   13   12-24     51-63  (66)
371 3j21_e 50S ribosomal protein L  23.5      29 0.00099   17.4   0.9   12    9-20     16-27  (62)
372 2yuu_A NPKC-delta, protein kin  23.5      45  0.0015   16.3   1.6   13    8-20     43-55  (83)
373 3p2a_A Thioredoxin 2, putative  23.3      30   0.001   17.3   1.0   10   10-19      5-14  (148)
374 2csh_A Zinc finger protein 297  23.2      38  0.0013   15.9   1.3   11    9-19     64-74  (110)
375 2vpz_A Thiosulfate reductase;   23.1 1.1E+02  0.0037   20.1   3.8   24   11-34     42-67  (765)
376 2gqj_A Zinc finger protein KIA  23.1      27 0.00093   16.6   0.7   11    9-19     23-33  (98)
377 2eli_A Protein kinase C alpha   23.1      48  0.0017   16.3   1.7   13    8-20     43-55  (85)
378 3mhs_E SAGA-associated factor   22.9      17 0.00058   19.6  -0.1   12   11-22     76-87  (96)
379 2ct2_A Tripartite motif protei  22.9      32  0.0011   16.0   1.0   12    9-20     55-66  (88)
380 3ml1_A NAPA, periplasmic nitra  22.7   1E+02  0.0035   20.7   3.6   24   11-34     17-42  (802)
381 1x4s_A Protein FON, zinc finge  22.7      34  0.0012   16.8   1.0   11    9-19     25-35  (59)
382 2ee8_A Protein ODD-skipped-rel  22.4      44  0.0015   15.5   1.4   12    8-19     15-26  (106)
383 2vy4_A U11/U12 small nuclear r  22.4      51  0.0018   14.3   1.5   14    8-21      3-17  (37)
384 1q14_A HST2 protein; histone d  22.4      32  0.0011   21.5   1.1   10   10-19    171-180 (361)
385 4g9i_A Hydrogenase maturation   22.4      38  0.0013   23.2   1.5   15    9-23    177-191 (772)
386 3flo_B DNA polymerase alpha ca  22.3      51  0.0018   19.3   1.9   14   10-23     22-35  (206)
387 2lv2_A Insulinoma-associated p  22.2      39  0.0013   16.5   1.2   10   10-19     56-65  (85)
388 2w0t_A Lethal(3)malignant brai  22.0      46  0.0016   15.4   1.4   11    8-18      4-14  (43)
389 1ti6_A Pyrogallol hydroxytrans  21.9   1E+02  0.0034   20.7   3.4   25   10-34      6-30  (875)
390 1zfd_A SWI5; DNA binding motif  21.6      37  0.0013   12.2   0.9   10   10-19      3-14  (32)
391 1ma3_A SIR2-AF2, transcription  21.5      32  0.0011   20.0   0.9   10    9-18    146-155 (253)
392 2d8x_A Protein pinch; LIM doma  21.5      38  0.0013   15.3   1.0   14    8-21      3-16  (70)
393 1x6f_A Zinc finger protein 462  21.4      43  0.0015   16.2   1.3   12    8-19     23-34  (88)
394 2ecy_A TNF receptor-associated  21.4      32  0.0011   15.4   0.8   11   10-20     50-60  (66)
395 3ttc_A HYPF, transcriptional r  21.3      41  0.0014   22.8   1.5   14    9-22     88-102 (657)
396 1pg5_B Aspartate carbamoyltran  21.3      52  0.0018   19.2   1.8   13    8-20    141-153 (168)
397 1jm7_A BRCA1, breast cancer ty  21.3      28 0.00097   17.0   0.6   11   10-20     58-68  (112)
398 1j8f_A SIRT2, sirtuin 2, isofo  21.3      35  0.0012   20.8   1.1   11    9-19    184-194 (323)
399 2ppt_A Thioredoxin-2; thiredox  21.1      35  0.0012   17.7   1.0   10   10-19     14-23  (155)
400 3efo_B SEC24 related gene fami  20.9      39  0.0013   23.0   1.3   13    7-19     95-107 (770)
401 3i9v_3 NADH-quinone oxidoreduc  20.8 1.1E+02  0.0037   20.5   3.5   25   10-34    253-279 (783)
402 1x4l_A Skeletal muscle LIM-pro  20.6      34  0.0012   15.6   0.8   13    9-21      4-16  (72)
403 2wbt_A B-129; zinc finger; 2.7  20.5      45  0.0015   16.2   1.3   10   10-19     74-83  (129)
404 2k1p_A Zinc finger RAN-binding  20.3      35  0.0012   14.4   0.7    9   11-19      7-15  (33)
405 3noy_A 4-hydroxy-3-methylbut-2  20.1      35  0.0012   22.0   0.9   11    8-18    269-279 (366)

No 1  
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe}
Probab=99.80  E-value=8.8e-21  Score=98.48  Aligned_cols=35  Identities=57%  Similarity=1.103  Sum_probs=33.2

Q ss_pred             CccccCCCCceecCCCCCeEEEeecCCceEEEEeC
Q 035423            1 MENTLKPGDVIQCRECGYRILYKKRTRRIVQYEAR   35 (35)
Q Consensus         1 ~~~~lk~~~~irC~~CG~RIlyK~R~~~~~~~~Ar   35 (35)
                      .+++|+.+++||||+||||||||+||++++||+||
T Consensus        29 ~~~~l~~~~~iRC~~CG~RILyK~Rt~r~~~~~Ar   63 (63)
T 3h0g_L           29 ARNTIQAKEVIRCRECGHRVMYKMRTKRMVQFEAR   63 (63)
T ss_dssp             CBCCCCSSSCCCCSSSCCCCCBCCCCCCCEEECCC
T ss_pred             CeeecCCCCceECCCCCcEEEEEecCCceEEEECC
Confidence            36889999999999999999999999999999998


No 2  
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ...
Probab=99.73  E-value=3.9e-19  Score=93.22  Aligned_cols=34  Identities=50%  Similarity=0.968  Sum_probs=32.3

Q ss_pred             ccccCCCCceecCCCCCeEEEeecCCceEEEEeC
Q 035423            2 ENTLKPGDVIQCRECGYRILYKKRTRRIVQYEAR   35 (35)
Q Consensus         2 ~~~lk~~~~irC~~CG~RIlyK~R~~~~~~~~Ar   35 (35)
                      +++++..|+|+||+||||||||+||++++||+||
T Consensus        37 ~~e~~~~d~irCp~CG~RILyK~R~~r~v~~~ar   70 (70)
T 1twf_L           37 KLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR   70 (70)
T ss_dssp             EECCCTTSTTCCSSSCCCCCBCCCCSSCEEECCC
T ss_pred             cceeCCCCCccCCCCCceEeEecCCCccEEEecC
Confidence            5778899999999999999999999999999998


No 3  
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X
Probab=99.49  E-value=1.4e-14  Score=72.24  Aligned_cols=33  Identities=30%  Similarity=0.577  Sum_probs=31.0

Q ss_pred             ccccCCCCceecCCCCCeEEEeecCCceEEEEe
Q 035423            2 ENTLKPGDVIQCRECGYRILYKKRTRRIVQYEA   34 (35)
Q Consensus         2 ~~~lk~~~~irC~~CG~RIlyK~R~~~~~~~~A   34 (35)
                      +.+|+..+.|+||+|||||+||.|++.++.++|
T Consensus        15 ~~el~~lP~IrCpyCGyrii~KvR~p~vK~vkA   47 (48)
T 4ayb_P           15 DEQLKVLPGVRCPYCGYKIIFMVRKPTIKIVKA   47 (48)
T ss_dssp             CCCSCCCSSSCCTTTCCSCEECCCCCSCEEEEC
T ss_pred             HHHHhhCCCcccCccCcEEEEEecCCcceeeec
Confidence            467899999999999999999999999999988


No 4  
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}
Probab=95.99  E-value=0.0034  Score=37.23  Aligned_cols=19  Identities=53%  Similarity=1.125  Sum_probs=14.9

Q ss_pred             CCCceecCCCCCeEEEeecC
Q 035423            7 PGDVIQCRECGYRILYKKRT   26 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK~R~   26 (35)
                      ..+.+.||+|| ||||....
T Consensus       219 ~~~Iv~Cp~Cg-RIL~~~~~  237 (256)
T 3na7_A          219 SGDMITCPYCG-RILYAEGA  237 (256)
T ss_dssp             SSSCEECTTTC-CEEECSCC
T ss_pred             CCCEEECCCCC-eeEEeCcc
Confidence            34679999998 89997644


No 5  
>2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae}
Probab=93.73  E-value=0.047  Score=28.59  Aligned_cols=15  Identities=33%  Similarity=0.687  Sum_probs=12.9

Q ss_pred             cCCCCceecCCCCCe
Q 035423            5 LKPGDVIQCRECGYR   19 (35)
Q Consensus         5 lk~~~~irC~~CG~R   19 (35)
                      |..+.+-||++||+-
T Consensus        51 l~~g~~~RC~eCG~~   65 (80)
T 2odx_A           51 PTVNEVARCWECGSV   65 (80)
T ss_dssp             CCTTCEEECSSSCCE
T ss_pred             ecCCCCeECCCCCeE
Confidence            677888999999994


No 6  
>1v54_F VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: g.41.5.3 PDB: 1oco_F* 1occ_F* 1ocz_F* 1ocr_F* 1v55_F* 2dyr_F* 2dys_F* 2eij_F* 2eik_F* 2eil_F* 2eim_F* 2ein_F* 2occ_F* 2ybb_Q* 2zxw_F* 3abk_F* 3abl_F* 3abm_F* 3ag1_F* 3ag2_F* ...
Probab=92.91  E-value=0.055  Score=29.24  Aligned_cols=17  Identities=41%  Similarity=0.962  Sum_probs=13.4

Q ss_pred             cCCCCceecCCCCCeEEEe
Q 035423            5 LKPGDVIQCRECGYRILYK   23 (35)
Q Consensus         5 lk~~~~irC~~CG~RIlyK   23 (35)
                      |..+.+-||++||+  .||
T Consensus        74 l~~g~~~RC~eCG~--~fk   90 (98)
T 1v54_F           74 LHKGEAQRCPSCGT--HYK   90 (98)
T ss_dssp             EESSSCEECTTTCC--EEE
T ss_pred             EeCCCceECCCCCe--EEE
Confidence            56677899999998  454


No 7  
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii}
Probab=91.84  E-value=0.077  Score=29.34  Aligned_cols=17  Identities=24%  Similarity=0.495  Sum_probs=12.3

Q ss_pred             CceecCCCCCeEEEeec
Q 035423            9 DVIQCRECGYRILYKKR   25 (35)
Q Consensus         9 ~~irC~~CG~RIlyK~R   25 (35)
                      +...||.||+.+-.+.|
T Consensus       147 ~~~~Cp~CG~~~~~~~~  163 (165)
T 2lcq_A          147 PGGVCPDCGSKVKLIPR  163 (165)
T ss_dssp             GGGBCTTTCCBEEECCC
T ss_pred             CCCcCCCCCCcceeCCc
Confidence            34699999999654444


No 8  
>2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2}
Probab=91.72  E-value=0.11  Score=27.56  Aligned_cols=17  Identities=18%  Similarity=0.526  Sum_probs=13.8

Q ss_pred             CCCceecCCCCCeEEEe
Q 035423            7 PGDVIQCRECGYRILYK   23 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK   23 (35)
                      ....+.|||||-+-.+|
T Consensus        50 ~~g~~~CpYCg~~f~l~   66 (80)
T 2jvm_A           50 ETGFVECGYCDRRYIHE   66 (80)
T ss_dssp             TTCEEECSSSSCEEEEH
T ss_pred             CCCeEECCCCCCEEEec
Confidence            46789999999986655


No 9  
>2y69_F Cytochrome C oxidase subunit 5B; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus}
Probab=91.13  E-value=0.11  Score=29.37  Aligned_cols=15  Identities=33%  Similarity=0.902  Sum_probs=12.3

Q ss_pred             cCCCCceecCCCCCe
Q 035423            5 LKPGDVIQCRECGYR   19 (35)
Q Consensus         5 lk~~~~irC~~CG~R   19 (35)
                      |..+.+-||++||+-
T Consensus       105 L~kg~p~RCpeCG~~  119 (129)
T 2y69_F          105 LHKGEAQRCPSCGTH  119 (129)
T ss_dssp             EESSSCEECTTTCCE
T ss_pred             EeCCCceeCCCCCeE
Confidence            566778999999983


No 10 
>2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi}
Probab=90.58  E-value=0.13  Score=26.31  Aligned_cols=17  Identities=18%  Similarity=0.520  Sum_probs=13.6

Q ss_pred             CCCceecCCCCCeEEEe
Q 035423            7 PGDVIQCRECGYRILYK   23 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK   23 (35)
                      ....+.|||||-+-.+|
T Consensus        37 ~~g~~~CpYCg~~f~l~   53 (67)
T 2jrr_A           37 DTGWVECPYCDCKYVLK   53 (67)
T ss_dssp             TTSEEEETTTTEEEEET
T ss_pred             CCCeEECCCCCCEEEEC
Confidence            45789999999886655


No 11 
>2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str}
Probab=90.53  E-value=0.13  Score=27.64  Aligned_cols=20  Identities=20%  Similarity=0.340  Sum_probs=15.4

Q ss_pred             cCCCCceecCCCCCeEEEee
Q 035423            5 LKPGDVIQCRECGYRILYKK   24 (35)
Q Consensus         5 lk~~~~irC~~CG~RIlyK~   24 (35)
                      |.....+.|||||-+-.++.
T Consensus        43 i~~~g~~~CpYCg~~y~~~~   62 (87)
T 2jz8_A           43 MGSTDEKICPYCSTLYRYDP   62 (87)
T ss_dssp             CTTCCEECCTTTCCEEECCT
T ss_pred             cCCCCeEECCCCCCEeEcCC
Confidence            45567899999999866553


No 12 
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens}
Probab=88.48  E-value=0.29  Score=22.55  Aligned_cols=20  Identities=20%  Similarity=0.517  Sum_probs=14.3

Q ss_pred             ccCCCCceecCCCCCeEEEe
Q 035423            4 TLKPGDVIQCRECGYRILYK   23 (35)
Q Consensus         4 ~lk~~~~irC~~CG~RIlyK   23 (35)
                      .+...+...|+.||-.|--+
T Consensus         3 ~~~~~~~~~C~~C~~~i~~~   22 (39)
T 2i5o_A            3 HMAAEDQVPCEKCGSLVPVW   22 (39)
T ss_dssp             ---CCCEEECTTTCCEEEGG
T ss_pred             CCCcCCCcccccccCcCCcc
Confidence            46778899999999987643


No 13 
>1hxr_A Guanine nucleotide exchange factor MSS4; RAB GTPase, membrane trafficking, Zn binding site, metal binding protein; 1.65A {Rattus norvegicus} SCOP: b.88.1.1 PDB: 1fwq_A 2fu5_A
Probab=87.04  E-value=0.35  Score=26.50  Aligned_cols=19  Identities=26%  Similarity=0.718  Sum_probs=14.9

Q ss_pred             CCCCceecCCCCCeEEEee
Q 035423            6 KPGDVIQCRECGYRILYKK   24 (35)
Q Consensus         6 k~~~~irC~~CG~RIlyK~   24 (35)
                      +....++|+.|+.+||-+.
T Consensus         8 ~N~~~i~C~~C~s~il~~~   26 (115)
T 1hxr_A            8 RNRKAVLCQRCGSRVLQPG   26 (115)
T ss_dssp             BBSSCEEETTTCCEEECTT
T ss_pred             cccCeEECCCCCCEEeccC
Confidence            3456899999999998543


No 14 
>1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1
Probab=86.48  E-value=0.31  Score=23.11  Aligned_cols=13  Identities=38%  Similarity=0.935  Sum_probs=10.9

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      .+.||.||++-++
T Consensus        15 ~~~Cp~Cg~~~~~   27 (57)
T 1qyp_A           15 KITCPKCGNDTAY   27 (57)
T ss_dssp             ECCCTTTCCSEEE
T ss_pred             EeECCCCCCCEEE
Confidence            5789999998765


No 15 
>1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1
Probab=84.34  E-value=0.27  Score=25.15  Aligned_cols=18  Identities=28%  Similarity=0.556  Sum_probs=13.1

Q ss_pred             CceecCCCCCeEEEeecCC
Q 035423            9 DVIQCRECGYRILYKKRTR   27 (35)
Q Consensus         9 ~~irC~~CG~RIlyK~R~~   27 (35)
                      ....|| ||.+|=+++++-
T Consensus        20 kT~~C~-CG~~~~~~k~ri   37 (71)
T 1gh9_A           20 KTRKCV-CGRTVNVKDRRI   37 (71)
T ss_dssp             SEEEET-TTEEEECCSSSC
T ss_pred             cEEECC-CCCeeeeceEEE
Confidence            456788 888887777653


No 16 
>1tfi_A Transcriptional elongation factor SII; transcription regulation; NMR {Homo sapiens} SCOP: g.41.3.1
Probab=82.81  E-value=0.45  Score=22.62  Aligned_cols=14  Identities=21%  Similarity=0.591  Sum_probs=10.4

Q ss_pred             CCceecCCCCCeEE
Q 035423            8 GDVIQCRECGYRIL   21 (35)
Q Consensus         8 ~~~irC~~CG~RIl   21 (35)
                      ...+.||.||++=.
T Consensus         7 t~~~~Cp~Cg~~~a   20 (50)
T 1tfi_A            7 TDLFTCGKCKKKNC   20 (50)
T ss_dssp             CCCSCCSSSCSSCE
T ss_pred             eCccCCCCCCCCEE
Confidence            45678999998643


No 17 
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1
Probab=79.67  E-value=1.3  Score=20.26  Aligned_cols=15  Identities=20%  Similarity=0.665  Sum_probs=10.6

Q ss_pred             eecCCCCC-eEEEeec
Q 035423           11 IQCRECGY-RILYKKR   25 (35)
Q Consensus        11 irC~~CG~-RIlyK~R   25 (35)
                      ..||.||. .+.|-..
T Consensus         6 ~~CP~C~~~~l~~d~~   21 (50)
T 1pft_A            6 KVCPACESAELIYDPE   21 (50)
T ss_dssp             CSCTTTSCCCEEEETT
T ss_pred             EeCcCCCCcceEEcCC
Confidence            46888888 7777543


No 18 
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A
Probab=78.00  E-value=1.1  Score=16.39  Aligned_cols=10  Identities=40%  Similarity=0.860  Sum_probs=8.2

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus         2 ~~~C~~C~k~   11 (29)
T 1rik_A            2 KFACPECPKR   11 (29)
T ss_dssp             CEECSSSSCE
T ss_pred             CccCCCCCch
Confidence            4689999976


No 19 
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ...
Probab=77.27  E-value=0.58  Score=24.39  Aligned_cols=21  Identities=14%  Similarity=0.347  Sum_probs=14.7

Q ss_pred             ccCCCCceecCCCCCeEEEee
Q 035423            4 TLKPGDVIQCRECGYRILYKK   24 (35)
Q Consensus         4 ~lk~~~~irC~~CG~RIlyK~   24 (35)
                      +++......||.||...++..
T Consensus        21 e~~q~~~y~Cp~CG~~~v~r~   41 (83)
T 1vq8_Z           21 ESEMNEDHACPNCGEDRVDRQ   41 (83)
T ss_dssp             HHHHHSCEECSSSCCEEEEEE
T ss_pred             HHhccccCcCCCCCCcceecc
Confidence            344455678999998776654


No 20 
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=76.85  E-value=1.2  Score=16.22  Aligned_cols=10  Identities=30%  Similarity=0.693  Sum_probs=8.5

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus         3 ~~~C~~C~k~   12 (27)
T 2kvh_A            3 PFSCSLCPQR   12 (27)
T ss_dssp             CEECSSSSCE
T ss_pred             CccCCCcChh
Confidence            5789999986


No 21 
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A
Probab=76.41  E-value=1.2  Score=21.49  Aligned_cols=15  Identities=7%  Similarity=0.140  Sum_probs=10.3

Q ss_pred             CceecCCCCC-eEEEe
Q 035423            9 DVIQCRECGY-RILYK   23 (35)
Q Consensus         9 ~~irC~~CG~-RIlyK   23 (35)
                      ....||+||. .|.|-
T Consensus        10 ~~~~Cp~C~~~~lv~D   25 (58)
T 1dl6_A           10 PRVTCPNHPDAILVED   25 (58)
T ss_dssp             SCCSBTTBSSSCCEEC
T ss_pred             ccccCcCCCCCceeEe
Confidence            3448999987 66653


No 22 
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe}
Probab=75.85  E-value=1.3  Score=23.67  Aligned_cols=10  Identities=20%  Similarity=0.557  Sum_probs=8.6

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .+.||.||++
T Consensus        72 ~~~Cp~C~~~   81 (113)
T 3h0g_I           72 DKECPRCHQH   81 (113)
T ss_dssp             CSCCSSSCCS
T ss_pred             ccCCCCCCCc
Confidence            3889999997


No 23 
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=73.93  E-value=1.7  Score=15.80  Aligned_cols=10  Identities=40%  Similarity=0.926  Sum_probs=8.4

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus         3 ~~~C~~C~k~   12 (28)
T 2kvf_A            3 PYSCSVCGKR   12 (28)
T ss_dssp             SEECSSSCCE
T ss_pred             CccCCCCCcc
Confidence            5789999986


No 24 
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus}
Probab=73.08  E-value=2.7  Score=19.86  Aligned_cols=13  Identities=23%  Similarity=0.703  Sum_probs=8.4

Q ss_pred             ecCCCCCeEEEee
Q 035423           12 QCRECGYRILYKK   24 (35)
Q Consensus        12 rC~~CG~RIlyK~   24 (35)
                      -||.||.-+++..
T Consensus        21 ~CP~CG~~~fm~~   33 (50)
T 3j20_Y           21 FCPRCGPGVFMAD   33 (50)
T ss_dssp             ECSSSCSSCEEEE
T ss_pred             cCCCCCCceEEec
Confidence            4778877665543


No 25 
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=73.03  E-value=1.6  Score=15.78  Aligned_cols=10  Identities=40%  Similarity=0.826  Sum_probs=8.4

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|..||..
T Consensus         3 ~~~C~~C~~~   12 (30)
T 2m0d_A            3 PYQCDYCGRS   12 (30)
T ss_dssp             CEECTTTCCE
T ss_pred             CccCCCCCcc
Confidence            5789999975


No 26 
>2gag_D Heterotetrameric sarcosine oxidase delta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_D* 1x31_D* 1vrq_D* 3ad7_D* 3ad8_D* 3ad9_D* 3ada_D*
Probab=72.31  E-value=0.89  Score=24.72  Aligned_cols=10  Identities=50%  Similarity=1.262  Sum_probs=8.3

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .|-||+||-|
T Consensus         3 ~I~CP~CG~R   12 (99)
T 2gag_D            3 LIDCPNCGPR   12 (99)
T ss_dssp             EEEETTTEEE
T ss_pred             EecCCCCCCc
Confidence            5899999965


No 27 
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=71.92  E-value=1.4  Score=16.23  Aligned_cols=10  Identities=20%  Similarity=0.471  Sum_probs=8.3

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus         3 ~~~C~~C~k~   12 (27)
T 2kvg_A            3 PYRCPLCRAG   12 (27)
T ss_dssp             TEEETTTTEE
T ss_pred             CcCCCCCCcc
Confidence            5789999976


No 28 
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=71.72  E-value=1.4  Score=15.89  Aligned_cols=10  Identities=20%  Similarity=0.687  Sum_probs=7.8

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus         2 ~~~C~~C~~~   11 (29)
T 2m0e_A            2 EHKCPHCDKK   11 (29)
T ss_dssp             CCCCSSCCCC
T ss_pred             CCcCCCCCcc
Confidence            4579999975


No 29 
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A
Probab=71.47  E-value=1.8  Score=22.38  Aligned_cols=12  Identities=17%  Similarity=0.531  Sum_probs=9.2

Q ss_pred             eecCCCCCeEEE
Q 035423           11 IQCRECGYRILY   22 (35)
Q Consensus        11 irC~~CG~RIly   22 (35)
                      .+||.||.-.+.
T Consensus         3 M~Cp~Cg~~~~~   14 (133)
T 3o9x_A            3 MKCPVCHQGEMV   14 (133)
T ss_dssp             CBCTTTSSSBEE
T ss_pred             cCCCcCCCCcee
Confidence            589999987553


No 30 
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}
Probab=73.28  E-value=0.88  Score=16.52  Aligned_cols=12  Identities=33%  Similarity=0.883  Sum_probs=8.8

Q ss_pred             ceecCCCCCeEE
Q 035423           10 VIQCRECGYRIL   21 (35)
Q Consensus        10 ~irC~~CG~RIl   21 (35)
                      +..|+.||...-
T Consensus         2 p~~C~~C~k~f~   13 (26)
T 2lvu_A            2 PYVCERCGKRFV   13 (26)
Confidence            457999998643


No 31 
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=69.84  E-value=2.1  Score=15.41  Aligned_cols=10  Identities=50%  Similarity=1.325  Sum_probs=8.0

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus         2 ~~~C~~C~k~   11 (29)
T 2m0f_A            2 PLKCRECGKQ   11 (29)
T ss_dssp             CEECTTTSCE
T ss_pred             CccCCCCCCc
Confidence            4689999975


No 32 
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1
Probab=69.65  E-value=1.8  Score=15.53  Aligned_cols=9  Identities=22%  Similarity=0.637  Sum_probs=7.2

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      ..|+.||..
T Consensus         2 ~~C~~C~k~   10 (27)
T 1znf_A            2 YKCGLCERS   10 (27)
T ss_dssp             CBCSSSCCB
T ss_pred             ccCCCCCCc
Confidence            479999975


No 33 
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A
Probab=69.60  E-value=1.6  Score=15.81  Aligned_cols=10  Identities=40%  Similarity=1.092  Sum_probs=7.9

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus         2 ~~~C~~C~k~   11 (30)
T 1klr_A            2 TYQCQYCEFR   11 (30)
T ss_dssp             CCCCSSSSCC
T ss_pred             CccCCCCCCc
Confidence            3579999976


No 34 
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1
Probab=68.70  E-value=1.9  Score=15.83  Aligned_cols=10  Identities=20%  Similarity=0.547  Sum_probs=7.9

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus         2 ~~~C~~C~k~   11 (30)
T 1paa_A            2 AYACGLCNRA   11 (30)
T ss_dssp             CSBCTTTCCB
T ss_pred             CcCCcccCcc
Confidence            4679999975


No 35 
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A
Probab=68.45  E-value=1.9  Score=16.80  Aligned_cols=11  Identities=27%  Similarity=0.767  Sum_probs=9.0

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        10 k~~~C~~C~k~   20 (37)
T 1p7a_A           10 KPFQCPDCDRS   20 (37)
T ss_dssp             SSBCCTTTCCC
T ss_pred             CCccCCCCCcc
Confidence            46899999975


No 36 
>3po3_S Transcription elongation factor S-II; RNA polymerase II, mRNA, transcription, arrest, BACKTRACKING cleavage, transferase-DNA-RNA complex; HET: DNA BRU EPE PGE; 3.30A {Saccharomyces cerevisiae} PDB: 1y1v_S 1y1y_S 3gtm_S* 1enw_A
Probab=67.92  E-value=1.6  Score=25.06  Aligned_cols=14  Identities=21%  Similarity=0.582  Sum_probs=10.3

Q ss_pred             CCceecCCCCCeEE
Q 035423            8 GDVIQCRECGYRIL   21 (35)
Q Consensus         8 ~~~irC~~CG~RIl   21 (35)
                      .+.+.||.||++=.
T Consensus       135 t~~~~Cp~C~~~~a  148 (178)
T 3po3_S          135 TDRFTCGKCKEKKV  148 (178)
T ss_dssp             BSSSCCSSSCCSCE
T ss_pred             cCCcCCCCCCCCce
Confidence            34578999998643


No 37 
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A
Probab=67.81  E-value=2.1  Score=15.45  Aligned_cols=10  Identities=20%  Similarity=0.551  Sum_probs=7.9

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus         2 ~~~C~~C~~~   11 (29)
T 1ard_A            2 SFVCEVCTRA   11 (29)
T ss_dssp             CCBCTTTCCB
T ss_pred             CeECCCCCcc
Confidence            4679999975


No 38 
>3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus}
Probab=67.12  E-value=2.3  Score=20.54  Aligned_cols=11  Identities=45%  Similarity=1.380  Sum_probs=6.5

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ....|..|||.
T Consensus        27 gaw~CrKCG~~   37 (51)
T 3j21_g           27 GAKKCRKCGYK   37 (51)
T ss_dssp             TCSSCSSSSSC
T ss_pred             CceecCCCCCc
Confidence            34566666665


No 39 
>2l8e_A Polyhomeotic-like protein 1; DNA binding protein; NMR {Homo sapiens}
Probab=67.09  E-value=4.2  Score=19.31  Aligned_cols=12  Identities=25%  Similarity=0.622  Sum_probs=9.7

Q ss_pred             eecCCCCCeEEE
Q 035423           11 IQCRECGYRILY   22 (35)
Q Consensus        11 irC~~CG~RIly   22 (35)
                      ..|.+||.-|.-
T Consensus        19 ~~C~~CG~~i~~   30 (49)
T 2l8e_A           19 LKCEYCGKYAPA   30 (49)
T ss_dssp             EECTTTCCEEEG
T ss_pred             CcChhccCcccc
Confidence            459999998764


No 40 
>1kaf_A Transcription regulatory protein MOTA; escherichia coli, X-RAY crystallography, protein-DNA interactions, structural genomics; 1.60A {Enterobacteria phage T4} SCOP: d.199.1.1
Probab=66.52  E-value=5  Score=22.17  Aligned_cols=18  Identities=33%  Similarity=0.545  Sum_probs=15.5

Q ss_pred             CeEEEeecCCceEEEEeC
Q 035423           18 YRILYKKRTRRIVQYEAR   35 (35)
Q Consensus        18 ~RIlyK~R~~~~~~~~Ar   35 (35)
                      +-|+++||+...+|||-+
T Consensus        35 ~~i~f~KRt~GiRqfEi~   52 (108)
T 1kaf_A           35 YLAILEKRTNGIRNFEIN   52 (108)
T ss_dssp             EEEEEEEEETTEEEEEEC
T ss_pred             eEEeeecccCceeEEEEe
Confidence            568999999999999853


No 41 
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=66.12  E-value=5.2  Score=15.23  Aligned_cols=12  Identities=33%  Similarity=1.041  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus         7 ~k~~~C~~C~k~   18 (36)
T 2elt_A            7 GKPYKCPQCSYA   18 (36)
T ss_dssp             CCSEECSSSSCE
T ss_pred             CCCCCCCCCCcc
Confidence            456899999975


No 42 
>3r8s_0 50S ribosomal protein L32; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 1p85_Z 1p86_Z 2awb_0 2aw4_0 2i2v_0 2j28_0 2i2t_0* 2qao_0* 2qba_0* 2qbc_0* 2qbe_0 2qbg_0 2qbi_0* 2qbk_0* 2qov_0 2qox_0 2qoz_0* 2qp1_0* 2rdo_0 2vhm_0 ...
Probab=66.10  E-value=5.2  Score=19.28  Aligned_cols=16  Identities=13%  Similarity=0.131  Sum_probs=11.9

Q ss_pred             cCC-CCceecCCCCCeE
Q 035423            5 LKP-GDVIQCRECGYRI   20 (35)
Q Consensus         5 lk~-~~~irC~~CG~RI   20 (35)
                      |+. -..+.||.||.-.
T Consensus        21 l~~~p~l~~c~~cGe~~   37 (56)
T 3r8s_0           21 LTAVTSLSVDKTSGEKH   37 (56)
T ss_dssp             CCCCCCEEECTTTCCEE
T ss_pred             cccCCceeECCCCCCee
Confidence            444 5679999999853


No 43 
>2poi_A Baculoviral IAP repeat-containing protein 4; zinc finger, signaling protein/apoptosis complex; 1.80A {Homo sapiens} PDB: 2pop_B
Probab=66.02  E-value=3.2  Score=21.72  Aligned_cols=14  Identities=29%  Similarity=0.816  Sum_probs=11.8

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      .+|.|+|-+||..|
T Consensus        52 ~~D~V~Cf~C~~~l   65 (94)
T 2poi_A           52 EGDTVRCFSCHAAV   65 (94)
T ss_dssp             STTCEEETTTCCEE
T ss_pred             CCCEEEcccCCCEe
Confidence            57899999999764


No 44 
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}
Probab=65.93  E-value=3.1  Score=15.76  Aligned_cols=11  Identities=18%  Similarity=0.329  Sum_probs=9.1

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus         6 k~~~C~~C~k~   16 (35)
T 2elx_A            6 SGYVCALCLKK   16 (35)
T ss_dssp             CSEECSSSCCE
T ss_pred             CCeECCCCcch
Confidence            46899999986


No 45 
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=65.77  E-value=3  Score=16.12  Aligned_cols=13  Identities=31%  Similarity=0.861  Sum_probs=10.1

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      ..+..|+.||...
T Consensus         7 ~k~~~C~~C~k~f   19 (36)
T 2elq_A            7 GKPFKCSLCEYAT   19 (36)
T ss_dssp             CCSEECSSSSCEE
T ss_pred             CCCccCCCCCchh
Confidence            3468999999863


No 46 
>2l7x_A Envelope glycoprotein; cytoplasmic tail, viral protein; NMR {Crimean-congo hemorrhagic fever virus}
Probab=65.43  E-value=1.8  Score=22.80  Aligned_cols=10  Identities=30%  Similarity=0.693  Sum_probs=7.9

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      .-||||+.|.
T Consensus        31 NiCPYC~nRl   40 (77)
T 2l7x_A           31 NICPYCASRL   40 (77)
T ss_dssp             TCCTTTCCCC
T ss_pred             ccChhhhccC
Confidence            3599999984


No 47 
>1ef4_A Subunit N, DNA-directed RNA polymerase; three helix bundle, zinc binding, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus} SCOP: a.4.11.1
Probab=65.29  E-value=1.6  Score=21.56  Aligned_cols=12  Identities=25%  Similarity=0.742  Sum_probs=9.7

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      -||||-.||.=|
T Consensus         2 iPVRCFTCGkvi   13 (55)
T 1ef4_A            2 IPVRCLSCGKPV   13 (55)
T ss_dssp             CSSSCSCTTSCC
T ss_pred             CCeecCCCCCCh
Confidence            379999999754


No 48 
>1lv3_A Hypothetical protein YACG; zinc finger, rubredoxin knuckle, C4 tetrahedral Zn+2, antiparallel beta strand and alpha helix, NESG project; NMR {Escherichia coli} SCOP: g.39.1.9
Probab=65.22  E-value=4.3  Score=20.64  Aligned_cols=18  Identities=17%  Similarity=0.606  Sum_probs=14.2

Q ss_pred             CCCCceecCCCCCeEEEe
Q 035423            6 KPGDVIQCRECGYRILYK   23 (35)
Q Consensus         6 k~~~~irC~~CG~RIlyK   23 (35)
                      .....+.||.||.-+.+.
T Consensus         5 ~~~~~~~CP~Cgkp~~W~   22 (68)
T 1lv3_A            5 SETITVNCPTCGKTVVWG   22 (68)
T ss_dssp             CCCCEEECTTTCCEEECS
T ss_pred             CCCCcCcCCCCCCccccc
Confidence            445678999999998763


No 49 
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1
Probab=65.13  E-value=3.5  Score=21.16  Aligned_cols=11  Identities=27%  Similarity=0.712  Sum_probs=8.8

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      +-.||-||..+
T Consensus        47 g~~CPvCgs~l   57 (112)
T 1l8d_A           47 KGKCPVCGREL   57 (112)
T ss_dssp             SEECTTTCCEE
T ss_pred             CCCCCCCCCcC
Confidence            56799999764


No 50 
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1
Probab=65.09  E-value=3.3  Score=15.82  Aligned_cols=12  Identities=25%  Similarity=0.459  Sum_probs=9.5

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      .+..|..||...
T Consensus         6 k~~~C~~C~k~f   17 (35)
T 1srk_A            6 RPFVCRICLSAF   17 (35)
T ss_dssp             SCEECSSSCCEE
T ss_pred             cCeeCCCCCccc
Confidence            457899999863


No 51 
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=65.07  E-value=4.8  Score=15.46  Aligned_cols=12  Identities=25%  Similarity=0.783  Sum_probs=9.7

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus         7 ~k~~~C~~C~k~   18 (36)
T 2els_A            7 GKIFTCEYCNKV   18 (36)
T ss_dssp             CCCEECTTTCCE
T ss_pred             CCCEECCCCCce
Confidence            456899999986


No 52 
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=64.29  E-value=3.4  Score=16.08  Aligned_cols=12  Identities=17%  Similarity=0.766  Sum_probs=9.6

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      .+..|+.||...
T Consensus         8 k~~~C~~C~k~f   19 (37)
T 2elp_A            8 RAMKCPYCDFYF   19 (37)
T ss_dssp             CCEECSSSSCEE
T ss_pred             CCeECCCCChhh
Confidence            468999999863


No 53 
>3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B30; helix-turn-helix, Zn-binding protein, DNA-binding, transcrip transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A
Probab=64.09  E-value=3.2  Score=20.42  Aligned_cols=12  Identities=17%  Similarity=0.531  Sum_probs=8.8

Q ss_pred             eecCCCCCeEEE
Q 035423           11 IQCRECGYRILY   22 (35)
Q Consensus        11 irC~~CG~RIly   22 (35)
                      .+||.||.--|.
T Consensus         3 m~Cp~Cg~~~l~   14 (78)
T 3ga8_A            3 MKCPVCHQGEMV   14 (78)
T ss_dssp             CBCTTTSSSBEE
T ss_pred             eECCCCCCCeeE
Confidence            589999975343


No 54 
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ...
Probab=63.46  E-value=2.9  Score=22.52  Aligned_cols=10  Identities=30%  Similarity=0.703  Sum_probs=8.8

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .+.||.||++
T Consensus        72 ~~~Cp~C~~~   81 (122)
T 1twf_I           72 DRECPKCHSR   81 (122)
T ss_dssp             CCCCTTTCCC
T ss_pred             CCCCCCCCCC
Confidence            5789999998


No 55 
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4
Probab=63.22  E-value=7.2  Score=19.48  Aligned_cols=15  Identities=13%  Similarity=0.636  Sum_probs=7.8

Q ss_pred             CCCcee-cCCCCCeEE
Q 035423            7 PGDVIQ-CRECGYRIL   21 (35)
Q Consensus         7 ~~~~ir-C~~CG~RIl   21 (35)
                      ..+.++ ||.|++-++
T Consensus        21 ~~~~~~wCP~C~~~~~   36 (86)
T 2ct7_A           21 RDPKFLWCAQCSFGFI   36 (86)
T ss_dssp             SCCCEECCSSSCCCEE
T ss_pred             cCCCEeECcCCCchhe
Confidence            334444 666666543


No 56 
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori}
Probab=62.96  E-value=1.9  Score=22.77  Aligned_cols=13  Identities=15%  Similarity=0.442  Sum_probs=9.4

Q ss_pred             ce-ecCCCCCeEEE
Q 035423           10 VI-QCRECGYRILY   22 (35)
Q Consensus        10 ~i-rC~~CG~RIly   22 (35)
                      .. .||.||+..++
T Consensus        89 ~~~~CP~Cgs~~~~  102 (119)
T 2kdx_A           89 DYGVCEKCHSKNVI  102 (119)
T ss_dssp             TTCCCSSSSSCCCE
T ss_pred             CCCcCccccCCCcE
Confidence            45 79999887544


No 57 
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82
Probab=62.44  E-value=2.9  Score=22.84  Aligned_cols=12  Identities=17%  Similarity=0.423  Sum_probs=8.3

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+.+||.|+..
T Consensus        82 ~kPsrCP~CkSe   93 (105)
T 2gmg_A           82 NIPSRCPKCKSE   93 (105)
T ss_dssp             SCCSSCSSSCCC
T ss_pred             CCCCCCcCCCCC
Confidence            456778888764


No 58 
>2qkd_A Zinc finger protein ZPR1; helical hairpins, beta helix, anti-parrallel beta sheet, double straded anti-parallel beta helix, metal binding protein; 2.00A {Mus musculus}
Probab=62.44  E-value=2.9  Score=27.03  Aligned_cols=10  Identities=30%  Similarity=1.165  Sum_probs=8.6

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ...|++||||
T Consensus        41 Sf~C~~CGyr   50 (404)
T 2qkd_A           41 SFSCEHCGWN   50 (404)
T ss_dssp             EEECTTTCCE
T ss_pred             EEECCCCCCc
Confidence            5689999998


No 59 
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=62.37  E-value=4  Score=15.74  Aligned_cols=12  Identities=25%  Similarity=0.711  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus         7 ~k~~~C~~C~k~   18 (36)
T 2elv_A            7 GLLYDCHICERK   18 (36)
T ss_dssp             CCCEECSSSCCE
T ss_pred             CCCeECCCCCCc
Confidence            346899999976


No 60 
>3d9t_A Baculoviral IAP repeat-containing protein 2; zinc finger, apoptosis, cytoplasm, metal-binding, polymorphism, zinc, zinc-finger, alternative splicing, hydrolase, protease; 1.50A {Homo sapiens} SCOP: g.52.1.1 PDB: 3d9u_A 3uw4_A* 2uvl_A
Probab=62.34  E-value=4.4  Score=21.08  Aligned_cols=14  Identities=21%  Similarity=0.491  Sum_probs=11.5

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      ..|.|+|-+||..+
T Consensus        45 ~~D~v~Cf~C~~~l   58 (97)
T 3d9t_A           45 RNDDVKCFCCDGGL   58 (97)
T ss_dssp             STTCEEETTTCCEE
T ss_pred             CCCEEEecCcCCEe
Confidence            46889999999864


No 61 
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=61.54  E-value=3.9  Score=16.14  Aligned_cols=12  Identities=25%  Similarity=0.797  Sum_probs=9.7

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      .+..|+.||...
T Consensus         8 k~~~C~~C~k~f   19 (37)
T 2elm_A            8 HLYYCSQCHYSS   19 (37)
T ss_dssp             CEEECSSSSCEE
T ss_pred             cCeECCCCCccc
Confidence            468999999874


No 62 
>2qra_D XIAP, baculoviral IAP repeat-containing protein 4, inhibitor; apoptosis, signaling protein, zinc binding; 2.50A {Homo sapiens}
Probab=61.32  E-value=4.3  Score=22.03  Aligned_cols=15  Identities=27%  Similarity=0.738  Sum_probs=12.3

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      ..+|.|+|-+||..|
T Consensus        68 g~~D~V~Cf~C~~~L   82 (111)
T 2qra_D           68 GEGDTVRCFSCHAAV   82 (111)
T ss_dssp             SSTTCEEETTTCCEE
T ss_pred             CCCCEEEcccCCCEe
Confidence            357899999999764


No 63 
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic}
Probab=61.13  E-value=2.4  Score=16.35  Aligned_cols=10  Identities=30%  Similarity=0.800  Sum_probs=7.7

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus         2 p~~C~~C~k~   11 (32)
T 2kfq_A            2 AFACPACPKR   11 (32)
T ss_dssp             CSSSSSSCTT
T ss_pred             CCCCCCCCcc
Confidence            3579999975


No 64 
>1twf_J DNA-directed RNA polymerases I, II, and III 8.3 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.11.1 PDB: 1i3q_J 1i6h_J 1k83_J* 1nik_J 1nt9_J 1pqv_J 1r5u_J 1r9s_J* 1r9t_J* 1sfo_J* 1twa_J* 1twc_J* 1i50_J* 1twg_J* 1twh_J* 1wcm_J 1y1v_J 1y1w_J 1y1y_J 1y77_J* ...
Probab=61.10  E-value=2.5  Score=21.73  Aligned_cols=12  Identities=25%  Similarity=0.708  Sum_probs=9.8

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      -||||-.||.=|
T Consensus         3 iPVRCFTCGkvi   14 (70)
T 1twf_J            3 VPVRCFSCGKVV   14 (70)
T ss_dssp             CCSBCTTTCCBC
T ss_pred             CCeecCCCCCCh
Confidence            479999999754


No 65 
>1dxg_A Desulforedoxin; non-heme iron protein, rubredoxin type metal center, electron transport; 1.80A {Desulfovibrio gigas} SCOP: g.41.5.2 PDB: 1dcd_A 1dhg_A 1cfw_A 2lk5_A 2lk6_A
Probab=60.93  E-value=9  Score=16.63  Aligned_cols=17  Identities=35%  Similarity=0.768  Sum_probs=13.1

Q ss_pred             CCCCceecCCCCCeEEE
Q 035423            6 KPGDVIQCRECGYRILY   22 (35)
Q Consensus         6 k~~~~irC~~CG~RIly   22 (35)
                      +...-.+|+.||+=|..
T Consensus         2 k~~~fY~C~~CGnivev   18 (36)
T 1dxg_A            2 NEGDVYKCELCGQVVKV   18 (36)
T ss_dssp             CTTCEEECTTTCCEEEE
T ss_pred             CcccEEEcCCCCcEEEE
Confidence            45677899999987654


No 66 
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A*
Probab=60.73  E-value=3  Score=22.90  Aligned_cols=13  Identities=23%  Similarity=0.687  Sum_probs=10.3

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      ...||.||+.=++
T Consensus       107 ~~~CP~Cgs~~~~  119 (139)
T 3a43_A          107 FLACPKCGSHDFE  119 (139)
T ss_dssp             GCSCSSSSCCCEE
T ss_pred             CCcCccccCCccE
Confidence            6789999988554


No 67 
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1
Probab=59.84  E-value=3.2  Score=16.09  Aligned_cols=10  Identities=40%  Similarity=0.860  Sum_probs=7.8

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus         2 p~~C~~C~k~   11 (33)
T 1rim_A            2 KFACPECPKR   11 (33)
T ss_dssp             CCCCSSSCCC
T ss_pred             cccCCCCCch
Confidence            3579999975


No 68 
>3m1d_A Baculoviral IAP repeat-containing protein 2; BIR, apoptosis, cytoplasm, polymorphism, zinc, zinc-FIN metal binding protein; 2.00A {Homo sapiens} PDB: 3m0a_D 3m0d_D
Probab=59.83  E-value=5.3  Score=20.40  Aligned_cols=14  Identities=29%  Similarity=0.731  Sum_probs=11.7

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      ..|.|+|-+||-.+
T Consensus        43 ~~D~v~Cf~C~~~l   56 (85)
T 3m1d_A           43 VNDKVKCFCCGLML   56 (85)
T ss_dssp             STTCEEETTTCCEE
T ss_pred             CCCEEEeCCcCCEe
Confidence            46899999999764


No 69 
>3fac_A Putative uncharacterized protein; complete proteome, structural genomics, PSI-2, protein structure initiative; 2.50A {Rhodobacter sphaeroides 2}
Probab=59.42  E-value=11  Score=19.36  Aligned_cols=15  Identities=33%  Similarity=0.700  Sum_probs=12.3

Q ss_pred             eecCCCCCeEEEeec
Q 035423           11 IQCRECGYRILYKKR   25 (35)
Q Consensus        11 irC~~CG~RIlyK~R   25 (35)
                      .-|+.||..+.+...
T Consensus        68 ~FC~~CGs~l~~~~~   82 (118)
T 3fac_A           68 WFCRTCGIYTHHQRR   82 (118)
T ss_dssp             EEETTTCCEEEEECS
T ss_pred             EECCCCCccccCccC
Confidence            469999999888754


No 70 
>3v2d_5 50S ribosomal protein L32; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 2hgq_4 2hgj_4 2hgu_4 2j03_5 2jl6_5 2jl8_5 2v47_5 2v49_5 2wdi_5 2wdj_5 2wdl_5 2wdn_5 2wh2_5 2wh4_5 2wrj_5 2wrl_5 2wro_5 2wrr_5 2x9s_5 2x9u_5 ...
Probab=59.32  E-value=5.8  Score=19.41  Aligned_cols=14  Identities=36%  Similarity=0.885  Sum_probs=9.3

Q ss_pred             cCCCCceecCCCCC
Q 035423            5 LKPGDVIQCRECGY   18 (35)
Q Consensus         5 lk~~~~irC~~CG~   18 (35)
                      |+.-..+.||.||.
T Consensus        25 l~~p~l~~c~~cGe   38 (60)
T 3v2d_5           25 LTPPTLVPCPECKA   38 (60)
T ss_dssp             CCCCCCEECTTTCC
T ss_pred             ccCCceeECCCCCC
Confidence            44555677777776


No 71 
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}
Probab=63.49  E-value=2  Score=15.74  Aligned_cols=11  Identities=36%  Similarity=0.718  Sum_probs=8.3

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      +..|+.||...
T Consensus         2 ~~~C~~C~k~f   12 (29)
T 2lvt_A            2 PCQCVMCGKAF   12 (29)
Confidence            45799999763


No 72 
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=58.72  E-value=5.8  Score=18.78  Aligned_cols=12  Identities=25%  Similarity=0.736  Sum_probs=7.8

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      .++.|++||..+
T Consensus        42 ~~~~C~~C~~~~   53 (75)
T 2d9k_A           42 RTELCGNCGRNV   53 (75)
T ss_dssp             CEEECSSSCCEE
T ss_pred             CceEcccCCCcC
Confidence            356777777753


No 73 
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1
Probab=58.52  E-value=4.7  Score=18.88  Aligned_cols=8  Identities=50%  Similarity=1.398  Sum_probs=4.3

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      -+|+.|||
T Consensus         5 y~C~vCGy   12 (46)
T 6rxn_A            5 YVCNVCGY   12 (46)
T ss_dssp             EEETTTCC
T ss_pred             EECCCCCe
Confidence            45555554


No 74 
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8
Probab=58.38  E-value=4.7  Score=19.31  Aligned_cols=17  Identities=35%  Similarity=0.770  Sum_probs=12.6

Q ss_pred             CCceecCCCCCeEEEee
Q 035423            8 GDVIQCRECGYRILYKK   24 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK~   24 (35)
                      .+...|..||+-.++|.
T Consensus        34 ~dr~~C~kCgyt~~~~~   50 (55)
T 2k4x_A           34 ADRYSCGRCGYTEFKKA   50 (55)
T ss_dssp             SSEEECTTTCCCEECCC
T ss_pred             CCEEECCCCCCEEEeCc
Confidence            46778888888876654


No 75 
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens}
Probab=62.76  E-value=2.1  Score=15.59  Aligned_cols=11  Identities=18%  Similarity=0.507  Sum_probs=8.5

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      +..|+.||...
T Consensus         3 ~~~C~~C~k~f   13 (30)
T 2lvr_A            3 PYVCIHCQRQF   13 (30)
Confidence            46799999864


No 76 
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A
Probab=57.87  E-value=5.2  Score=15.79  Aligned_cols=11  Identities=18%  Similarity=0.437  Sum_probs=9.0

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus         5 k~~~C~~C~k~   15 (39)
T 1njq_A            5 RSYTCSFCKRE   15 (39)
T ss_dssp             SSEECTTTCCE
T ss_pred             CceECCCCCcc
Confidence            35799999976


No 77 
>2con_A RUH-035 protein, NIN one binding protein; ribosome, RNA binding protein, unknown function, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.15.1
Probab=57.59  E-value=3.9  Score=21.20  Aligned_cols=18  Identities=28%  Similarity=0.549  Sum_probs=13.5

Q ss_pred             CCCceecCCCCCeEEEee
Q 035423            7 PGDVIQCRECGYRILYKK   24 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK~   24 (35)
                      ..+..-||.||+.-|.|.
T Consensus        27 ~~~k~FCp~CGn~TL~Rv   44 (79)
T 2con_A           27 DMNRVFCGHCGNKTLKKV   44 (79)
T ss_dssp             CSSCCSCSSSCCSCCEEE
T ss_pred             CcccccccccCcccceEE
Confidence            345678999999877653


No 78 
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=57.19  E-value=3.4  Score=15.98  Aligned_cols=11  Identities=18%  Similarity=0.464  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus         8 k~~~C~~C~k~   18 (37)
T 2elo_A            8 RSYSCPVCEKS   18 (37)
T ss_dssp             CCCEETTTTEE
T ss_pred             CCcCCCCCCCc
Confidence            45789999975


No 79 
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=57.11  E-value=5.4  Score=15.88  Aligned_cols=13  Identities=31%  Similarity=0.823  Sum_probs=10.0

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      ..+..|+.||...
T Consensus         9 ~k~~~C~~C~k~f   21 (42)
T 2en2_A            9 EKPYKCETCGARF   21 (42)
T ss_dssp             SCSEECTTTCCEE
T ss_pred             CCCEeCCCcChhh
Confidence            3468999999863


No 80 
>1g73_C Inhibitors of apoptosis-like protein ILP; helix bundle, zinc-binding domain, apoptosis/apoptosis inhibitor complex; 2.00A {Homo sapiens} SCOP: g.52.1.1 PDB: 3cm2_D* 3clx_D* 3cm7_C* 1f9x_A 1g3f_A 1tfq_A* 1tft_A* 3eyl_A* 3g76_A* 2jk7_A* 2opz_A 2opy_A* 1xb0_A 1xb1_A
Probab=57.08  E-value=6  Score=21.57  Aligned_cols=15  Identities=33%  Similarity=0.826  Sum_probs=12.2

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      ..+|.|+|-+||..+
T Consensus        56 g~~D~V~Cf~C~~~L   70 (121)
T 1g73_C           56 GEGDKVKCFHCGGGL   70 (121)
T ss_dssp             SSTTCEEETTTCCEE
T ss_pred             CCCCEEEcCcCCCCc
Confidence            357889999999764


No 81 
>3hl5_A Baculoviral IAP repeat-containing protein 4; BIR, apoptosis, small molecule drug discovery, structur drug design, ligase, metal-binding; HET: 9JZ; 1.80A {Homo sapiens} PDB: 1nw9_A 2vsl_A
Probab=57.01  E-value=6.2  Score=20.46  Aligned_cols=14  Identities=36%  Similarity=0.911  Sum_probs=11.9

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      .+|.|+|-+||-.+
T Consensus        43 ~~D~v~Cf~C~~~l   56 (95)
T 3hl5_A           43 EGDKVKCFHCGGGL   56 (95)
T ss_dssp             STTCEEETTTCCEE
T ss_pred             CCCeEEecCCCCCc
Confidence            57899999999874


No 82 
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A
Probab=56.65  E-value=5.6  Score=15.75  Aligned_cols=12  Identities=25%  Similarity=0.642  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus         9 ~~~~~C~~C~k~   20 (42)
T 2epc_A            9 ETPYLCGQCGKS   20 (42)
T ss_dssp             SCCEECSSSCCE
T ss_pred             CCCeECCCCCcc
Confidence            346899999986


No 83 
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=56.10  E-value=4.5  Score=15.44  Aligned_cols=12  Identities=33%  Similarity=0.866  Sum_probs=9.2

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus         7 ~~~~~C~~C~k~   18 (36)
T 2elr_A            7 GKTHLCDMCGKK   18 (36)
T ss_dssp             CSSCBCTTTCCB
T ss_pred             CCCeecCcCCCC
Confidence            346789999975


No 84 
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A
Probab=55.97  E-value=3.6  Score=23.38  Aligned_cols=10  Identities=50%  Similarity=1.298  Sum_probs=8.4

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .-+|+.|||-
T Consensus       155 ~~~C~~CG~~  164 (191)
T 1lko_A          155 KWRCRNCGYV  164 (191)
T ss_dssp             EEEETTTCCE
T ss_pred             eEEECCCCCE
Confidence            5789999985


No 85 
>2vm5_A Baculoviral IAP repeat-containing protein 1; apoptosis; 1.80A {Homo sapiens}
Probab=55.95  E-value=6  Score=21.02  Aligned_cols=15  Identities=33%  Similarity=0.689  Sum_probs=12.1

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      ..+|.|+|-+||..+
T Consensus        52 g~~D~V~Cf~C~~~L   66 (106)
T 2vm5_A           52 GKQDTVQCFSCGGCL   66 (106)
T ss_dssp             SSTTCEEETTTCCEE
T ss_pred             CCCCEEEccccCCEe
Confidence            357889999999764


No 86 
>1qxf_A GR2, 30S ribosomal protein S27E; structural genomics, beta sheet, PSI, protein structure initiative; NMR {Archaeoglobus fulgidus} SCOP: g.41.8.4
Probab=55.51  E-value=4.7  Score=20.53  Aligned_cols=11  Identities=18%  Similarity=0.673  Sum_probs=8.2

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..|+||.|+.-
T Consensus         6 m~VKCp~C~ni   16 (66)
T 1qxf_A            6 VKVKCPDCEHE   16 (66)
T ss_dssp             EEEECTTTCCE
T ss_pred             EEEECCCCCCc
Confidence            35889999864


No 87 
>1jd5_A DIAP1, apoptosis 1 inhibitor; IAP, caspase activation; 1.90A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1jd4_A 1jd6_A 1q4q_A
Probab=55.33  E-value=7.5  Score=21.36  Aligned_cols=14  Identities=36%  Similarity=0.869  Sum_probs=12.0

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      .+|.|+|-+||..|
T Consensus        57 ~~D~V~Cf~C~~~L   70 (124)
T 1jd5_A           57 VGDRVRCFSCGGGL   70 (124)
T ss_dssp             STTCEEETTTCCEE
T ss_pred             CCCEEEecCCCCEe
Confidence            47899999999875


No 88 
>3j20_W 30S ribosomal protein S27E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus}
Probab=55.32  E-value=4.8  Score=20.29  Aligned_cols=11  Identities=27%  Similarity=0.833  Sum_probs=8.7

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..|+||.|+.-
T Consensus        14 m~VkCp~C~~~   24 (63)
T 3j20_W           14 LRVKCIDCGNE   24 (63)
T ss_dssp             EEEECSSSCCE
T ss_pred             EEEECCCCCCe
Confidence            35899999874


No 89 
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=55.15  E-value=6  Score=15.95  Aligned_cols=11  Identities=18%  Similarity=0.610  Sum_probs=9.2

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (44)
T 2emb_A           11 KRYECSKCQAT   21 (44)
T ss_dssp             SSEECTTTCCE
T ss_pred             CCeECCCCCCc
Confidence            46899999986


No 90 
>1se0_A Apoptosis 1 inhibitor; apoptosis, IAP, BIR, caspase; 1.75A {Drosophila melanogaster} SCOP: g.52.1.1 PDB: 1sdz_A 3sip_E
Probab=54.91  E-value=6.9  Score=21.18  Aligned_cols=14  Identities=43%  Similarity=0.959  Sum_probs=11.9

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      .+|.|+|-+||..+
T Consensus        45 ~~D~V~Cf~C~~~L   58 (116)
T 1se0_A           45 AGDKVKCFFCGVEI   58 (116)
T ss_dssp             STTCEEETTTCCEE
T ss_pred             CCCEEEecCcCCEe
Confidence            57889999999874


No 91 
>2zjr_Z 50S ribosomal protein L32; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: g.41.8.5 PDB: 1j5a_M* 1jzy_M* 1jzz_M* 1k01_M* 1nkw_Z 1ond_Z* 1sm1_Z* 1yl3_5 2b66_5 2b9n_5 2b9p_5 2zjp_Y* 2zjq_Z 1jzx_M 3cf5_Y* 3dll_Y* 3pio_Z* 3pip_Z* 1nwy_Z* 1nwx_Z* ...
Probab=54.61  E-value=7.8  Score=18.91  Aligned_cols=15  Identities=20%  Similarity=0.645  Sum_probs=10.1

Q ss_pred             cCCCCceecCCCCCe
Q 035423            5 LKPGDVIQCRECGYR   19 (35)
Q Consensus         5 lk~~~~irC~~CG~R   19 (35)
                      |..-..+.|+.||.-
T Consensus        25 l~~p~l~~c~~cG~~   39 (60)
T 2zjr_Z           25 LTAPNLTECPQCHGK   39 (60)
T ss_dssp             CCCCCCEECTTTCCE
T ss_pred             ccCCCceECCCCCCE
Confidence            455566778877764


No 92 
>2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5
Probab=54.57  E-value=4.7  Score=23.16  Aligned_cols=14  Identities=29%  Similarity=0.816  Sum_probs=10.0

Q ss_pred             CCCCceecCCCCCe
Q 035423            6 KPGDVIQCRECGYR   19 (35)
Q Consensus         6 k~~~~irC~~CG~R   19 (35)
                      ..++..-||+|||-
T Consensus        40 eDg~l~vCPeC~hE   53 (138)
T 2akl_A           40 EDGALLVCPECAHE   53 (138)
T ss_dssp             ECSSSEEETTTTEE
T ss_pred             ecCCeEECCccccc
Confidence            34566788888875


No 93 
>2qfa_A Baculoviral IAP repeat-containing protein 5; three-helical-bundle, long helix, protein complex, alternative splicing, apoptosis, cell cycle, cell division; HET: MES; 1.40A {Homo sapiens} SCOP: g.52.1.1 PDB: 1e31_A* 4a0i_A 4a0j_A* 4a0n_A* 2raw_A 3uec_A* 3ued_A* 3uef_A 3uig_A* 3uih_A 3uii_A 1f3h_A 3uee_A 3ueg_A* 3uei_A 3ueh_A* 3uik_A 3uij_A 1m4m_A 2rax_A ...
Probab=54.44  E-value=6.9  Score=21.59  Aligned_cols=13  Identities=31%  Similarity=0.478  Sum_probs=11.0

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      .|.|+|-+||..|
T Consensus        52 ~D~V~Cf~C~~~L   64 (142)
T 2qfa_A           52 PDLAQCFFCFKEL   64 (142)
T ss_dssp             TTCEEETTTCCEE
T ss_pred             CCEEEcCCCCCEe
Confidence            4889999999764


No 94 
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=54.34  E-value=6.4  Score=15.95  Aligned_cols=12  Identities=33%  Similarity=0.819  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2eow_A           10 EKPYKCNECGKA   21 (46)
T ss_dssp             CCCEECTTSCCE
T ss_pred             CCCeeccccCCh
Confidence            346899999986


No 95 
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A
Probab=53.93  E-value=6.8  Score=22.09  Aligned_cols=12  Identities=42%  Similarity=0.938  Sum_probs=8.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ...-+|+.|||-
T Consensus       136 ~~~~~C~~CG~i  147 (170)
T 3pwf_A          136 KKVYICPICGYT  147 (170)
T ss_dssp             SCEEECTTTCCE
T ss_pred             CCeeEeCCCCCe
Confidence            345678888884


No 96 
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=53.82  E-value=6.6  Score=15.55  Aligned_cols=12  Identities=42%  Similarity=0.985  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus         8 ~k~~~C~~C~k~   19 (41)
T 2ept_A            8 QRVYECQECGKS   19 (41)
T ss_dssp             CCCEECSSSCCE
T ss_pred             CCCeECCCCCCC
Confidence            346899999976


No 97 
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A
Probab=53.70  E-value=6.8  Score=18.55  Aligned_cols=8  Identities=50%  Similarity=1.377  Sum_probs=4.3

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      -+|+.|||
T Consensus         4 y~C~~CGy   11 (52)
T 1e8j_A            4 YVCTVCGY   11 (52)
T ss_dssp             EECSSSCC
T ss_pred             EEeCCCCe
Confidence            45555554


No 98 
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718}
Probab=53.63  E-value=5.7  Score=21.45  Aligned_cols=14  Identities=21%  Similarity=0.698  Sum_probs=10.8

Q ss_pred             eecCCCCCeEEEee
Q 035423           11 IQCRECGYRILYKK   24 (35)
Q Consensus        11 irC~~CG~RIlyK~   24 (35)
                      --||.||.+.-+..
T Consensus         4 ~~C~~CG~~~~~~~   17 (189)
T 3cng_A            4 KFCSQCGGEVILRI   17 (189)
T ss_dssp             CBCTTTCCBCEEEC
T ss_pred             ccCchhCCcccccc
Confidence            35999999977654


No 99 
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis}
Probab=53.43  E-value=7  Score=20.30  Aligned_cols=13  Identities=23%  Similarity=0.884  Sum_probs=8.9

Q ss_pred             CCCceecCCCCCe
Q 035423            7 PGDVIQCRECGYR   19 (35)
Q Consensus         7 ~~~~irC~~CG~R   19 (35)
                      ....-+|+.|||-
T Consensus        24 em~~y~C~vCGyv   36 (81)
T 2kn9_A           24 DYKLFRCIQCGFE   36 (81)
T ss_dssp             CCCEEEETTTCCE
T ss_pred             CcceEEeCCCCEE
Confidence            3456788888873


No 100
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=53.25  E-value=6.8  Score=15.90  Aligned_cols=12  Identities=33%  Similarity=0.825  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (44)
T 2epv_A           10 EKPYECNECGKA   21 (44)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CcCeECCCCCcc
Confidence            346899999986


No 101
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=52.91  E-value=4.4  Score=16.53  Aligned_cols=8  Identities=13%  Similarity=-0.047  Sum_probs=4.0

Q ss_pred             ceecCCCC
Q 035423           10 VIQCRECG   17 (35)
Q Consensus        10 ~irC~~CG   17 (35)
                      +..|+.||
T Consensus        38 ~~~C~~cg   45 (45)
T 2epq_A           38 GKSGPSSG   45 (45)
T ss_dssp             CCCCCCCC
T ss_pred             CCCCcCCC
Confidence            34455554


No 102
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=52.74  E-value=7  Score=15.82  Aligned_cols=12  Identities=33%  Similarity=0.783  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (46)
T 2yrj_A           10 EKPYRCGECGKA   21 (46)
T ss_dssp             CCCEECSSSCCE
T ss_pred             CCCeECCCCCCc
Confidence            346899999986


No 103
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A
Probab=52.53  E-value=6.8  Score=15.99  Aligned_cols=12  Identities=33%  Similarity=0.858  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2emj_A           10 EKPFECAECGKS   21 (46)
T ss_dssp             CCSEECSSSSCE
T ss_pred             CCCEECCCCCcc
Confidence            346899999976


No 104
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=52.46  E-value=6.9  Score=15.75  Aligned_cols=11  Identities=18%  Similarity=0.703  Sum_probs=9.2

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (44)
T 2yu5_A           11 NPFKCSKCDRV   21 (44)
T ss_dssp             CSEECSSSSCE
T ss_pred             CCeECCCCCch
Confidence            46899999986


No 105
>2riq_A Poly [ADP-ribose] polymerase 1; Zn-binding domain, Zn ribbon, Zn finger, ADP-ribosylation, D damage, DNA repair, DNA-binding, glycosyltransferase; 1.70A {Homo sapiens} PDB: 2jvn_A
Probab=52.04  E-value=6.4  Score=22.60  Aligned_cols=17  Identities=29%  Similarity=0.952  Sum_probs=13.5

Q ss_pred             CCceecCCCCCeEEEee
Q 035423            8 GDVIQCRECGYRILYKK   24 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK~   24 (35)
                      |..-.||.|+.++.|..
T Consensus        76 Gal~~CP~C~G~l~y~~   92 (160)
T 2riq_A           76 GALLPCEECSGQLVFKS   92 (160)
T ss_dssp             CEECCCTTTCCCEEEET
T ss_pred             CCCCCCCCCCCEEEEeC
Confidence            44568999999998864


No 106
>3siq_A Apoptosis 1 inhibitor; DIAP1-BIR1 domain, ligase; 2.40A {Drosophila melanogaster}
Probab=51.89  E-value=8  Score=21.75  Aligned_cols=14  Identities=43%  Similarity=0.959  Sum_probs=12.0

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      .+|.++|-+||..+
T Consensus        67 ~~D~V~Cf~C~~~L   80 (136)
T 3siq_A           67 AGDKVKCFFCGVEI   80 (136)
T ss_dssp             STTCEEETTTCCEE
T ss_pred             CCCeEEEeccCCEe
Confidence            57899999999874


No 107
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A
Probab=51.78  E-value=5  Score=23.16  Aligned_cols=11  Identities=36%  Similarity=0.854  Sum_probs=9.0

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..-+|+.|||-
T Consensus       170 ~~~~C~~CG~i  180 (202)
T 1yuz_A          170 KFHLCPICGYI  180 (202)
T ss_dssp             CEEECSSSCCE
T ss_pred             cEEEECCCCCE
Confidence            45789999985


No 108
>2zjr_1 50S ribosomal protein L33; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: g.41.8.6 PDB: 1nwx_1* 1xbp_1* 2zjp_1* 2zjq_1 1nwy_1 3cf5_1* 3dll_1* 3pio_1* 3pip_1* 1pnu_1 1pny_1 1vor_3 1vou_3 1vow_3 1voy_3 1vp0_3
Probab=51.65  E-value=9.2  Score=18.41  Aligned_cols=13  Identities=0%  Similarity=0.107  Sum_probs=11.0

Q ss_pred             ecCCCCCeEEEee
Q 035423           12 QCRECGYRILYKK   24 (35)
Q Consensus        12 rC~~CG~RIlyK~   24 (35)
                      -||.|+...|+|+
T Consensus        40 ycp~~~kHtlhkE   52 (55)
T 2zjr_1           40 YDPVAKKHVVFRE   52 (55)
T ss_pred             cCCCCCCEEeEEE
Confidence            4899999999887


No 109
>2ftc_P Mitochondrial ribosomal protein L33 isoform A, mitochondrial 39S ribosomal protein L27; mitochondrial ribosome, large ribosomal subunit, ribosomal R ribosome; 12.10A {Bos taurus} PDB: 3iy9_P
Probab=51.25  E-value=9  Score=18.18  Aligned_cols=13  Identities=15%  Similarity=0.153  Sum_probs=10.6

Q ss_pred             ecCCCCCeEEEee
Q 035423           12 QCRECGYRILYKK   24 (35)
Q Consensus        12 rC~~CG~RIlyK~   24 (35)
                      -||.|+.-.|||+
T Consensus        38 ycp~~~khtlhkE   50 (52)
T 2ftc_P           38 YDPVVKQRVLFVE   50 (52)
T ss_pred             cCCCCCceEeEEe
Confidence            3888888888886


No 110
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=51.22  E-value=7.6  Score=15.69  Aligned_cols=12  Identities=33%  Similarity=0.736  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2yts_A           10 EKPYICNECGKS   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CcCEECCCCChh
Confidence            346899999976


No 111
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y*
Probab=51.14  E-value=3.3  Score=21.21  Aligned_cols=16  Identities=25%  Similarity=0.688  Sum_probs=12.0

Q ss_pred             cccCCCCceecCCCCC
Q 035423            3 NTLKPGDVIQCRECGY   18 (35)
Q Consensus         3 ~~lk~~~~irC~~CG~   18 (35)
                      .++++...-.||.||.
T Consensus        20 ie~~q~~ky~C~fCgk   35 (73)
T 1ffk_W           20 VEIKHKKKYKCPVCGF   35 (73)
T ss_pred             HHHhcccCccCCCCCC
Confidence            4566677788999986


No 112
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=51.10  E-value=7.7  Score=15.81  Aligned_cols=11  Identities=18%  Similarity=0.739  Sum_probs=9.1

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2eoy_A           11 KCFKCNKCEKT   21 (46)
T ss_dssp             CCEECSSSCCE
T ss_pred             CCEECcCCCCc
Confidence            46899999976


No 113
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=51.04  E-value=7.7  Score=15.80  Aligned_cols=12  Identities=25%  Similarity=0.780  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2yto_A           10 EKPYKCSDCGKA   21 (46)
T ss_dssp             CCCEECSSSCCE
T ss_pred             CCCEECcccCCc
Confidence            346899999986


No 114
>3mup_A Baculoviral IAP repeat-containing protein 2; zinc-finger motif, apoptosis inhibitor; HET: SMK; 2.60A {Homo sapiens} SCOP: g.52.1.1 PDB: 3oz1_A* 4eb9_A*
Probab=50.95  E-value=8  Score=21.13  Aligned_cols=14  Identities=21%  Similarity=0.491  Sum_probs=11.9

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      .+|.|+|-.||-.+
T Consensus        51 ~~D~V~Cf~C~~~L   64 (122)
T 3mup_A           51 RNDDVKCFCCDGGL   64 (122)
T ss_dssp             STTCEEETTTCCEE
T ss_pred             CCCeEEecCcCCEe
Confidence            46899999999874


No 115
>3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae}
Probab=50.86  E-value=3.2  Score=22.96  Aligned_cols=11  Identities=27%  Similarity=0.558  Sum_probs=0.0

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      .+.||.||++=
T Consensus        92 ~~~CpkCg~~~  102 (133)
T 3qt1_I           92 DRECPKCHSRE  102 (133)
T ss_dssp             -----------
T ss_pred             cCCCCCCCCce
Confidence            48999999863


No 116
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=50.77  E-value=5.7  Score=16.25  Aligned_cols=12  Identities=25%  Similarity=0.631  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2eoz_A           10 EKPYSCNVCGKA   21 (46)
T ss_dssp             CCSEEETTTTEE
T ss_pred             CCCeECcccChh
Confidence            346899999976


No 117
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=50.61  E-value=5.9  Score=15.68  Aligned_cols=11  Identities=27%  Similarity=0.842  Sum_probs=9.0

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        10 k~~~C~~C~k~   20 (42)
T 2ytb_A           10 KPYRCDQCGKA   20 (42)
T ss_dssp             CSBCCTTTTCC
T ss_pred             CCeeCCCccch
Confidence            46789999975


No 118
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=50.58  E-value=7.9  Score=15.77  Aligned_cols=12  Identities=33%  Similarity=0.783  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2ytp_A           10 ERHYECSECGKA   21 (46)
T ss_dssp             CCCEECSSSCCE
T ss_pred             CCCeECCcCCcc
Confidence            346889999976


No 119
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=50.49  E-value=8  Score=15.63  Aligned_cols=12  Identities=25%  Similarity=0.545  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2eme_A           10 EKPYVCDYCGKA   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CCCeECCCCChh
Confidence            346899999976


No 120
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=50.43  E-value=8  Score=15.76  Aligned_cols=11  Identities=36%  Similarity=0.818  Sum_probs=9.1

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2em4_A           11 RPYECIECGKA   21 (46)
T ss_dssp             SSEECSSSCCE
T ss_pred             cCcCCCCCCCc
Confidence            46899999976


No 121
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=50.19  E-value=6.2  Score=15.73  Aligned_cols=11  Identities=36%  Similarity=0.845  Sum_probs=9.0

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        10 k~~~C~~C~k~   20 (42)
T 2eos_A           10 KPYPCEICGTR   20 (42)
T ss_dssp             CCBCCSSSCCC
T ss_pred             CCEECCCCCCc
Confidence            46789999975


No 122
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa}
Probab=50.19  E-value=7.3  Score=18.64  Aligned_cols=8  Identities=50%  Similarity=1.319  Sum_probs=4.5

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      -+|+.|||
T Consensus         4 y~C~~CGy   11 (55)
T 2v3b_B            4 WQCVVCGF   11 (55)
T ss_dssp             EEETTTCC
T ss_pred             EEeCCCCe
Confidence            45566665


No 123
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=50.18  E-value=8.1  Score=15.67  Aligned_cols=12  Identities=42%  Similarity=1.043  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2en3_A           10 EKPFQCKECGMN   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CCCeeCcccChh
Confidence            346899999986


No 124
>2c6a_A Ubiquitin-protein ligase E3 MDM2; zinc finger, human MDM2, phosphorylation, alternative splicing, metal-binding, nuclear protein, proto- oncogene; NMR {Homo sapiens} SCOP: g.41.11.1 PDB: 2c6b_A
Probab=50.17  E-value=6.3  Score=18.85  Aligned_cols=17  Identities=18%  Similarity=0.526  Sum_probs=13.9

Q ss_pred             ccccCCCCceecCCCCC
Q 035423            2 ENTLKPGDVIQCRECGY   18 (35)
Q Consensus         2 ~~~lk~~~~irC~~CG~   18 (35)
                      |.+|...|--+|++|+.
T Consensus         5 D~di~~~D~WkC~~C~~   21 (46)
T 2c6a_A            5 DPEISLADYWKCTSCNE   21 (46)
T ss_dssp             CSSSCGGGCEECTTTCC
T ss_pred             CCccCccceEecccccc
Confidence            56777889999999984


No 125
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A
Probab=50.14  E-value=8.2  Score=15.26  Aligned_cols=12  Identities=33%  Similarity=0.858  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus         8 ~k~~~C~~C~k~   19 (42)
T 2el5_A            8 ENPYECSECGKA   19 (42)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CCCccCCCcChh
Confidence            346899999976


No 126
>3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A
Probab=49.99  E-value=7.2  Score=21.87  Aligned_cols=14  Identities=43%  Similarity=1.047  Sum_probs=11.0

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      ....++||+||..-
T Consensus       153 ~~~~~~cp~~g~~e  166 (179)
T 3m7n_A          153 EGDILKCPECGRVE  166 (179)
T ss_dssp             CSSSEECSSSCCEE
T ss_pred             CCCEEECCCCCCEE
Confidence            34789999999863


No 127
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B
Probab=49.87  E-value=8.5  Score=16.36  Aligned_cols=13  Identities=23%  Similarity=0.542  Sum_probs=10.0

Q ss_pred             CCCceecCCCCCe
Q 035423            7 PGDVIQCRECGYR   19 (35)
Q Consensus         7 ~~~~irC~~CG~R   19 (35)
                      ...+..|+.||..
T Consensus         5 gekp~~C~~CgK~   17 (36)
T 1fv5_A            5 KPARFMCLPCGIA   17 (36)
T ss_dssp             SCCCCEETTTTEE
T ss_pred             CccCeECCCCCCc
Confidence            3457899999975


No 128
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=49.83  E-value=8.2  Score=15.59  Aligned_cols=12  Identities=33%  Similarity=0.800  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (46)
T 2eor_A           10 EKPYNCEECGKA   21 (46)
T ss_dssp             CCSEECTTTCCE
T ss_pred             CcCccCCCCCCC
Confidence            346899999976


No 129
>2i3h_A Baculoviral IAP repeat-containing protein 7; zinc binding, peptide complex, apoptosis inhibition, peptidomimetic, small molecule, drug design, inhibitor/apoptosis complex; HET: BTB; 1.62A {Homo sapiens} SCOP: g.52.1.1 PDB: 2i3i_A* 3f7h_A* 3f7i_A* 3gt9_A* 3gta_A* 1tw6_A* 3uw5_A* 3f7g_A* 1oxn_A* 1oxq_A* 1oy7_A*
Probab=49.75  E-value=8.4  Score=21.49  Aligned_cols=15  Identities=20%  Similarity=0.315  Sum_probs=12.2

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      ...|.|+|-+||..|
T Consensus        78 g~~D~V~Cf~C~~~L   92 (133)
T 2i3h_A           78 GHQDKVRCFFCYGGL   92 (133)
T ss_dssp             SSTTCEEETTTCCEE
T ss_pred             CCCCEEEecccCCEe
Confidence            347889999999764


No 130
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=49.46  E-value=8.4  Score=15.67  Aligned_cols=12  Identities=33%  Similarity=0.933  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2em2_A           10 EKPFKCKECGKA   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CCCEECCcCCch
Confidence            346899999986


No 131
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=49.12  E-value=8.6  Score=15.58  Aligned_cols=12  Identities=33%  Similarity=0.794  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2ep3_A           10 EKPYRCAECGKA   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CCCeECCCCCch
Confidence            346899999986


No 132
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=49.12  E-value=8.6  Score=15.58  Aligned_cols=12  Identities=33%  Similarity=0.783  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (46)
T 2emi_A           10 ERHYECSECGKA   21 (46)
T ss_dssp             CCCEECSSSCCE
T ss_pred             CCCCCCCCCCcc
Confidence            346899999976


No 133
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A
Probab=49.06  E-value=8.6  Score=15.51  Aligned_cols=12  Identities=33%  Similarity=0.875  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2em9_A           10 EKPYNCKECGKS   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CcCeECCccccc
Confidence            346899999976


No 134
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4
Probab=49.05  E-value=5.4  Score=20.78  Aligned_cols=11  Identities=18%  Similarity=0.495  Sum_probs=9.2

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..-.||.|||-
T Consensus        22 t~F~CPfCnh~   32 (85)
T 1wii_A           22 TQFTCPFCNHE   32 (85)
T ss_dssp             SCCCCTTTCCS
T ss_pred             CeEcCCCCCCC
Confidence            45689999998


No 135
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.99  E-value=8.7  Score=15.57  Aligned_cols=12  Identities=33%  Similarity=0.700  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2ytj_A           10 EKPYICAECGKA   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CcCeECCCCChh
Confidence            346899999986


No 136
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.88  E-value=6.7  Score=15.94  Aligned_cols=12  Identities=33%  Similarity=0.780  Sum_probs=9.4

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2enf_A           10 EKPYKCNECGKV   21 (46)
T ss_dssp             CCSCBCSSSCCB
T ss_pred             CcCeECCCCCcc
Confidence            346789999976


No 137
>3v2d_6 50S ribosomal protein L33; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 2hgq_5 2hgj_5 2hgu_5 2j03_6 2jl6_6 2jl8_6 2v47_6 2v49_6 2wdi_6 2wdj_6 2wdl_6 2wdn_6 2wh2_6 2wh4_6 2wrj_6 2wrl_6 2wro_6 2wrr_6 2x9s_6 2x9u_6 ...
Probab=48.72  E-value=9.4  Score=18.37  Aligned_cols=12  Identities=17%  Similarity=0.507  Sum_probs=9.2

Q ss_pred             cCCCCCeEEEee
Q 035423           13 CRECGYRILYKK   24 (35)
Q Consensus        13 C~~CG~RIlyK~   24 (35)
                      ||.|+.-.|+|+
T Consensus        40 cp~c~kHtlhkE   51 (54)
T 3v2d_6           40 CPWCRKHTVHRE   51 (54)
T ss_dssp             ETTTTEEEEEEE
T ss_pred             CCCCCCEeeEEE
Confidence            777877777775


No 138
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.67  E-value=8.8  Score=15.48  Aligned_cols=12  Identities=25%  Similarity=0.648  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2ytf_A           10 EKPFECSECQKA   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CCCcCCCCCCcc
Confidence            346899999976


No 139
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.66  E-value=8.8  Score=15.55  Aligned_cols=12  Identities=33%  Similarity=0.789  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2eq0_A           10 EKPYKCHECGKV   21 (46)
T ss_dssp             CCCEECTTTCCE
T ss_pred             CCCeECCCCCch
Confidence            446899999986


No 140
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.37  E-value=9  Score=15.45  Aligned_cols=11  Identities=36%  Similarity=0.890  Sum_probs=9.1

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2epw_A           11 KPCKCTECGKA   21 (46)
T ss_dssp             CSEECSSSCCE
T ss_pred             CCeeCCCCCCc
Confidence            46899999986


No 141
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.19  E-value=9.1  Score=15.56  Aligned_cols=12  Identities=42%  Similarity=1.057  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2emf_A           10 GKHFECTECGKA   21 (46)
T ss_dssp             SCCEECSSSCCE
T ss_pred             CCCeECCCCCch
Confidence            346899999976


No 142
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ...
Probab=48.13  E-value=5.9  Score=18.76  Aligned_cols=8  Identities=50%  Similarity=1.680  Sum_probs=5.8

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      -+|+.|||
T Consensus         3 ~~C~~CGy   10 (52)
T 1yk4_A            3 LSCKICGY   10 (52)
T ss_dssp             EEESSSSC
T ss_pred             EEeCCCCe
Confidence            46777876


No 143
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.08  E-value=7  Score=16.00  Aligned_cols=12  Identities=25%  Similarity=0.700  Sum_probs=9.3

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2eon_A           10 EKPYKCQVCGKA   21 (46)
T ss_dssp             CCSCBCSSSCCB
T ss_pred             CcccCCCCCCcc
Confidence            346789999976


No 144
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=48.06  E-value=8.9  Score=15.38  Aligned_cols=12  Identities=17%  Similarity=0.396  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus         8 ~k~~~C~~C~k~   19 (44)
T 2emx_A            8 EKPFGCSCCEKA   19 (44)
T ss_dssp             CCCEECSSSSCE
T ss_pred             CcCccCCCCCcc
Confidence            346899999986


No 145
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.06  E-value=9.2  Score=15.49  Aligned_cols=12  Identities=33%  Similarity=0.880  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2emy_A           10 ENPYECHECGKA   21 (46)
T ss_dssp             SCCEECSSSCCE
T ss_pred             CcCcCCCCCCcc
Confidence            346899999986


No 146
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=47.94  E-value=9.2  Score=15.48  Aligned_cols=11  Identities=36%  Similarity=0.908  Sum_probs=9.2

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2em7_A           11 KPYKCEECGKG   21 (46)
T ss_dssp             CSEECSSSCCE
T ss_pred             cCccCCCccch
Confidence            46899999976


No 147
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A
Probab=47.93  E-value=9.2  Score=15.48  Aligned_cols=12  Identities=33%  Similarity=0.775  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2ema_A           10 EKRYKCNECGKV   21 (46)
T ss_dssp             SCCEECSSSCCE
T ss_pred             CcCcCCCCCcch
Confidence            346899999976


No 148
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.93  E-value=5.8  Score=15.92  Aligned_cols=11  Identities=36%  Similarity=0.857  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (44)
T 2eoj_A           11 NPYECCECGKV   21 (44)
T ss_dssp             CSCEETTTTEE
T ss_pred             cCeeCCCCCCc
Confidence            46899999975


No 149
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.89  E-value=9.2  Score=15.20  Aligned_cols=12  Identities=25%  Similarity=0.614  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (44)
T 2eof_A           10 EKPYECNECQKA   21 (44)
T ss_dssp             CCSEECTTTCCE
T ss_pred             CCCeECCCCCcc
Confidence            346899999976


No 150
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A*
Probab=47.86  E-value=8.9  Score=16.33  Aligned_cols=11  Identities=18%  Similarity=0.289  Sum_probs=9.1

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        23 k~~~C~~C~k~   33 (54)
T 1yui_A           23 QPATCPICYAV   33 (54)
T ss_dssp             CCEECTTTCCE
T ss_pred             CCccCCCCCcc
Confidence            46889999976


No 151
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.85  E-value=7.1  Score=15.40  Aligned_cols=11  Identities=27%  Similarity=0.612  Sum_probs=8.8

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus         9 k~~~C~~C~k~   19 (42)
T 2yte_A            9 KPYSCAECKET   19 (42)
T ss_dssp             CSCBCTTTCCB
T ss_pred             CCeECCCCCCc
Confidence            45789999975


No 152
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens}
Probab=47.78  E-value=8.8  Score=16.10  Aligned_cols=11  Identities=27%  Similarity=0.769  Sum_probs=8.3

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        31 ~~~~C~~C~~~   41 (57)
T 3uk3_C           31 KPYKCEFCEYA   41 (57)
T ss_dssp             CCEECSSSSCE
T ss_pred             CCcCCCCCcch
Confidence            35789999875


No 153
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens}
Probab=47.32  E-value=9.3  Score=16.10  Aligned_cols=11  Identities=36%  Similarity=0.818  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|..||..
T Consensus         6 kp~~C~~C~k~   16 (48)
T 3iuf_A            6 KPYACDICGKR   16 (48)
T ss_dssp             SCEECTTTCCE
T ss_pred             cCEECCCcCcc
Confidence            35789999976


No 154
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.09  E-value=9.7  Score=15.41  Aligned_cols=12  Identities=33%  Similarity=0.681  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2emp_A           10 VKPYMCNECGKA   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CcCeECCCCCch
Confidence            346899999986


No 155
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.07  E-value=9.7  Score=15.41  Aligned_cols=12  Identities=17%  Similarity=0.567  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (46)
T 2em3_A           10 EKPYECKVCSKA   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CcCeECCCCCcc
Confidence            346899999976


No 156
>1i4o_C X-linked IAP, baculoviral IAP repeat-containing protein 4; protease-inhibitor, apoptosis-hydrolase complex; 2.40A {Homo sapiens} PDB: 1kmc_C 1i51_E 1i3o_E 1c9q_A
Probab=46.73  E-value=8.8  Score=21.51  Aligned_cols=14  Identities=43%  Similarity=0.902  Sum_probs=11.7

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      .+|.|+|-+||..|
T Consensus        75 ~~D~V~Cf~C~~~L   88 (141)
T 1i4o_C           75 IGDQVQCFCCGGKL   88 (141)
T ss_pred             CCCEEEeccCCCEe
Confidence            47889999999764


No 157
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=46.70  E-value=11  Score=18.77  Aligned_cols=12  Identities=33%  Similarity=0.897  Sum_probs=9.4

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      ..++|+.|+|++
T Consensus        27 ~g~~C~~C~h~f   38 (74)
T 2ct0_A           27 QGQSCETCGIRM   38 (74)
T ss_dssp             SSEECSSSCCEE
T ss_pred             cCCccCCCCchh
Confidence            457899999874


No 158
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.67  E-value=9.9  Score=15.38  Aligned_cols=12  Identities=33%  Similarity=0.780  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2yu8_A           10 EKPYKCNECGKV   21 (46)
T ss_dssp             CSSEECSSSCCE
T ss_pred             CCCeECCcCCch
Confidence            346899999976


No 159
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.67  E-value=5.9  Score=16.06  Aligned_cols=12  Identities=25%  Similarity=0.772  Sum_probs=9.3

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2eq3_A           10 EKPYECNQCGKA   21 (46)
T ss_dssp             CCSSEETTTTEE
T ss_pred             CCCeECCCCChh
Confidence            346889999975


No 160
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.54  E-value=10  Score=15.30  Aligned_cols=12  Identities=33%  Similarity=0.767  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2emm_A           10 ERPHKCNECGKS   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CCCeeCCCCChh
Confidence            346899999976


No 161
>3r8s_1 50S ribosomal protein L33; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 3fik_1 3j19_1 2wwq_4 3oat_1* 3oas_1* 3ofd_1 3ofc_1 3ofr_1* 3ofz_1* 3og0_1 3ofq_1 3r8t_1 3i1n_1 1vs8_1 1vs6_1 1vt2_1 3i1p_1 3i1r_1 3i1t_1 3i20_1 ...
Probab=46.49  E-value=9.5  Score=18.06  Aligned_cols=13  Identities=15%  Similarity=0.192  Sum_probs=9.9

Q ss_pred             ecCCCCCeEEEee
Q 035423           12 QCRECGYRILYKK   24 (35)
Q Consensus        12 rC~~CG~RIlyK~   24 (35)
                      -||.|+...|+|+
T Consensus        36 ycp~~~khtlhkE   48 (50)
T 3r8s_1           36 FDPVVRQHVIYKE   48 (50)
T ss_dssp             EETTTTEEEEEEC
T ss_pred             eCcCCCCEeeEEE
Confidence            3788888888775


No 162
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.49  E-value=7.6  Score=15.82  Aligned_cols=11  Identities=18%  Similarity=0.510  Sum_probs=9.0

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2enh_A           11 KPYECDVCRKA   21 (46)
T ss_dssp             SSCBCTTTCCB
T ss_pred             CCcCCCCcCch
Confidence            46789999976


No 163
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.34  E-value=7.7  Score=15.74  Aligned_cols=11  Identities=36%  Similarity=0.860  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2emg_A           11 NPFICSECGKV   21 (46)
T ss_dssp             CSCBCTTTCCB
T ss_pred             CCEECCccCcc
Confidence            45789999975


No 164
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.25  E-value=10  Score=15.36  Aligned_cols=12  Identities=33%  Similarity=0.841  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (46)
T 2ytg_A           10 EKPFKCGECGKS   21 (46)
T ss_dssp             CCSEECTTTCCE
T ss_pred             CCCeECCCCCcc
Confidence            346899999976


No 165
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=46.21  E-value=10  Score=15.40  Aligned_cols=12  Identities=42%  Similarity=0.830  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (46)
T 2em5_A           10 TKSHQCHECGRG   21 (46)
T ss_dssp             SCSEECSSSCCE
T ss_pred             CCCeECCcCCCc
Confidence            346899999976


No 166
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.20  E-value=10  Score=15.34  Aligned_cols=12  Identities=33%  Similarity=0.780  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2ene_A           10 EKPYKCNECGKV   21 (46)
T ss_dssp             SSSEECSSSCCE
T ss_pred             CCCeECCCCCch
Confidence            346899999976


No 167
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.07  E-value=10  Score=15.33  Aligned_cols=12  Identities=33%  Similarity=0.780  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (46)
T 2ytk_A           10 EKPYKCNECGKV   21 (46)
T ss_dssp             SCSEECSSSCCE
T ss_pred             CCCEeCCcCCCc
Confidence            346899999976


No 168
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.00  E-value=7.5  Score=15.61  Aligned_cols=11  Identities=36%  Similarity=0.918  Sum_probs=9.0

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 ~~~~C~~C~k~   21 (44)
T 2eox_A           11 KSYNCNECGKA   21 (44)
T ss_dssp             CCEEETTTTEE
T ss_pred             CCeECcccCcc
Confidence            46899999975


No 169
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4
Probab=45.84  E-value=7  Score=16.34  Aligned_cols=12  Identities=25%  Similarity=0.664  Sum_probs=9.3

Q ss_pred             ceecCCCCCeEE
Q 035423           10 VIQCRECGYRIL   21 (35)
Q Consensus        10 ~irC~~CG~RIl   21 (35)
                      +-+|+.||..|.
T Consensus         3 ~~~C~~C~k~Vy   14 (31)
T 1zfo_A            3 NPNCARCGKIVY   14 (31)
T ss_dssp             CCBCSSSCSBCC
T ss_pred             CCcCCccCCEEe
Confidence            458999998853


No 170
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=45.76  E-value=7.6  Score=15.74  Aligned_cols=12  Identities=25%  Similarity=0.775  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (45)
T 2epu_A           10 QKPFECTHCGKS   21 (45)
T ss_dssp             CCSEEETTTTEE
T ss_pred             CcCccCCCCCCc
Confidence            346899999976


No 171
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1
Probab=45.60  E-value=10  Score=16.13  Aligned_cols=11  Identities=18%  Similarity=0.455  Sum_probs=8.8

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        29 ~~~~C~~C~~~   39 (60)
T 2adr_A           29 KPYPCGLCNRA   39 (60)
T ss_dssp             CSEECTTTCCE
T ss_pred             CCccCCCCCCc
Confidence            46889999975


No 172
>2lo3_A SAGA-associated factor 73; zinc-finger, deubiquitination, transcription factor, SAGA CO transcription; NMR {Saccharomyces cerevisiae}
Probab=45.56  E-value=6.4  Score=18.72  Aligned_cols=16  Identities=25%  Similarity=0.600  Sum_probs=11.7

Q ss_pred             CCCceecCCCCCeEEE
Q 035423            7 PGDVIQCRECGYRILY   22 (35)
Q Consensus         7 ~~~~irC~~CG~RIly   22 (35)
                      +.+---|..||..|++
T Consensus        14 ~~~YRvC~~CgkPi~l   29 (44)
T 2lo3_A           14 PIQYRVCEKCGKPLAL   29 (44)
T ss_dssp             CCCEEECTTTCCEEET
T ss_pred             cccchhhcccCCcchH
Confidence            3344569999999875


No 173
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=45.52  E-value=11  Score=15.28  Aligned_cols=11  Identities=36%  Similarity=0.960  Sum_probs=9.2

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2enc_A           11 KPFKCEECGKG   21 (46)
T ss_dssp             CSEECSSSCCE
T ss_pred             CCcCCCCCCCc
Confidence            46899999986


No 174
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A
Probab=45.49  E-value=9.6  Score=19.04  Aligned_cols=9  Identities=44%  Similarity=1.372  Sum_probs=5.6

Q ss_pred             ceecCCCCC
Q 035423           10 VIQCRECGY   18 (35)
Q Consensus        10 ~irC~~CG~   18 (35)
                      .-+|+.|||
T Consensus         7 ~y~C~vCGy   15 (70)
T 1dx8_A            7 KYECEACGY   15 (70)
T ss_dssp             CEEETTTCC
T ss_pred             eEEeCCCCE
Confidence            456666665


No 175
>2qgp_A HNH endonuclease; Q39X46, GMR87, X-RAY, NESG, structural genomics, PSI-2, protein structure initiative; 2.60A {Geobacter metallireducens gs-15}
Probab=45.18  E-value=6.6  Score=20.63  Aligned_cols=12  Identities=25%  Similarity=0.409  Sum_probs=9.4

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      +.-+|++||..+
T Consensus        34 ~~~~C~yCg~~~   45 (112)
T 2qgp_A           34 ARGICHYCGEIF   45 (112)
T ss_dssp             HHTBCTTTCCBC
T ss_pred             cCCcCCCCCCcC
Confidence            346899999875


No 176
>3mkr_B Coatomer subunit alpha; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}
Probab=45.15  E-value=11  Score=23.74  Aligned_cols=12  Identities=25%  Similarity=0.293  Sum_probs=10.4

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      .+.++||+||..
T Consensus       276 ~~~v~Cp~cgA~  287 (320)
T 3mkr_B          276 KPVEKCPLSGAC  287 (320)
T ss_dssp             SCCEECTTTCCE
T ss_pred             CCCccCCCCCCe
Confidence            567899999986


No 177
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=45.04  E-value=7.6  Score=15.83  Aligned_cols=11  Identities=27%  Similarity=0.779  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2eoh_A           11 KPYECKECRKT   21 (46)
T ss_dssp             CSCCCSSSCCC
T ss_pred             CCcCCCCcCch
Confidence            45789999975


No 178
>3u5c_b RP61, YS20, 40S ribosomal protein S27-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_X 3u5g_b
Probab=44.96  E-value=8.7  Score=20.24  Aligned_cols=11  Identities=18%  Similarity=0.329  Sum_probs=8.8

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..|+||.|+.-
T Consensus        33 m~VkCp~C~~~   43 (82)
T 3u5c_b           33 LDVKCPGCLNI   43 (82)
T ss_dssp             EEEECTTSCSC
T ss_pred             EEEECCCCCCe
Confidence            35899999874


No 179
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=44.93  E-value=8.4  Score=15.67  Aligned_cols=12  Identities=25%  Similarity=0.728  Sum_probs=9.3

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2em6_A           10 EKCYKCDVCGKE   21 (46)
T ss_dssp             CCCCBCSSSCCB
T ss_pred             CCCeECCCCCcc
Confidence            345789999975


No 180
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=44.92  E-value=6.6  Score=15.97  Aligned_cols=12  Identities=33%  Similarity=0.780  Sum_probs=9.2

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2yti_A           10 EKPYKCNECGKV   21 (46)
T ss_dssp             CCTTCCSSSCCC
T ss_pred             CcCeECCCCCcc
Confidence            345789999975


No 181
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=44.88  E-value=7.2  Score=15.56  Aligned_cols=11  Identities=36%  Similarity=0.827  Sum_probs=8.8

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (44)
T 2en7_A           11 KPYVCNECGKA   21 (44)
T ss_dssp             SSSCCTTTCCC
T ss_pred             cCeECCCCCCc
Confidence            45789999975


No 182
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus}
Probab=44.79  E-value=2.1  Score=22.02  Aligned_cols=16  Identities=19%  Similarity=0.555  Sum_probs=10.3

Q ss_pred             ccCCCCceecCCCCCe
Q 035423            4 TLKPGDVIQCRECGYR   19 (35)
Q Consensus         4 ~lk~~~~irC~~CG~R   19 (35)
                      |+++...-.||.||.-
T Consensus        20 e~~q~~ky~C~fCgk~   35 (72)
T 3jyw_9           20 EIQQHARYDCSFCGKK   35 (72)
T ss_dssp             HHHHHSCBCCSSCCSS
T ss_pred             HHHhccCccCCCCCCc
Confidence            4445556678888854


No 183
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=44.75  E-value=11  Score=15.22  Aligned_cols=12  Identities=25%  Similarity=0.659  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2eml_A           10 EKPYECSVCGKA   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CCCeeCCCcCCc
Confidence            346899999976


No 184
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=44.75  E-value=11  Score=15.23  Aligned_cols=12  Identities=25%  Similarity=0.537  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2emh_A           10 ERPYICTVCGKA   21 (46)
T ss_dssp             CCSEECTTTCCE
T ss_pred             CCCcCCCCCCch
Confidence            346899999976


No 185
>2ayj_A 50S ribosomal protein L40E; Zn-binding, beta-strand protein, structural genomics, PSI, protein structure initiative; NMR {Sulfolobus solfataricus} SCOP: g.41.8.7
Probab=44.71  E-value=8.2  Score=19.06  Aligned_cols=14  Identities=29%  Similarity=0.524  Sum_probs=10.7

Q ss_pred             CCceecCCCCCeEE
Q 035423            8 GDVIQCRECGYRIL   21 (35)
Q Consensus         8 ~~~irC~~CG~RIl   21 (35)
                      -...+|+.|||.=|
T Consensus        31 ~~A~~CRKCg~~~L   44 (56)
T 2ayj_A           31 IRATKCRRCHSTNL   44 (56)
T ss_dssp             TTCSSCTTTCCCCE
T ss_pred             cccccccCCCCCCC
Confidence            34688999999844


No 186
>3q87_A Putative uncharacterized protein ECU08_1170; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi}
Probab=44.44  E-value=7.5  Score=21.61  Aligned_cols=18  Identities=22%  Similarity=0.442  Sum_probs=12.8

Q ss_pred             ceecCCCCCeEEEeecCC
Q 035423           10 VIQCRECGYRILYKKRTR   27 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R~~   27 (35)
                      ...||+||+.--.+..-+
T Consensus        99 ~L~Cp~cgr~ypI~~GIP  116 (125)
T 3q87_A           99 SLRCDMCGLIYPIKGSIV  116 (125)
T ss_dssp             EEEETTTCCEEEEETTEE
T ss_pred             EEECCCCCCEeeccCCcc
Confidence            578999999765554433


No 187
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=44.43  E-value=11  Score=15.14  Aligned_cols=12  Identities=33%  Similarity=0.767  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (46)
T 2en8_A           10 EKSHTCDECGKN   21 (46)
T ss_dssp             CSSEECTTTCCE
T ss_pred             CCCeECCCcCcc
Confidence            346899999976


No 188
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus}
Probab=44.39  E-value=2.2  Score=22.46  Aligned_cols=16  Identities=25%  Similarity=0.484  Sum_probs=11.1

Q ss_pred             ccCCCCceecCCCCCe
Q 035423            4 TLKPGDVIQCRECGYR   19 (35)
Q Consensus         4 ~lk~~~~irC~~CG~R   19 (35)
                      ++++...-.||.||.-
T Consensus        29 e~~q~~ky~CpfCGk~   44 (83)
T 3j21_i           29 EAKMRQKHTCPVCGRK   44 (83)
T ss_dssp             HHHHHSCBCCSSSCSS
T ss_pred             HHHhhcccCCCCCCCc
Confidence            4455566778888865


No 189
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=44.14  E-value=8.7  Score=15.63  Aligned_cols=11  Identities=55%  Similarity=1.168  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2yth_A           11 KPFQCEECGKR   21 (46)
T ss_dssp             SSBCCSSSCCC
T ss_pred             cCCCCCCCCcc
Confidence            45889999975


No 190
>1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1
Probab=44.09  E-value=5.7  Score=17.49  Aligned_cols=10  Identities=30%  Similarity=0.979  Sum_probs=7.9

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ..+|..||++
T Consensus        21 ~l~C~aCG~~   30 (36)
T 1k81_A           21 LLKCMACGAI   30 (36)
T ss_dssp             EEEEETTTEE
T ss_pred             EEEhhcCCCc
Confidence            4678899886


No 191
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A
Probab=44.07  E-value=11  Score=15.79  Aligned_cols=11  Identities=18%  Similarity=0.721  Sum_probs=8.8

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        28 ~~~~C~~C~~~   38 (57)
T 1bbo_A           28 RPYHCTYCNFS   38 (57)
T ss_dssp             CCEECSSSSCE
T ss_pred             CCccCCCCCch
Confidence            46889999975


No 192
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=44.02  E-value=11  Score=15.22  Aligned_cols=12  Identities=33%  Similarity=0.744  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2em8_A           10 EKPYKCVECGKG   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CCCeECcccCch
Confidence            346899999976


No 193
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A
Probab=44.00  E-value=11  Score=15.14  Aligned_cols=12  Identities=17%  Similarity=0.457  Sum_probs=9.4

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2el4_A           10 VKPYGCSQCAKT   21 (46)
T ss_dssp             CCSEECSSSSCE
T ss_pred             CCceECCCCCch
Confidence            346899999976


No 194
>3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A
Probab=43.98  E-value=12  Score=23.72  Aligned_cols=12  Identities=8%  Similarity=0.016  Sum_probs=10.7

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      .+.++||+||.+
T Consensus       285 ~~~v~Cp~cgA~  296 (325)
T 3mv2_A          285 TPSVSDPLTGSK  296 (325)
T ss_dssp             SCEEECTTTCCE
T ss_pred             CCCccCCCCCCe
Confidence            678999999987


No 195
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=43.82  E-value=12  Score=15.15  Aligned_cols=12  Identities=50%  Similarity=0.889  Sum_probs=9.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (46)
T 2yso_A           10 EKSHQCRECGEI   21 (46)
T ss_dssp             CCCEECTTTCCE
T ss_pred             CCCEEccccChh
Confidence            346899999986


No 196
>1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1
Probab=43.77  E-value=8.9  Score=20.15  Aligned_cols=12  Identities=25%  Similarity=0.329  Sum_probs=8.2

Q ss_pred             CCCceecCCCCC
Q 035423            7 PGDVIQCRECGY   18 (35)
Q Consensus         7 ~~~~irC~~CG~   18 (35)
                      ....-+|+.|||
T Consensus        32 ~m~~y~C~vCGy   43 (87)
T 1s24_A           32 AYLKWICITCGH   43 (87)
T ss_dssp             CCCEEEETTTTE
T ss_pred             CCceEECCCCCe
Confidence            345677888886


No 197
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus}
Probab=43.74  E-value=7.6  Score=20.98  Aligned_cols=10  Identities=40%  Similarity=1.012  Sum_probs=8.2

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      ..+||.||--
T Consensus        51 ~FkCP~CgEE   60 (95)
T 2k5c_A           51 VFKCPVCGEE   60 (95)
T ss_dssp             EEECTTTCCE
T ss_pred             hhcCCCccHH
Confidence            4689999976


No 198
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=43.73  E-value=12  Score=15.19  Aligned_cols=12  Identities=33%  Similarity=0.753  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2eoo_A           10 ERPYGCNECGKN   21 (46)
T ss_dssp             CCCEECSSSCCE
T ss_pred             CCCEEccccCcc
Confidence            346899999976


No 199
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=43.72  E-value=8  Score=15.69  Aligned_cols=11  Identities=36%  Similarity=0.918  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2eq1_A           11 KPYKCNECGKA   21 (46)
T ss_dssp             CCCCCTTTTCC
T ss_pred             CCeECCcCChh
Confidence            45789999975


No 200
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=43.63  E-value=9  Score=15.52  Aligned_cols=12  Identities=33%  Similarity=0.772  Sum_probs=9.3

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2ytn_A           10 KKPYKCNECGKV   21 (46)
T ss_dssp             CSSCBCTTTCCB
T ss_pred             CcCeECCCCCCe
Confidence            346789999975


No 201
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1
Probab=43.60  E-value=11  Score=16.70  Aligned_cols=10  Identities=20%  Similarity=0.617  Sum_probs=5.8

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus        39 ~~~C~~C~k~   48 (62)
T 1vd4_A           39 TFRCTFCHTE   48 (62)
T ss_dssp             EEBCSSSCCB
T ss_pred             CEECCCCCCc
Confidence            4556666654


No 202
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=43.44  E-value=9.2  Score=15.42  Aligned_cols=11  Identities=27%  Similarity=0.887  Sum_probs=9.0

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 ~~~~C~~C~k~   21 (46)
T 2eov_A           11 KPYKCSDCGKS   21 (46)
T ss_dssp             CSCBCSSSCCB
T ss_pred             CCccCCccChh
Confidence            46889999975


No 203
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1
Probab=43.28  E-value=17  Score=15.69  Aligned_cols=12  Identities=25%  Similarity=0.307  Sum_probs=8.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        38 ~~~~~C~~C~k~   49 (66)
T 2drp_A           38 VKVYPCPFCFKE   49 (66)
T ss_dssp             CCCEECTTTCCE
T ss_pred             CcCeECCCCCCc
Confidence            346788888865


No 204
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=43.06  E-value=12  Score=15.07  Aligned_cols=12  Identities=25%  Similarity=0.648  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2ep2_A           10 EKPYECSICGKS   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CcCcCCCCCCcc
Confidence            346899999976


No 205
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.88  E-value=9.3  Score=15.41  Aligned_cols=11  Identities=36%  Similarity=0.842  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (47)
T 2epx_A           11 KPYECIECGKA   21 (47)
T ss_dssp             CSBCCSSSCCC
T ss_pred             CCEECCccCch
Confidence            46889999975


No 206
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.65  E-value=12  Score=15.04  Aligned_cols=11  Identities=36%  Similarity=0.902  Sum_probs=9.1

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2ytd_A           11 KPYKCSECGKA   21 (46)
T ss_dssp             CSEECSSSCCE
T ss_pred             cCeECCCCCCe
Confidence            46899999976


No 207
>2xzm_6 RPS27E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_6
Probab=42.42  E-value=9.9  Score=19.96  Aligned_cols=11  Identities=18%  Similarity=0.546  Sum_probs=8.3

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..|+||.|+.-
T Consensus        31 m~VkCp~C~n~   41 (81)
T 2xzm_6           31 MDVKCAQCQNI   41 (81)
T ss_dssp             EEEECSSSCCE
T ss_pred             EEeECCCCCCe
Confidence            35899999864


No 208
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.31  E-value=9.7  Score=15.47  Aligned_cols=11  Identities=27%  Similarity=0.857  Sum_probs=8.8

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2en9_A           11 KLFKCNECKKT   21 (46)
T ss_dssp             CCCBCTTTCCB
T ss_pred             CCEECCccCcc
Confidence            45789999975


No 209
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A
Probab=42.30  E-value=12  Score=15.33  Aligned_cols=12  Identities=42%  Similarity=0.972  Sum_probs=8.9

Q ss_pred             CCCceecCCCCC
Q 035423            7 PGDVIQCRECGY   18 (35)
Q Consensus         7 ~~~~irC~~CG~   18 (35)
                      +...+.|-+||-
T Consensus         3 ~r~~~~C~nCgk   14 (29)
T 1nc8_A            3 QRKVIRCWNCGK   14 (29)
T ss_dssp             CCCCCBCTTTSC
T ss_pred             CCCCCEEEECCc
Confidence            345688999985


No 210
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=42.30  E-value=18  Score=15.89  Aligned_cols=11  Identities=18%  Similarity=0.453  Sum_probs=6.5

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|++||..
T Consensus         9 ~~~~C~~C~k~   19 (66)
T 2eod_A            9 RTQPCTYCTKE   19 (66)
T ss_dssp             CEEECSSSCCE
T ss_pred             CCeeccccCCc
Confidence            34566666655


No 211
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=42.25  E-value=8.2  Score=15.65  Aligned_cols=12  Identities=50%  Similarity=1.057  Sum_probs=9.2

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2eq2_A           10 GKPYQCNECGKA   21 (46)
T ss_dssp             SCSSSCCSSCCC
T ss_pred             CCCeECCCCCcc
Confidence            345789999975


No 212
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens}
Probab=41.98  E-value=13  Score=21.94  Aligned_cols=11  Identities=36%  Similarity=0.951  Sum_probs=8.2

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      .++|+.|++++
T Consensus       193 g~~C~~C~~~~  203 (238)
T 3nw0_A          193 GQSCETCGIRM  203 (238)
T ss_dssp             CEECSSSCCEE
T ss_pred             CcccCccChHH
Confidence            57888888764


No 213
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A
Probab=41.81  E-value=9.9  Score=15.43  Aligned_cols=11  Identities=36%  Similarity=0.887  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2ely_A           11 KPFKCVECGKG   21 (46)
T ss_dssp             CSBCCSSSCCC
T ss_pred             CCcccCccCcc
Confidence            45789999975


No 214
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=41.71  E-value=10  Score=15.30  Aligned_cols=11  Identities=36%  Similarity=0.903  Sum_probs=9.0

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus         9 k~~~C~~C~k~   19 (43)
T 2yrm_A            9 GAFFCNECDCR   19 (43)
T ss_dssp             CCBCCSSSCCC
T ss_pred             CCEECCCCCCe
Confidence            46789999976


No 215
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ...
Probab=41.71  E-value=12  Score=17.92  Aligned_cols=7  Identities=57%  Similarity=1.678  Sum_probs=3.3

Q ss_pred             ecCCCCC
Q 035423           12 QCRECGY   18 (35)
Q Consensus        12 rC~~CG~   18 (35)
                      +|+.|||
T Consensus         5 ~C~vCGy   11 (54)
T 4rxn_A            5 TCTVCGY   11 (54)
T ss_dssp             EETTTCC
T ss_pred             ECCCCCe
Confidence            4444444


No 216
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=41.57  E-value=9.2  Score=15.54  Aligned_cols=11  Identities=36%  Similarity=0.933  Sum_probs=8.8

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2emz_A           11 RPFKCNECGKG   21 (46)
T ss_dssp             CSCCCSSSCCC
T ss_pred             CCeECCCCCcc
Confidence            45789999975


No 217
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=41.56  E-value=10  Score=15.39  Aligned_cols=11  Identities=36%  Similarity=0.827  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2ytq_A           11 KPYGCSECGKA   21 (46)
T ss_dssp             CSCBCSSSCCB
T ss_pred             CCcCCCccChh
Confidence            45789999976


No 218
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens}
Probab=41.35  E-value=13  Score=15.05  Aligned_cols=11  Identities=18%  Similarity=0.685  Sum_probs=9.1

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2el6_A           11 NPYKCSQCEKS   21 (46)
T ss_dssp             CSEECSSSSCE
T ss_pred             CCeECCCCCcc
Confidence            46899999976


No 219
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A
Probab=41.05  E-value=11  Score=18.20  Aligned_cols=12  Identities=33%  Similarity=0.360  Sum_probs=9.4

Q ss_pred             CCCceecCCCCC
Q 035423            7 PGDVIQCRECGY   18 (35)
Q Consensus         7 ~~~~irC~~CG~   18 (35)
                      ..+..+|.+||-
T Consensus        20 ~~~~~~C~~Cge   31 (56)
T 1u6p_A           20 QLDRDQCAYCKE   31 (56)
T ss_dssp             TCCTTBCSSSCC
T ss_pred             CCCCCcceeCCC
Confidence            456789999985


No 220
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=40.91  E-value=9.2  Score=15.42  Aligned_cols=11  Identities=36%  Similarity=1.087  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2eq4_A           11 KLYNCKECGKS   21 (46)
T ss_dssp             CCCCBTTTTBC
T ss_pred             CCeECCCCCCc
Confidence            45789999975


No 221
>2nap_A Protein (periplasmic nitrate reductase); nitrogenous acceptor, dissimilatory nitrate reductase; HET: MGD MES; 1.90A {Desulfovibrio desulfuricans} SCOP: b.52.2.2 c.81.1.1 PDB: 2jim_A* 2jir_A* 2jip_A* 2v45_A* 2v3v_A* 2jiq_A* 2jio_A*
Probab=40.79  E-value=29  Score=22.47  Aligned_cols=33  Identities=21%  Similarity=0.321  Sum_probs=22.1

Q ss_pred             ccccCCCCceecCCC--CCeEEEeecCCceEEEEe
Q 035423            2 ENTLKPGDVIQCREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus         2 ~~~lk~~~~irC~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      +|.....-.--|++|  |+.|+...+..+++.++.
T Consensus         2 ~~~~~~~~~t~C~~C~~gC~i~v~v~~g~v~~v~g   36 (723)
T 2nap_A            2 DNRPEKWVKGVCRYCGTGCGVLVGVKDGKAVAIQG   36 (723)
T ss_dssp             --CCSEEEEEECSSCTTCCEEEEEEETTEEEEEEE
T ss_pred             CCccceEEeEECCCCCCCCcEEEEEECCEEEEEEe
Confidence            344444445679999  578888888888777764


No 222
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=40.59  E-value=11  Score=15.31  Aligned_cols=12  Identities=25%  Similarity=0.786  Sum_probs=9.3

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2elz_A           10 EKPYKCEDCGKG   21 (46)
T ss_dssp             CSSCBCSSSCCB
T ss_pred             CCCeeCcccCch
Confidence            346889999975


No 223
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=40.58  E-value=9.8  Score=15.39  Aligned_cols=11  Identities=27%  Similarity=0.773  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 ~~~~C~~C~k~   21 (46)
T 2eoq_A           11 KPFKCDICGKS   21 (46)
T ss_dssp             CSCCCSSSCCC
T ss_pred             CCcCCCcCCch
Confidence            46789999975


No 224
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1
Probab=40.52  E-value=13  Score=16.38  Aligned_cols=10  Identities=40%  Similarity=0.730  Sum_probs=7.0

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus        49 ~~~C~~C~~~   58 (73)
T 1f2i_G           49 PFQCRICMRN   58 (73)
T ss_dssp             CEECTTTCCE
T ss_pred             CeECCCCCch
Confidence            4678888764


No 225
>3j21_V 50S ribosomal protein L24E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus}
Probab=40.48  E-value=8.5  Score=19.31  Aligned_cols=10  Identities=30%  Similarity=0.680  Sum_probs=7.8

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      -.|.+||+.|
T Consensus         5 ~~C~Fcg~~I   14 (66)
T 3j21_V            5 NVCSYCGKPF   14 (66)
T ss_dssp             CBCTTTCSBC
T ss_pred             eEecCcCCcc
Confidence            4699998875


No 226
>1x6m_A GFA, glutathione-dependent formaldehyde-activating ENZ; Zn-enzyme, 3_10 helix, lyase; 2.35A {Paracoccus denitrificans} SCOP: b.88.1.4 PDB: 1xa8_A*
Probab=40.44  E-value=13  Score=21.07  Aligned_cols=16  Identities=25%  Similarity=0.746  Sum_probs=13.0

Q ss_pred             eecCCCCCeEEEeecC
Q 035423           11 IQCRECGYRILYKKRT   26 (35)
Q Consensus        11 irC~~CG~RIlyK~R~   26 (35)
                      .-|+.||..+.+....
T Consensus        99 ~FC~~CGs~l~~~~~~  114 (196)
T 1x6m_A           99 HRCRDCGVHMYGRIEN  114 (196)
T ss_dssp             EEETTTCCEEEEEECC
T ss_pred             EECCCCCCcCCccccc
Confidence            4699999999887653


No 227
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=40.40  E-value=9.3  Score=15.40  Aligned_cols=12  Identities=25%  Similarity=0.797  Sum_probs=9.2

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2ep1_A           10 EKPYECSDCGKS   21 (46)
T ss_dssp             CCSSCCSSSCCC
T ss_pred             CCCcCCCCCCch
Confidence            345789999975


No 228
>3iz6_X 40S ribosomal protein S27 (S27E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}
Probab=40.35  E-value=11  Score=20.00  Aligned_cols=10  Identities=20%  Similarity=0.547  Sum_probs=8.2

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .|+||.|+.-
T Consensus        36 ~VkCp~C~~~   45 (86)
T 3iz6_X           36 DVKCQGCFNI   45 (86)
T ss_dssp             EEECTTTCCE
T ss_pred             EEECCCCCCe
Confidence            4999999874


No 229
>1pqv_S STP-alpha, transcription elongation factor S-II, DNA; mRNA cleavage, proofreading, BACKTRACKING, gene expression, multiprotein complex; 3.80A {Saccharomyces cerevisiae} SCOP: i.8.1.1 PDB: 1eo0_A
Probab=40.33  E-value=12  Score=22.83  Aligned_cols=14  Identities=21%  Similarity=0.562  Sum_probs=10.6

Q ss_pred             CceecCCCCCeEEE
Q 035423            9 DVIQCRECGYRILY   22 (35)
Q Consensus         9 ~~irC~~CG~RIly   22 (35)
                      +.+.|+.||++=.|
T Consensus       267 ~~~~C~~C~~~~~~  280 (309)
T 1pqv_S          267 DRFTCGKCKEKKVS  280 (309)
T ss_pred             ccccCCCCCCCeeE
Confidence            35799999987543


No 230
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=40.06  E-value=10  Score=15.48  Aligned_cols=11  Identities=27%  Similarity=0.682  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2eom_A           11 RGHRCSDCGKF   21 (46)
T ss_dssp             SSCCCSSSCCC
T ss_pred             CCcCCCCCCCe
Confidence            45789999975


No 231
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=39.66  E-value=10  Score=15.23  Aligned_cols=12  Identities=33%  Similarity=0.805  Sum_probs=9.2

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (44)
T 2eou_A           10 KTTSECQECGKI   21 (44)
T ss_dssp             SCCCCCTTTCCC
T ss_pred             CcCeECCCCCcc
Confidence            345789999975


No 232
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=39.61  E-value=15  Score=14.79  Aligned_cols=12  Identities=17%  Similarity=0.440  Sum_probs=9.5

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (46)
T 2ep0_A           10 EKPYKCDVCHKS   21 (46)
T ss_dssp             CCSEECSSSCCE
T ss_pred             CCCeeCcccCcc
Confidence            346899999976


No 233
>3mhs_C SAGA-associated factor 11; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3m99_B 3mhh_C 4fjc_C 4fk5_C 4fip_C 2lo2_A 3kjl_E 3kik_E
Probab=39.55  E-value=18  Score=19.53  Aligned_cols=15  Identities=27%  Similarity=0.864  Sum_probs=12.0

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      +......|++||--|
T Consensus        66 ~~s~~~~C~nC~R~v   80 (99)
T 3mhs_C           66 ESSQYIHCENCGRDV   80 (99)
T ss_dssp             TTSCEEECTTTCCEE
T ss_pred             cCCCeEECCCCCCCc
Confidence            566778999999765


No 234
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=39.53  E-value=11  Score=15.24  Aligned_cols=12  Identities=25%  Similarity=0.744  Sum_probs=9.4

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2ysp_A           10 EKPYKCEKCGKG   21 (46)
T ss_dssp             CCSEEETTTTEE
T ss_pred             CCCeECCCCCCc
Confidence            346899999975


No 235
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=39.40  E-value=8.9  Score=15.46  Aligned_cols=11  Identities=36%  Similarity=0.918  Sum_probs=8.8

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2ytr_A           11 KPYKCNECGKA   21 (46)
T ss_dssp             CTTCCTTTCCC
T ss_pred             cCcCCCCCCCc
Confidence            45789999975


No 236
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=39.32  E-value=12  Score=15.09  Aligned_cols=12  Identities=42%  Similarity=0.916  Sum_probs=9.2

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (46)
T 2eop_A           10 EKPHECRECGKS   21 (46)
T ss_dssp             CCSCBCTTTCCB
T ss_pred             CCCeeCCCCCch
Confidence            346789999975


No 237
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=39.27  E-value=9  Score=15.64  Aligned_cols=11  Identities=36%  Similarity=0.857  Sum_probs=8.9

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2ytm_A           11 KPYKCMECGKA   21 (46)
T ss_dssp             CSSSBTTTTBC
T ss_pred             CCcCCCCCCch
Confidence            45789999975


No 238
>4avr_A PA4485; unknown function, GRAM-negative bacteria, infectious disease structure-based inhibitor design; 1.08A {Pseudomonas aeruginosa PA01}
Probab=39.20  E-value=14  Score=19.65  Aligned_cols=10  Identities=20%  Similarity=-0.031  Sum_probs=9.1

Q ss_pred             ecCCCCCeEE
Q 035423           12 QCRECGYRIL   21 (35)
Q Consensus        12 rC~~CG~RIl   21 (35)
                      |||+|+.|||
T Consensus        60 RGP~~~griI   69 (95)
T 4avr_A           60 RGPFRRGRII   69 (95)
T ss_dssp             CCCCSTTEEE
T ss_pred             CCCCCCCCEE
Confidence            8999999987


No 239
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A
Probab=39.17  E-value=9.6  Score=18.82  Aligned_cols=9  Identities=33%  Similarity=0.936  Sum_probs=6.2

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      -.||+||..
T Consensus        19 ~~CP~CG~~   27 (60)
T 2apo_B           19 EICPKCGEK   27 (60)
T ss_dssp             SBCSSSCSB
T ss_pred             ccCcCCCCc
Confidence            358888854


No 240
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=39.10  E-value=11  Score=15.16  Aligned_cols=11  Identities=27%  Similarity=0.842  Sum_probs=9.0

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2epz_A           11 KPFDCIDCGKA   21 (46)
T ss_dssp             CSBCCTTTCCC
T ss_pred             CCeECCCCCce
Confidence            46889999975


No 241
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1
Probab=38.98  E-value=8.8  Score=18.40  Aligned_cols=11  Identities=27%  Similarity=0.733  Sum_probs=8.3

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      .-+||.|+..|
T Consensus         6 ~k~CP~C~~~I   16 (60)
T 1wd2_A            6 TKECPKCHVTI   16 (60)
T ss_dssp             CCCCTTTCCCC
T ss_pred             ceECcCCCCee
Confidence            35799998765


No 242
>3iz5_m 60S ribosomal protein L43 (L37AE); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} PDB: 3izr_m 1ysh_D 2zkr_z
Probab=38.46  E-value=3.1  Score=22.27  Aligned_cols=16  Identities=19%  Similarity=0.345  Sum_probs=10.2

Q ss_pred             ccCCCCceecCCCCCe
Q 035423            4 TLKPGDVIQCRECGYR   19 (35)
Q Consensus         4 ~lk~~~~irC~~CG~R   19 (35)
                      ++++...-.||.||.-
T Consensus        30 e~~q~~ky~CpfCgk~   45 (92)
T 3iz5_m           30 EVSQHSKYFCEFCGKF   45 (92)
T ss_dssp             HHHHHSCBCCTTTCSS
T ss_pred             HHHHhccccCcccCCC
Confidence            3444556678888865


No 243
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A
Probab=38.12  E-value=12  Score=15.10  Aligned_cols=12  Identities=33%  Similarity=0.891  Sum_probs=9.2

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2emk_A           10 EKPYECKECGKA   21 (46)
T ss_dssp             SCSCBCSSSCCB
T ss_pred             CCceECCCCCch
Confidence            345789999975


No 244
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=38.06  E-value=12  Score=15.11  Aligned_cols=12  Identities=33%  Similarity=0.761  Sum_probs=9.3

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (46)
T 2en6_A           10 EKPYGCNECGKT   21 (46)
T ss_dssp             SCCEEETTTTEE
T ss_pred             CcCeECCCCCcc
Confidence            346899999975


No 245
>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1
Probab=38.00  E-value=8.3  Score=23.82  Aligned_cols=10  Identities=30%  Similarity=0.767  Sum_probs=7.1

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      -++|++||..
T Consensus       222 R~~C~~Cg~~  231 (309)
T 2fiy_A          222 RIKCSHCEES  231 (309)
T ss_dssp             TTSCSSSCCC
T ss_pred             CcCCcCCCCC
Confidence            4678888863


No 246
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=37.97  E-value=15  Score=16.28  Aligned_cols=11  Identities=36%  Similarity=0.842  Sum_probs=7.3

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        41 ~~~~C~~C~~~   51 (72)
T 1x6e_A           41 KPYKCLECGKA   51 (72)
T ss_dssp             CCEECSSSCCE
T ss_pred             CCeECCCCCcc
Confidence            35677777764


No 247
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9
Probab=37.90  E-value=11  Score=21.91  Aligned_cols=14  Identities=36%  Similarity=0.745  Sum_probs=10.9

Q ss_pred             eecCCCCCeEEEee
Q 035423           11 IQCRECGYRILYKK   24 (35)
Q Consensus        11 irC~~CG~RIlyK~   24 (35)
                      --||.||.+++.-.
T Consensus       114 ~~Cp~Cg~g~fma~  127 (189)
T 2xzm_9          114 KGCPKCGPGIFMAK  127 (189)
T ss_dssp             EECSTTCSSCEEEE
T ss_pred             ccCCccCCCccccC
Confidence            46999999977654


No 248
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens}
Probab=37.82  E-value=11  Score=15.16  Aligned_cols=11  Identities=36%  Similarity=0.884  Sum_probs=8.8

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        11 k~~~C~~C~k~   21 (46)
T 2em0_A           11 KTWKCRECDMC   21 (46)
T ss_dssp             CCCCCSSSCCC
T ss_pred             cCeECCCCCcc
Confidence            45789999975


No 249
>2nn6_I 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2
Probab=37.70  E-value=13  Score=21.48  Aligned_cols=11  Identities=18%  Similarity=0.329  Sum_probs=9.4

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..++||+||..
T Consensus       184 ~~m~cp~cg~~  194 (209)
T 2nn6_I          184 CEMQCPKTHTK  194 (209)
T ss_dssp             TEEECTTTTCC
T ss_pred             CEEECCCCCCE
Confidence            57999999975


No 250
>3oei_C RELK (toxin RV3358); toxin-antitoxin systems, protein-protein complex, tuberculos structural genomics consortium, protein binding; HET: MLZ FLC; 2.15A {Mycobacterium tuberculosis} SCOP: d.298.1.0
Probab=37.67  E-value=38  Score=17.47  Aligned_cols=18  Identities=17%  Similarity=0.394  Sum_probs=13.6

Q ss_pred             CCeEEEeecCCceEEEEe
Q 035423           17 GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        17 G~RIlyK~R~~~~~~~~A   34 (35)
                      +|||+|..-...+.-+.+
T Consensus        75 ~yRivy~i~d~~i~Il~~   92 (96)
T 3oei_C           75 EHRLVYRAGDDEVTMLKA   92 (96)
T ss_dssp             SCEEEEEECSSEEEEEES
T ss_pred             CEEEEEEEECCEEEEEEe
Confidence            489999998877665554


No 251
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y
Probab=37.61  E-value=3.8  Score=22.40  Aligned_cols=16  Identities=19%  Similarity=0.380  Sum_probs=11.5

Q ss_pred             ccCCCCceecCCCCCe
Q 035423            4 TLKPGDVIQCRECGYR   19 (35)
Q Consensus         4 ~lk~~~~irC~~CG~R   19 (35)
                      +++....-.||.||.-
T Consensus        30 E~~q~aky~CpfCgk~   45 (103)
T 4a17_Y           30 EITQHAKYGCPFCGKV   45 (103)
T ss_dssp             HHHHHSCEECTTTCCE
T ss_pred             HHHhhcCCCCCCCCCc
Confidence            4455667789999865


No 252
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50}
Probab=37.41  E-value=28  Score=17.25  Aligned_cols=17  Identities=24%  Similarity=0.565  Sum_probs=11.1

Q ss_pred             CCCceecCCCCCeEEEe
Q 035423            7 PGDVIQCRECGYRILYK   23 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK   23 (35)
                      ..+.+.||.|+...-|-
T Consensus         5 LL~iL~CP~ck~~L~~~   21 (70)
T 2js4_A            5 LLDILVCPVCKGRLEFQ   21 (70)
T ss_dssp             CCCCCBCTTTCCBEEEE
T ss_pred             HhhheECCCCCCcCEEe
Confidence            45566777777776554


No 253
>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus}
Probab=37.33  E-value=20  Score=17.50  Aligned_cols=14  Identities=14%  Similarity=0.667  Sum_probs=10.2

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      ...+.+|..||+..
T Consensus        46 ~~qG~kC~~C~~~c   59 (72)
T 2fnf_X           46 LRQALRCANCKFTC   59 (72)
T ss_dssp             SSCCEECTTSSCEE
T ss_pred             HhCcCccCCCCCee
Confidence            45678888888763


No 254
>3u5c_a 40S ribosomal protein S26-A, 40S ribosomal protein S25-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_a
Probab=37.23  E-value=17  Score=20.24  Aligned_cols=13  Identities=23%  Similarity=0.616  Sum_probs=10.3

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      ..+|+|.+||.-+
T Consensus        18 v~~V~C~nCgr~v   30 (119)
T 3u5c_a           18 VKPVRCVNCSKSI   30 (119)
T ss_dssp             CCEEECTTTCCEE
T ss_pred             CccEeeccccccc
Confidence            4579999999753


No 255
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae}
Probab=37.17  E-value=20  Score=21.55  Aligned_cols=14  Identities=36%  Similarity=0.755  Sum_probs=10.3

Q ss_pred             CceecCCCCC---eEEE
Q 035423            9 DVIQCRECGY---RILY   22 (35)
Q Consensus         9 ~~irC~~CG~---RIly   22 (35)
                      ....||+||.   .|++
T Consensus        20 ~~~~CPECGs~~t~IV~   36 (197)
T 3k1f_M           20 IVLTCPECKVYPPKIVE   36 (197)
T ss_dssp             CCCCCTTTCCSSCCEEE
T ss_pred             cCeECcCCCCcCCeEEE
Confidence            3458999998   5665


No 256
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=37.14  E-value=12  Score=15.04  Aligned_cols=12  Identities=42%  Similarity=1.016  Sum_probs=9.3

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (46)
T 2en1_A           10 EKPFKCEECGKR   21 (46)
T ss_dssp             CCSEEETTTTEE
T ss_pred             CCCeeCCCCCcc
Confidence            346899999975


No 257
>2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor}
Probab=37.08  E-value=32  Score=16.25  Aligned_cols=19  Identities=11%  Similarity=0.300  Sum_probs=12.2

Q ss_pred             cCCCCceecCCCCCeEEEe
Q 035423            5 LKPGDVIQCRECGYRILYK   23 (35)
Q Consensus         5 lk~~~~irC~~CG~RIlyK   23 (35)
                      .+..+-..||.|....-|.
T Consensus         5 ~~lL~iL~CP~c~~~L~~~   23 (56)
T 2kpi_A            5 AGLLEILACPACHAPLEER   23 (56)
T ss_dssp             CSCTTSCCCSSSCSCEEEE
T ss_pred             HHHHhheeCCCCCCcceec
Confidence            3445667788887776554


No 258
>1nkw_1 50S ribosomal protein L33; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans} SCOP: i.1.1.2 PDB: 1sm1_1* 1yl3_6 2b66_6 2b9n_6 2b9p_6
Probab=37.03  E-value=19  Score=18.84  Aligned_cols=13  Identities=0%  Similarity=0.107  Sum_probs=10.8

Q ss_pred             ecCCCCCeEEEee
Q 035423           12 QCRECGYRILYKK   24 (35)
Q Consensus        12 rC~~CG~RIlyK~   24 (35)
                      -||.|....|+|+
T Consensus        67 YcP~crKHtlHkE   79 (82)
T 1nkw_1           67 YDPVAKKHVVFRE   79 (82)
T ss_pred             cCCCCCCeeeEEe
Confidence            3888988888887


No 259
>3u6p_A Formamidopyrimidine-DNA glycosylase; DNA glycosylase, DNA repair, sequence context; HET: DNA 08Q; 1.60A {Geobacillus stearothermophilus} PDB: 3u6d_A* 3u6c_A* 3u6l_A* 3u6m_A* 3u6o_A* 3u6e_A* 3u6q_A* 3u6s_A* 3gp1_A* 3sbj_A* 2f5q_A* 2f5s_A* 3gq4_A* 3gpy_A* 2f5n_A 2f5o_A 2f5p_A 3sau_A* 3sar_A* 3sav_A* ...
Probab=36.85  E-value=28  Score=20.76  Aligned_cols=22  Identities=23%  Similarity=0.306  Sum_probs=14.6

Q ss_pred             ceecCCCCCeEEEeecCCceEE
Q 035423           10 VIQCRECGYRILYKKRTRRIVQ   31 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R~~~~~~   31 (35)
                      .--|+.||..|.-..-..+...
T Consensus       245 g~pC~~CG~~I~~~~~~gR~t~  266 (273)
T 3u6p_A          245 GNPCKRCGTPIEKTVVAGRGTH  266 (273)
T ss_dssp             TSBCTTTCCBCEEEEETTEEEE
T ss_pred             cCCCCCCCCeEEEEEECCCCeE
Confidence            3579999999876554444433


No 260
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1
Probab=36.70  E-value=14  Score=16.64  Aligned_cols=12  Identities=33%  Similarity=0.360  Sum_probs=9.3

Q ss_pred             CCCceecCCCCC
Q 035423            7 PGDVIQCRECGY   18 (35)
Q Consensus         7 ~~~~irC~~CG~   18 (35)
                      ..+.+.|-+||-
T Consensus         7 ~~~~~~C~~Cgk   18 (40)
T 1a6b_B            7 QLDRDQCAYCKE   18 (40)
T ss_dssp             SCCSSSCSSSCC
T ss_pred             CCCCCeeeECCC
Confidence            456789999984


No 261
>3izc_m 60S ribosomal protein RPL43 (L37AE); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins; NMR {Saccharomyces cerevisiae} PDB: 3izs_m 3o58_g 3o5h_g 3u5e_p 3u5i_p 4b6a_p 1s1i_9
Probab=36.51  E-value=3.3  Score=22.21  Aligned_cols=16  Identities=19%  Similarity=0.555  Sum_probs=9.9

Q ss_pred             ccCCCCceecCCCCCe
Q 035423            4 TLKPGDVIQCRECGYR   19 (35)
Q Consensus         4 ~lk~~~~irC~~CG~R   19 (35)
                      ++++...-.||.||.-
T Consensus        30 e~~q~~ky~CpfCgk~   45 (92)
T 3izc_m           30 EIQQHARYDCSFCGKK   45 (92)
T ss_dssp             HHHHHSCCCCSSSCSS
T ss_pred             HHHHhcCCcCCCCCCc
Confidence            3444556678888854


No 262
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis}
Probab=36.30  E-value=23  Score=17.46  Aligned_cols=17  Identities=24%  Similarity=0.337  Sum_probs=10.6

Q ss_pred             CCCceecCCCCCeEEEe
Q 035423            7 PGDVIQCRECGYRILYK   23 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK   23 (35)
                      ..+.+.||.|+..+-|-
T Consensus         5 LL~iL~CP~ck~~L~~~   21 (68)
T 2jr6_A            5 FLDILVCPVTKGRLEYH   21 (68)
T ss_dssp             SSCCCBCSSSCCBCEEE
T ss_pred             HhhheECCCCCCcCeEe
Confidence            34566777777665553


No 263
>3izc_Z 60S ribosomal protein RPL24 (L24E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins; NMR {Saccharomyces cerevisiae} PDB: 3izs_Z 3o58_V 3o5h_V 3u5e_W 3u5i_W 4b6a_W 1s1i_S 2x7n_D
Probab=36.22  E-value=14  Score=21.36  Aligned_cols=10  Identities=20%  Similarity=-0.021  Sum_probs=8.1

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      -.|-+||+.|
T Consensus         4 ~~CsFcg~~I   13 (155)
T 3izc_Z            4 EIDSFSGAKI   13 (155)
T ss_dssp             EECTTTCSEE
T ss_pred             eEecCcCCcc
Confidence            4699998886


No 264
>1vq8_U 50S ribosomal protein L24E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.39.1.6 PDB: 1giy_R 1jj2_T 1k73_V* 1k8a_V* 1k9m_V* 1kc8_V* 1kd1_V* 1kqs_T* 1m1k_V* 1m90_V* 1ml5_r* 1n8r_V* 1nji_V* 1q7y_V* 1q81_V* 1q82_V* 1q86_V* 1qvf_T 1qvg_T 1s72_U* ...
Probab=35.99  E-value=11  Score=18.90  Aligned_cols=10  Identities=40%  Similarity=0.923  Sum_probs=7.8

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      -.|-.||+.|
T Consensus         4 ~~C~Fcg~~I   13 (66)
T 1vq8_U            4 RECDYCGTDI   13 (66)
T ss_dssp             CBCTTTCCBC
T ss_pred             eEecCcCCcc
Confidence            4689998875


No 265
>1i7d_A DNA topoisomerase III; decatenating enzyme, protein-DNA complex, single-stranded DNA, isomerase/DNA complex; HET: DNA; 2.05A {Escherichia coli} SCOP: e.10.1.1 PDB: 2o5c_A* 2o54_A* 2o59_A* 2o19_A* 2o5e_A* 1d6m_A*
Probab=35.92  E-value=8.5  Score=25.87  Aligned_cols=17  Identities=24%  Similarity=0.003  Sum_probs=3.8

Q ss_pred             ceecCCCCCeEEEeecC
Q 035423           10 VIQCRECGYRILYKKRT   26 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R~   26 (35)
                      ...||.||..++.++-.
T Consensus       616 ~~~CP~Cg~~l~~~~~~  632 (659)
T 1i7d_A          616 GIVAPGSGGSADKKKAA  632 (659)
T ss_dssp             TCCCC------------
T ss_pred             CCCCCCCCCeeEEecCc
Confidence            45799999998765433


No 266
>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A*
Probab=35.89  E-value=21  Score=15.57  Aligned_cols=12  Identities=25%  Similarity=0.933  Sum_probs=9.1

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+.+|..|++.
T Consensus        26 ~qg~~C~~C~~~   37 (50)
T 1ptq_A           26 KQGLKCEDCGMN   37 (50)
T ss_dssp             SCEEEETTTCCE
T ss_pred             CccCEeCCCCCe
Confidence            367888888875


No 267
>3irb_A Uncharacterized protein from DUF35 family; 13815350, protein with unknown function from DUF35 family, S genomics; 1.80A {Sulfolobus solfataricus}
Probab=35.85  E-value=13  Score=20.33  Aligned_cols=13  Identities=23%  Similarity=0.577  Sum_probs=9.3

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      .-||+.||.-.++
T Consensus        47 ~~rC~~CG~~~~P   59 (145)
T 3irb_A           47 GSKCSKCGRIFVP   59 (145)
T ss_dssp             EEECTTTCCEEES
T ss_pred             EEEeCCCCcEEcC
Confidence            4688888876554


No 268
>4a17_T RPL24, 60S ribosomal protein L21; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_T 4a1c_T 4a1e_T
Probab=35.77  E-value=14  Score=21.42  Aligned_cols=10  Identities=50%  Similarity=1.002  Sum_probs=8.2

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      -.|-+||+.|
T Consensus         6 ~~CsFcg~~I   15 (158)
T 4a17_T            6 GTCSFCEYRI   15 (158)
T ss_dssp             EECTTTCCEE
T ss_pred             EEecCcCCcc
Confidence            4699998886


No 269
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=35.64  E-value=11  Score=15.14  Aligned_cols=12  Identities=33%  Similarity=0.780  Sum_probs=9.2

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~~~~~C~~C~k~   21 (46)
T 2eoe_A           10 EKPYKCNECGKV   21 (46)
T ss_dssp             CCSSEETTTTEE
T ss_pred             CCCeECCCcChh
Confidence            346889999975


No 270
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=35.33  E-value=26  Score=14.25  Aligned_cols=13  Identities=23%  Similarity=0.611  Sum_probs=8.4

Q ss_pred             CCCceecCCCCCe
Q 035423            7 PGDVIQCRECGYR   19 (35)
Q Consensus         7 ~~~~irC~~CG~R   19 (35)
                      ...+..|+.||..
T Consensus         9 ~~k~~~C~~C~k~   21 (48)
T 2epr_A            9 TRKQVACEICGKI   21 (48)
T ss_dssp             CCCSEEETTTTEE
T ss_pred             CCcCeeCCCCCcc
Confidence            3445778888764


No 271
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=35.22  E-value=18  Score=16.19  Aligned_cols=11  Identities=36%  Similarity=0.712  Sum_probs=8.2

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        37 ~~~~C~~C~k~   47 (78)
T 2d9h_A           37 LRFPCEFCGKR   47 (78)
T ss_dssp             CCEECTTTCCE
T ss_pred             cccCCCCCCch
Confidence            45788888865


No 272
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=35.13  E-value=17  Score=16.24  Aligned_cols=11  Identities=18%  Similarity=0.573  Sum_probs=8.0

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        44 ~~~~C~~C~~~   54 (77)
T 2ct1_A           44 AKFHCPHCDTV   54 (77)
T ss_dssp             SSEECSSSSCE
T ss_pred             CccCCCCCCCc
Confidence            35788888865


No 273
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group}
Probab=35.11  E-value=21  Score=16.99  Aligned_cols=17  Identities=18%  Similarity=0.694  Sum_probs=11.5

Q ss_pred             ccccCCCCceecCCCCCe
Q 035423            2 ENTLKPGDVIQCRECGYR   19 (35)
Q Consensus         2 ~~~lk~~~~irC~~CG~R   19 (35)
                      +....+...|+| .||..
T Consensus         2 ~d~~~~e~~v~C-~C~~~   18 (68)
T 2rsd_A            2 SDSFQPEAKVRC-ICSST   18 (68)
T ss_dssp             CSCCCSSCEECC-TTCCC
T ss_pred             CCCcCCCCCEEe-ECCCC
Confidence            445667778888 58753


No 274
>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus}
Probab=34.74  E-value=24  Score=16.45  Aligned_cols=13  Identities=15%  Similarity=0.746  Sum_probs=8.7

Q ss_pred             CCCceecCCCCCe
Q 035423            7 PGDVIQCRECGYR   19 (35)
Q Consensus         7 ~~~~irC~~CG~R   19 (35)
                      ...+.+|..||+.
T Consensus        33 ~kqg~kC~~C~~~   45 (59)
T 1rfh_A           33 LRQALRCANCKFT   45 (59)
T ss_dssp             CSCCEECTTTSCE
T ss_pred             hhCccEeCCCCCe
Confidence            3456778877765


No 275
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=34.48  E-value=12  Score=15.15  Aligned_cols=12  Identities=42%  Similarity=0.850  Sum_probs=9.2

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (46)
T 2ytt_A           10 EKPYQCSECGKS   21 (46)
T ss_dssp             CCTTCCSSSCCC
T ss_pred             CCCeeCCCCCcc
Confidence            345789999975


No 276
>4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M
Probab=34.25  E-value=17  Score=22.29  Aligned_cols=14  Identities=36%  Similarity=0.909  Sum_probs=9.5

Q ss_pred             ceecCCCCC---eEEEe
Q 035423           10 VIQCRECGY---RILYK   23 (35)
Q Consensus        10 ~irC~~CG~---RIlyK   23 (35)
                      ...||+||.   .|++-
T Consensus        21 ~~~Cp~C~~~~~~lv~D   37 (345)
T 4bbr_M           21 VLTCPECKVYPPKIVER   37 (345)
T ss_dssp             -CCCSSCCCSSCCEEEE
T ss_pred             CCcCCCCCCCCCceeEE
Confidence            458999995   55553


No 277
>3j21_d 50S ribosomal protein L34E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus}
Probab=34.23  E-value=17  Score=19.11  Aligned_cols=15  Identities=27%  Similarity=0.713  Sum_probs=10.7

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      +....-+|..||.++
T Consensus        29 K~~~~pkC~~cg~~L   43 (89)
T 3j21_d           29 KKPKIAHCAMCGRPL   43 (89)
T ss_dssp             CCCCCCBCSSSCCBC
T ss_pred             ccCCCCCCCCCCCcc
Confidence            345556899999763


No 278
>2xzf_A Formamidopyrimidine-DNA glycosylase; hydrolase-DNA complex; HET: VET; 1.80A {Lactococcus lactis subsp} PDB: 1pm5_A* 1xc8_A* 1pji_A* 2xzu_A* 3c58_A* 1tdz_A* 1nnj_A 1kfv_A 1pjj_A*
Probab=34.15  E-value=33  Score=20.34  Aligned_cols=22  Identities=27%  Similarity=0.490  Sum_probs=14.3

Q ss_pred             eecCCCCCeEEEeecCCceEEE
Q 035423           11 IQCRECGYRILYKKRTRRIVQY   32 (35)
Q Consensus        11 irC~~CG~RIlyK~R~~~~~~~   32 (35)
                      --|+.||..|.-.+=..+...|
T Consensus       243 ~pC~~CG~~I~~~~~~gR~t~~  264 (271)
T 2xzf_A          243 EKCSRCGAEIQKIKVAGRGTHF  264 (271)
T ss_dssp             SBCTTTCCBCEEEEETTEEEEE
T ss_pred             CCCCCCCCEeeEEEECCCceEE
Confidence            4599999998755444444433


No 279
>3eqt_A ATP-dependent RNA helicase DHX58; innate immunity, RIG-I-like helicases, viral RNA detection, LGP2/dsRNA complex, ATP-binding, coiled coil; 2.00A {Homo sapiens} PDB: 2w4r_A 2rqa_A
Probab=34.14  E-value=7.4  Score=22.14  Aligned_cols=14  Identities=64%  Similarity=1.322  Sum_probs=11.6

Q ss_pred             CCCCceecCCCCCe
Q 035423            6 KPGDVIQCRECGYR   19 (35)
Q Consensus         6 k~~~~irC~~CG~R   19 (35)
                      .++..|.|.+||..
T Consensus        65 ~~~g~I~C~~Cgq~   78 (145)
T 3eqt_A           65 KPGGVISCRNCGEV   78 (145)
T ss_dssp             EEEEEEEETTTCCE
T ss_pred             cCCcEEEchhhChh
Confidence            45678999999986


No 280
>3lpe_B DNA-directed RNA polymerase subunit E''; transcription regulation, SPT4, SPT5, NUSG, archaea, evoluti directed RNA polymerase; 1.90A {Methanocaldococcus jannaschii} SCOP: g.41.9.0
Probab=34.04  E-value=13  Score=18.12  Aligned_cols=7  Identities=29%  Similarity=0.676  Sum_probs=6.3

Q ss_pred             ecCCCCC
Q 035423           12 QCRECGY   18 (35)
Q Consensus        12 rC~~CG~   18 (35)
                      .||+||.
T Consensus        15 ~CpnC~~   21 (59)
T 3lpe_B           15 ICPICHS   21 (59)
T ss_dssp             BCTTTCC
T ss_pred             CCCCCCC
Confidence            6999997


No 281
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=34.01  E-value=27  Score=15.28  Aligned_cols=10  Identities=40%  Similarity=1.046  Sum_probs=5.5

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus         9 ~~~C~~C~k~   18 (70)
T 1x5w_A            9 PEKCSECSYS   18 (70)
T ss_dssp             SEECSSSSCE
T ss_pred             CeECCCCCcc
Confidence            4556666543


No 282
>1ee8_A MUTM (FPG) protein; beta sandwich, zinc finger, helix two-turns helix, riken STR genomics/proteomics initiative, RSGI, structural genomics; 1.90A {Thermus thermophilus} SCOP: a.156.1.2 b.113.1.1 g.39.1.8
Probab=33.98  E-value=35  Score=20.29  Aligned_cols=22  Identities=18%  Similarity=0.489  Sum_probs=14.5

Q ss_pred             eecCCCCCeEEEeecCCceEEE
Q 035423           11 IQCRECGYRILYKKRTRRIVQY   32 (35)
Q Consensus        11 irC~~CG~RIlyK~R~~~~~~~   32 (35)
                      --|+.||..|.-.+=..+...|
T Consensus       236 ~pC~~CG~~I~~~~~~gR~t~~  257 (266)
T 1ee8_A          236 LPCPACGRPVERRVVAGRGTHF  257 (266)
T ss_dssp             SBCTTTCCBCEEEESSSCEEEE
T ss_pred             CCCCCCCCEeeEEEECCCceEE
Confidence            4599999998755544444433


No 283
>1nui_A DNA primase/helicase; zinc-biding domain, toprim fold, DNA replication, DNA-direct polymerase, primosome, late protein, ATP-binding; HET: DNA; 2.90A {Enterobacteria phage T7} SCOP: e.13.1.2 g.41.3.2
Probab=33.88  E-value=13  Score=21.22  Aligned_cols=9  Identities=44%  Similarity=1.113  Sum_probs=7.5

Q ss_pred             ceecCCCCC
Q 035423           10 VIQCRECGY   18 (35)
Q Consensus        10 ~irC~~CG~   18 (35)
                      ...||.||.
T Consensus        14 ~~~CP~Cg~   22 (255)
T 1nui_A           14 HIPCDNCGS   22 (255)
T ss_dssp             EECCSSSCC
T ss_pred             CCcCCCCCC
Confidence            568999987


No 284
>1k3x_A Endonuclease VIII; hydrolase/DNA, hydrolase-DNA complex; HET: BRU PED; 1.25A {Escherichia coli} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 PDB: 1k3w_A* 1q39_A 2ea0_A* 2oq4_A* 1q3c_A 2opf_A* 1q3b_A*
Probab=33.86  E-value=34  Score=20.20  Aligned_cols=22  Identities=23%  Similarity=0.398  Sum_probs=14.2

Q ss_pred             eecCCCCCeEEEeecCCceEEE
Q 035423           11 IQCRECGYRILYKKRTRRIVQY   32 (35)
Q Consensus        11 irC~~CG~RIlyK~R~~~~~~~   32 (35)
                      --|+.||..|.-..=..+...|
T Consensus       235 ~pC~~CG~~I~~~~~~gR~t~~  256 (262)
T 1k3x_A          235 EPCERCGSIIEKTTLSSRPFYW  256 (262)
T ss_dssp             SBCTTTCCBCEEEEETTEEEEE
T ss_pred             CCCCCCCCEeEEEEECCCCeEE
Confidence            3599999998755444444333


No 285
>1k82_A Formamidopyrimidine-DNA glycosylase; protein-DNA complex, DNA repair, beta sandwich, zinc finger, helix two-turns helix, hydrolase/DNA complex; HET: PED; 2.10A {Escherichia coli} SCOP: a.156.1.2 b.113.1.1 g.39.1.8
Probab=33.82  E-value=34  Score=20.31  Aligned_cols=22  Identities=36%  Similarity=0.688  Sum_probs=14.2

Q ss_pred             eecCCCCCeEEEeecCCceEEE
Q 035423           11 IQCRECGYRILYKKRTRRIVQY   32 (35)
Q Consensus        11 irC~~CG~RIlyK~R~~~~~~~   32 (35)
                      --|+.||..|.--+=..+...|
T Consensus       241 ~pC~~CG~~I~~~~~~gR~t~~  262 (268)
T 1k82_A          241 EPCRVCGTPIVATKHAQRATFY  262 (268)
T ss_dssp             SBCTTTCCBCEEEEETTEEEEE
T ss_pred             CCCCCCCCEeeEEEECCCceEE
Confidence            4599999998755444444433


No 286
>3iz5_i 60S ribosomal protein L34 (L34E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} PDB: 3izr_i
Probab=33.60  E-value=14  Score=20.54  Aligned_cols=15  Identities=27%  Similarity=0.408  Sum_probs=10.7

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      +....-+|..||.++
T Consensus        37 K~~~~pkC~~cg~~L   51 (119)
T 3iz5_i           37 KRASGPKCPVTGKKI   51 (119)
T ss_dssp             CCSSCCCSTTSSCCS
T ss_pred             cCCCCCCCCCCCCcc
Confidence            345566799999763


No 287
>4esj_A Type-2 restriction enzyme DPNI; restriction endonuclease-DNA complex, type IIM, type IIE, RE enzyme, DPNI; HET: DNA 6MA; 2.05A {Streptococcus pneumoniae}
Probab=33.57  E-value=8.8  Score=23.93  Aligned_cols=14  Identities=29%  Similarity=0.574  Sum_probs=10.0

Q ss_pred             ceecCCCCCeEEEe
Q 035423           10 VIQCRECGYRILYK   23 (35)
Q Consensus        10 ~irC~~CG~RIlyK   23 (35)
                      .+-||.||..-|=+
T Consensus        34 n~yCPnCG~~~l~~   47 (257)
T 4esj_A           34 QSYCPNCGNNPLNH   47 (257)
T ss_dssp             HCCCTTTCCSSCEE
T ss_pred             CCcCCCCCChhhhh
Confidence            35699999975543


No 288
>3u5e_g 60S ribosomal protein L34-A, 60S ribosomal protein L33-A; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_g 4b6a_g 3izc_i 3izs_i
Probab=33.29  E-value=18  Score=20.13  Aligned_cols=15  Identities=27%  Similarity=0.665  Sum_probs=10.9

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      +....-+|..||.++
T Consensus        37 K~~~~pkCg~Cg~~L   51 (121)
T 3u5e_g           37 KLATRPKCGDCGSAL   51 (121)
T ss_dssp             CCCCCCBCTTTCCBC
T ss_pred             cCCCCCCCCCCCCcc
Confidence            445566799999864


No 289
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=33.08  E-value=15  Score=18.63  Aligned_cols=12  Identities=33%  Similarity=0.924  Sum_probs=10.1

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      ....|++|+..|
T Consensus        27 ~~A~Ck~C~k~l   38 (76)
T 2djr_A           27 QYATCRLCGRQV   38 (76)
T ss_dssp             SCEEESSSCCBC
T ss_pred             CEEECCCCCCcc
Confidence            468999999876


No 290
>2gvi_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.87A {Thermoplasma acidophilum} SCOP: d.81.3.1 g.39.1.18
Probab=33.07  E-value=30  Score=19.81  Aligned_cols=15  Identities=27%  Similarity=0.680  Sum_probs=11.8

Q ss_pred             CCCceecCCCCCeEE
Q 035423            7 PGDVIQCRECGYRIL   21 (35)
Q Consensus         7 ~~~~irC~~CG~RIl   21 (35)
                      ....+.|..||--++
T Consensus       169 ~~~~~~C~~CGE~~~  183 (204)
T 2gvi_A          169 NGAKVRCDVCGEYTY  183 (204)
T ss_dssp             CCCEEECTTTCCEEE
T ss_pred             CCCceECCCCCCchh
Confidence            356799999998754


No 291
>1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A
Probab=33.02  E-value=15  Score=17.08  Aligned_cols=11  Identities=18%  Similarity=0.848  Sum_probs=8.6

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      +.+|.+|+++-
T Consensus        27 G~kC~~Ck~~c   37 (49)
T 1kbe_A           27 GVKCKHCRLKC   37 (49)
T ss_dssp             EEEETTTTEEE
T ss_pred             cCCCCCCCCcc
Confidence            48899998863


No 292
>3iz5_Z 60S ribosomal protein L24 (L24E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} PDB: 3izr_Z
Probab=32.93  E-value=17  Score=21.19  Aligned_cols=11  Identities=36%  Similarity=0.597  Sum_probs=8.6

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      .-.|-+||+.|
T Consensus         5 ~e~CsFcG~~I   15 (162)
T 3iz5_Z            5 TELCRFSGQKI   15 (162)
T ss_dssp             CEECTTTCSEE
T ss_pred             EEEecCcCCcc
Confidence            35699999886


No 293
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=32.65  E-value=22  Score=15.04  Aligned_cols=12  Identities=33%  Similarity=0.858  Sum_probs=9.0

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        10 ~k~~~C~~C~k~   21 (54)
T 2eps_A           10 GKPYICQSCGKG   21 (54)
T ss_dssp             SCCEECSSSCCE
T ss_pred             CCCeECCCCCcc
Confidence            346789999875


No 294
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A
Probab=31.56  E-value=19  Score=12.47  Aligned_cols=10  Identities=40%  Similarity=1.009  Sum_probs=7.8

Q ss_pred             ceecC--CCCCe
Q 035423           10 VIQCR--ECGYR   19 (35)
Q Consensus        10 ~irC~--~CG~R   19 (35)
                      +..|+  .||..
T Consensus         2 ~~~C~~~~C~k~   13 (29)
T 2ab3_A            2 VYVCHFENCGRS   13 (29)
T ss_dssp             CEEECSTTTCEE
T ss_pred             CCCCcCCcCcCc
Confidence            46799  99975


No 295
>2gnr_A Conserved hypothetical protein; 13815350, structural genomics, PSI, protein structure initiative; 1.80A {Sulfolobus solfataricus P2} PDB: 3irb_A
Probab=31.51  E-value=17  Score=20.04  Aligned_cols=13  Identities=23%  Similarity=0.560  Sum_probs=9.5

Q ss_pred             CceecCCCCCeEE
Q 035423            9 DVIQCRECGYRIL   21 (35)
Q Consensus         9 ~~irC~~CG~RIl   21 (35)
                      -.-+|+.||+-.+
T Consensus        46 ~~~rC~~CG~~~f   58 (145)
T 2gnr_A           46 IGSKCSKCGRIFV   58 (145)
T ss_dssp             EEEECTTTCCEEE
T ss_pred             EEEEECCCCcEEe
Confidence            3568999998644


No 296
>2odd_A Protein CBFA2T1; MYND zinc finger, cross-braced topology, poly-proline, proline-tryptophan interaction, metal binding protein; NMR {Homo sapiens}
Probab=31.04  E-value=14  Score=17.33  Aligned_cols=8  Identities=38%  Similarity=1.248  Sum_probs=5.7

Q ss_pred             ecCCCCCe
Q 035423           12 QCRECGYR   19 (35)
Q Consensus        12 rC~~CG~R   19 (35)
                      .|..||..
T Consensus        19 ~C~~C~~~   26 (64)
T 2odd_A           19 SCWNCGRK   26 (64)
T ss_dssp             SCTTTSSC
T ss_pred             cCccccCC
Confidence            67778763


No 297
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}
Probab=31.00  E-value=23  Score=15.68  Aligned_cols=10  Identities=30%  Similarity=0.850  Sum_probs=6.5

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus        45 ~~~C~~C~k~   54 (74)
T 2lce_A           45 PYRCNICGAQ   54 (74)
T ss_dssp             SEECTTTCCE
T ss_pred             CEECCCCCch
Confidence            4667777754


No 298
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus}
Probab=30.99  E-value=23  Score=16.24  Aligned_cols=10  Identities=30%  Similarity=0.677  Sum_probs=6.1

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +-.|..||..
T Consensus         4 py~C~~C~k~   13 (60)
T 4gzn_C            4 PFFCNFCGKT   13 (60)
T ss_dssp             CEECTTTCCE
T ss_pred             CccCCCCCCE
Confidence            4567777654


No 299
>2kwq_A Protein MCM10 homolog; DNA replication, DNA binding, zinc motif, zinc ribbon binding protein; NMR {Xenopus laevis}
Probab=30.96  E-value=21  Score=18.81  Aligned_cols=16  Identities=25%  Similarity=0.490  Sum_probs=13.0

Q ss_pred             ccCCCCceecCCCCCe
Q 035423            4 TLKPGDVIQCRECGYR   19 (35)
Q Consensus         4 ~lk~~~~irC~~CG~R   19 (35)
                      ++...+...|+.||.-
T Consensus        59 sl~r~P~~~C~~Cg~~   74 (92)
T 2kwq_A           59 SLDRLPKKHCSTCGLF   74 (92)
T ss_dssp             ESSSSCCSCCTTTCSC
T ss_pred             EeeeCCCCCCCCCCCC
Confidence            4567788899999976


No 300
>4ayb_N DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2wb1_N 2y0s_N 2waq_N 4b1o_N 4b1p_O 2pmz_N 3hkz_N
Probab=30.96  E-value=16  Score=18.46  Aligned_cols=11  Identities=45%  Similarity=0.905  Sum_probs=9.1

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      ||||=.||.=|
T Consensus         4 PVRCFTCGkvi   14 (66)
T 4ayb_N            4 PIRCFTCGSLI   14 (66)
T ss_dssp             CSBCTTTCCBC
T ss_pred             CcccCCCcHhH
Confidence            79999999743


No 301
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=30.77  E-value=24  Score=16.73  Aligned_cols=14  Identities=21%  Similarity=0.719  Sum_probs=10.5

Q ss_pred             CCCCceecCCCCCe
Q 035423            6 KPGDVIQCRECGYR   19 (35)
Q Consensus         6 k~~~~irC~~CG~R   19 (35)
                      ....+..|..||..
T Consensus         9 ~~ekpy~C~~CgK~   22 (66)
T 2epp_A            9 REAGILPCGLCGKV   22 (66)
T ss_dssp             CCCCCCCCTTTCCC
T ss_pred             CCccCcCCCCCCCc
Confidence            34456889999976


No 302
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae}
Probab=30.75  E-value=20  Score=21.79  Aligned_cols=10  Identities=40%  Similarity=0.863  Sum_probs=7.8

Q ss_pred             CceecCCCCC
Q 035423            9 DVIQCRECGY   18 (35)
Q Consensus         9 ~~irC~~CG~   18 (35)
                      ....||+||.
T Consensus        20 ~~~~Cp~Cg~   29 (345)
T 3k7a_M           20 IVLTCPECKV   29 (345)
T ss_dssp             CCCCCSTTCC
T ss_pred             CCCcCcCCCC
Confidence            3567999987


No 303
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus}
Probab=30.67  E-value=23  Score=15.60  Aligned_cols=11  Identities=27%  Similarity=0.742  Sum_probs=7.1

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        56 ~~~~C~~C~~~   66 (82)
T 2kmk_A           56 KPHKCQVCGKA   66 (82)
T ss_dssp             CCEECTTTSCE
T ss_pred             CCCcCCCcchh
Confidence            34677777754


No 304
>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens}
Probab=30.65  E-value=29  Score=16.22  Aligned_cols=12  Identities=25%  Similarity=0.841  Sum_probs=9.0

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+.+|..|++.
T Consensus        38 ~qg~~C~~C~~~   49 (65)
T 2enz_A           38 RQGLKCDACGMN   49 (65)
T ss_dssp             SCSEEESSSCCE
T ss_pred             CcccccCCCCCc
Confidence            356888888875


No 305
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=30.60  E-value=24  Score=15.75  Aligned_cols=11  Identities=27%  Similarity=0.836  Sum_probs=8.3

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        46 ~~~~C~~C~~~   56 (86)
T 1x6h_A           46 AAFVCSKCGKT   56 (86)
T ss_dssp             CCEECSSSCCE
T ss_pred             cceECCCCCCh
Confidence            35788888875


No 306
>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A
Probab=30.34  E-value=21  Score=15.76  Aligned_cols=11  Identities=36%  Similarity=1.298  Sum_probs=7.7

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+.+|..|++.
T Consensus        26 qG~~C~~C~~~   36 (52)
T 1faq_A           26 NGFRCQTCGYK   36 (52)
T ss_dssp             SEEECTTTTCC
T ss_pred             cCCEeCCCCCe
Confidence            46778877764


No 307
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}
Probab=30.26  E-value=22  Score=16.33  Aligned_cols=13  Identities=15%  Similarity=0.289  Sum_probs=9.8

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      .....||.|...+
T Consensus        57 ~~~~~CP~Cr~~~   69 (85)
T 2ecw_A           57 DGKGNCPVCRVPY   69 (85)
T ss_dssp             TSCBCCTTTCCCC
T ss_pred             CCCCCCCCCCCcC
Confidence            3468899998775


No 308
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens}
Probab=30.13  E-value=23  Score=18.60  Aligned_cols=12  Identities=50%  Similarity=0.891  Sum_probs=10.0

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      .|.|.|-+||..
T Consensus        19 ~d~iiClecGK~   30 (87)
T 2jsp_A           19 DDHIVCLECGGS   30 (87)
T ss_dssp             SSCEECTBTCCE
T ss_pred             CCceEecccchh
Confidence            467899999985


No 309
>2xzm_5 Ribosomal protein S26E containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_5
Probab=30.06  E-value=27  Score=19.48  Aligned_cols=13  Identities=23%  Similarity=0.887  Sum_probs=10.4

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      ...|+|.+||--+
T Consensus        18 v~~V~C~nCgr~v   30 (119)
T 2xzm_5           18 TRTVPCTNCGRQV   30 (119)
T ss_dssp             CCEEECTTTCCEE
T ss_pred             CccEeeCCccccC
Confidence            4579999999764


No 310
>3hxi_C Eukaryotic translation initiation factor 4E- binding protein 1; protein-mRNA CAP complex, acetylation, phosphoprotein, protein synthesis inhibitor; HET: GTG; 1.80A {Homo sapiens} PDB: 3hxg_C*
Probab=29.98  E-value=22  Score=14.48  Aligned_cols=7  Identities=43%  Similarity=0.771  Sum_probs=5.5

Q ss_pred             CCeEEEe
Q 035423           17 GYRILYK   23 (35)
Q Consensus        17 G~RIlyK   23 (35)
                      |.||+|-
T Consensus         3 GTrIiYd    9 (21)
T 3hxi_C            3 SGRIIYD    9 (26)
T ss_pred             ceEEEEe
Confidence            7789884


No 311
>4a18_C 60S ribosomal protein L36A; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_C 4a1b_C 4a1d_C
Probab=29.81  E-value=27  Score=19.09  Aligned_cols=14  Identities=14%  Similarity=0.494  Sum_probs=11.3

Q ss_pred             ceecCCCCCeEEEe
Q 035423           10 VIQCRECGYRILYK   23 (35)
Q Consensus        10 ~irC~~CG~RIlyK   23 (35)
                      -..|.+||+..+.-
T Consensus        69 rl~C~eC~~~~~~~   82 (109)
T 4a18_C           69 KFDCTTCKTKRVIP   82 (109)
T ss_dssp             EEEETTTCCEEEEE
T ss_pred             EEEecccCcccccc
Confidence            46899999987764


No 312
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 3pdh_A* 2h4h_A* 3jr3_A* 2h59_A*
Probab=29.78  E-value=27  Score=20.23  Aligned_cols=11  Identities=36%  Similarity=0.776  Sum_probs=8.7

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..-+||.||..
T Consensus       144 ~~p~C~~Cgg~  154 (246)
T 1yc5_A          144 DVPLCDDCNSL  154 (246)
T ss_dssp             SSCBCTTTCCB
T ss_pred             CCCCCCCCCCc
Confidence            45699999975


No 313
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=29.63  E-value=25  Score=15.66  Aligned_cols=11  Identities=36%  Similarity=0.899  Sum_probs=7.4

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        45 ~~~~C~~C~~~   55 (77)
T 2cot_A           45 KPYKCDECGKA   55 (77)
T ss_dssp             CSEECSSSCCE
T ss_pred             cCeeCCCCCCc
Confidence            35678888764


No 314
>1vq8_1 50S ribosomal protein L37E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.2 PDB: 1vq4_1* 1vq5_1* 1vq6_1* 1vq7_1* 1s72_1* 1vq9_1* 1vqk_1* 1vql_1* 1vqm_1* 1vqn_1* 1vqo_1* 1vqp_1* 1yhq_1* 1yi2_1* 1yij_1* 1yit_1* 1yj9_1* 1yjn_1* 1yjw_1* 2otj_1* ...
Probab=29.46  E-value=24  Score=17.38  Aligned_cols=13  Identities=31%  Similarity=0.787  Sum_probs=9.9

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      ..-+.|+-||.+-
T Consensus        15 ktH~~CrRCG~~s   27 (57)
T 1vq8_1           15 TTHTKCRRCGEKS   27 (57)
T ss_dssp             CCEEECTTTCSEE
T ss_pred             CccccccccCChh
Confidence            4568899999873


No 315
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A*
Probab=29.41  E-value=27  Score=20.30  Aligned_cols=11  Identities=27%  Similarity=0.905  Sum_probs=8.7

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      .-+||.||..+
T Consensus       142 ~p~C~~Cgg~l  152 (249)
T 1m2k_A          142 LPKCDKCGSLL  152 (249)
T ss_dssp             CCBCSSSSSBE
T ss_pred             CCCCCCCCCCc
Confidence            46999999853


No 316
>1ryq_A DNA-directed RNA polymerase, subunit E''; structural genomics, zinc, PSI, protein structure initiative; 1.38A {Pyrococcus furiosus} SCOP: g.41.9.3 PDB: 3qqc_E
Probab=29.31  E-value=16  Score=18.46  Aligned_cols=11  Identities=36%  Similarity=0.785  Sum_probs=8.2

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      +.-.||+||..
T Consensus        22 ~~~~CPnC~s~   32 (69)
T 1ryq_A           22 SEDRCPVCGSR   32 (69)
T ss_dssp             SSSSCTTTCCC
T ss_pred             cCCcCCCccCC
Confidence            45579999964


No 317
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1
Probab=29.21  E-value=34  Score=16.86  Aligned_cols=17  Identities=18%  Similarity=0.215  Sum_probs=9.8

Q ss_pred             CCCceecCCCCCeEEEe
Q 035423            7 PGDVIQCRECGYRILYK   23 (35)
Q Consensus         7 ~~~~irC~~CG~RIlyK   23 (35)
                      ..+...||.|...+-|-
T Consensus         7 LLeiL~CP~ck~~L~~~   23 (67)
T 2jny_A            7 LLEVLACPKDKGPLRYL   23 (67)
T ss_dssp             GTCCCBCTTTCCBCEEE
T ss_pred             HHHHhCCCCCCCcCeEe
Confidence            34556666666665543


No 318
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A
Probab=29.17  E-value=22  Score=12.81  Aligned_cols=10  Identities=40%  Similarity=0.916  Sum_probs=7.3

Q ss_pred             ceecC--CCCCe
Q 035423           10 VIQCR--ECGYR   19 (35)
Q Consensus        10 ~irC~--~CG~R   19 (35)
                      +..|+  .||..
T Consensus         2 p~~C~~~~C~k~   13 (31)
T 1sp2_A            2 PFMCTWSYCGKR   13 (31)
T ss_dssp             CCBCCSTTCCCB
T ss_pred             CcCCcCCCCCcc
Confidence            35787  89975


No 319
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens}
Probab=29.08  E-value=17  Score=16.99  Aligned_cols=14  Identities=29%  Similarity=0.702  Sum_probs=8.7

Q ss_pred             CCceec-CCCCCeEE
Q 035423            8 GDVIQC-RECGYRIL   21 (35)
Q Consensus         8 ~~~irC-~~CG~RIl   21 (35)
                      ...|.| ..||..|+
T Consensus        14 ~~~v~C~~~C~~~v~   28 (76)
T 2yuc_A           14 FNVIPCPNRCPMKLS   28 (76)
T ss_dssp             CSCCBCTTCCSCBCC
T ss_pred             CcccCCCccccHHhh
Confidence            456777 36776654


No 320
>3p8b_A DNA-directed RNA polymerase, subunit E''; transcription elongation factor, RNA polymerase, transferase transcription complex; 1.80A {Pyrococcus furiosus}
Probab=28.98  E-value=18  Score=18.92  Aligned_cols=8  Identities=50%  Similarity=1.294  Sum_probs=6.7

Q ss_pred             ecCCCCCe
Q 035423           12 QCRECGYR   19 (35)
Q Consensus        12 rC~~CG~R   19 (35)
                      .||+||..
T Consensus        37 ~CPnCgs~   44 (81)
T 3p8b_A           37 RCPVCGSR   44 (81)
T ss_dssp             SCTTTCCC
T ss_pred             CCCCCCCC
Confidence            59999984


No 321
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=28.98  E-value=21  Score=16.16  Aligned_cols=12  Identities=17%  Similarity=0.609  Sum_probs=8.5

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      ....||.|+..|
T Consensus        56 ~~~~CP~Cr~~~   67 (73)
T 2ysl_A           56 GFFKCPLCKTSV   67 (73)
T ss_dssp             SCCCCSSSCCCC
T ss_pred             CCCCCCCCCCcC
Confidence            456788887764


No 322
>3f2g_A Alkylmercury lyase; MERB, organomercurial lyase, mercury resistance, mercuric resistance, plasmid; 1.78A {Escherichia coli} PDB: 3f2h_A 3fn8_A 1s6l_A 3f0o_A 3f0p_A 3f2f_A
Probab=28.88  E-value=77  Score=18.79  Aligned_cols=21  Identities=14%  Similarity=0.241  Sum_probs=16.6

Q ss_pred             eecCCCCCeEEEeecCCceEE
Q 035423           11 IQCRECGYRILYKKRTRRIVQ   31 (35)
Q Consensus        11 irC~~CG~RIlyK~R~~~~~~   31 (35)
                      -+||.||-.|=....+..+..
T Consensus       115 S~Cp~tG~pI~ltv~~~~i~~  135 (220)
T 3f2g_A          115 SHCAATGAPVSLTVSPSEIQA  135 (220)
T ss_dssp             EECTTTCCEEEEEECSSCEEE
T ss_pred             ecCCCCCCeEEEEEcCCceee
Confidence            469999999998888775543


No 323
>2e7z_A Acetylene hydratase AHY; tungstoprotein, DMSO reductase family, iron-sulfur-cluster, lyase; HET: MGD; 1.26A {Pelobacter acetylenicus}
Probab=28.85  E-value=69  Score=20.80  Aligned_cols=24  Identities=13%  Similarity=0.362  Sum_probs=17.5

Q ss_pred             eecCCC--CCeEEEeec-CCceEEEEe
Q 035423           11 IQCREC--GYRILYKKR-TRRIVQYEA   34 (35)
Q Consensus        11 irC~~C--G~RIlyK~R-~~~~~~~~A   34 (35)
                      --|++|  |+.|+...+ ..+++.++.
T Consensus         4 t~C~~C~~gC~i~v~v~~~g~v~rv~g   30 (727)
T 2e7z_A            4 VVCQSCDINCVVEAEVKADGKIQTKSI   30 (727)
T ss_dssp             EECCSSTTCCEEEEEECTTSCEEEEEC
T ss_pred             eECCCCcCCCCEEEEEEECCEEEEEEc
Confidence            358888  577888887 777777653


No 324
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B
Probab=28.74  E-value=28  Score=15.58  Aligned_cols=16  Identities=13%  Similarity=0.329  Sum_probs=11.6

Q ss_pred             CCCCceecCCCCCeEE
Q 035423            6 KPGDVIQCRECGYRIL   21 (35)
Q Consensus         6 k~~~~irC~~CG~RIl   21 (35)
                      ......+|..|+..|.
T Consensus         7 ~~~~~~~C~~C~~~i~   22 (72)
T 3f6q_B            7 QGSASATCERCKGGFA   22 (72)
T ss_dssp             CCCTTCBCTTTCCBCC
T ss_pred             cCcCCccchhcCcccc
Confidence            3355678999998865


No 325
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C
Probab=28.08  E-value=28  Score=15.66  Aligned_cols=11  Identities=27%  Similarity=0.818  Sum_probs=7.3

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        61 ~~~~C~~C~~~   71 (90)
T 1a1h_A           61 KPFACDICGRK   71 (90)
T ss_dssp             CCEECTTTCCE
T ss_pred             CCccCCCCCch
Confidence            34677777764


No 326
>3d00_A Tungsten formylmethanofuran dehydrogenase subunit; FWDE/GAPDH domain-like fold, structural genomics, joint CENT structural genomics; HET: MSE; 1.90A {Syntrophus aciditrophicus}
Probab=28.06  E-value=41  Score=19.23  Aligned_cols=15  Identities=20%  Similarity=0.614  Sum_probs=12.0

Q ss_pred             CCCceecCCCCCeEE
Q 035423            7 PGDVIQCRECGYRIL   21 (35)
Q Consensus         7 ~~~~irC~~CG~RIl   21 (35)
                      +...+.|..||--++
T Consensus       160 ~~~~~~C~~CGE~~~  174 (191)
T 3d00_A          160 KGKIVLCPQCREAYP  174 (191)
T ss_dssp             CCCEEECTTTCCEEE
T ss_pred             CcCCEECCcCCCChh
Confidence            367899999997764


No 327
>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus}
Probab=27.92  E-value=33  Score=19.19  Aligned_cols=14  Identities=29%  Similarity=0.515  Sum_probs=11.1

Q ss_pred             CCCceecCCCCCeE
Q 035423            7 PGDVIQCRECGYRI   20 (35)
Q Consensus         7 ~~~~irC~~CG~RI   20 (35)
                      .+....|.+|.++|
T Consensus        82 ~~~g~~C~~C~~~V   95 (153)
T 2zet_C           82 LNSRRQCLECSLFV   95 (153)
T ss_dssp             SSCCEECTTTCCEE
T ss_pred             cCCCCcCCCCCchh
Confidence            45578999999886


No 328
>2zkr_u 60S ribosomal protein L24; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris}
Probab=27.86  E-value=17  Score=20.94  Aligned_cols=10  Identities=40%  Similarity=0.810  Sum_probs=7.7

Q ss_pred             eecCCCCCeE
Q 035423           11 IQCRECGYRI   20 (35)
Q Consensus        11 irC~~CG~RI   20 (35)
                      -.|-+||+.|
T Consensus         4 ~~C~Fcg~~I   13 (157)
T 2zkr_u            4 ELCSFSGYKI   13 (157)
T ss_dssp             CBCTTTCCBC
T ss_pred             eeecCcCCcc
Confidence            4688998875


No 329
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=27.49  E-value=29  Score=14.88  Aligned_cols=13  Identities=23%  Similarity=0.690  Sum_probs=10.0

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      ..+..|+.||...
T Consensus        16 ~~~~~C~~C~k~f   28 (73)
T 2ctu_A           16 DRSQKCSKCGIIF   28 (73)
T ss_dssp             CSEEECSSSCCEE
T ss_pred             CCCeeCCcccchh
Confidence            3468999999863


No 330
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=27.40  E-value=20  Score=15.88  Aligned_cols=8  Identities=25%  Similarity=0.376  Sum_probs=4.1

Q ss_pred             eecCCCCC
Q 035423           11 IQCRECGY   18 (35)
Q Consensus        11 irC~~CG~   18 (35)
                      ..|+.||.
T Consensus        69 ~~C~~C~k   76 (79)
T 2dlk_A           69 YICEFSGP   76 (79)
T ss_dssp             CSCCSSSC
T ss_pred             eeCCCCCC
Confidence            45555553


No 331
>2hl7_A Cytochrome C-type biogenesis protein CCMH; three-helices bundle, oxidoreductase; HET: PG4; 1.70A {Pseudomonas aeruginosa}
Probab=27.36  E-value=22  Score=18.35  Aligned_cols=11  Identities=18%  Similarity=0.779  Sum_probs=8.8

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..+|||.|...
T Consensus        25 ~~LRCp~Cqnq   35 (84)
T 2hl7_A           25 QELRCPKCQNQ   35 (84)
T ss_dssp             HHEECTTSSSC
T ss_pred             HcCcCCCCCCC
Confidence            46899999874


No 332
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=27.32  E-value=27  Score=16.69  Aligned_cols=16  Identities=25%  Similarity=0.542  Sum_probs=12.3

Q ss_pred             CCCCceecCCCCCeEE
Q 035423            6 KPGDVIQCRECGYRIL   21 (35)
Q Consensus         6 k~~~~irC~~CG~RIl   21 (35)
                      +.+...+|..|+..|.
T Consensus        11 ~~~~~~~C~~C~~~I~   26 (82)
T 2co8_A           11 EAGAGDLCALCGEHLY   26 (82)
T ss_dssp             CCCSSCBCSSSCCBCC
T ss_pred             CCCCCCCCcccCCCcc
Confidence            4556778999998874


No 333
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}
Probab=27.32  E-value=23  Score=18.92  Aligned_cols=13  Identities=15%  Similarity=0.766  Sum_probs=6.6

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      .+.|++|+..+.+
T Consensus       137 ~~~C~~C~~~~~~  149 (170)
T 3hcs_A          137 QVSCDNCAASMAF  149 (170)
T ss_dssp             EEECTTTCCEEEG
T ss_pred             CeECCCCCCccCH
Confidence            3455555555443


No 334
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=27.32  E-value=31  Score=15.82  Aligned_cols=16  Identities=13%  Similarity=0.254  Sum_probs=11.5

Q ss_pred             CCCCceecCCCCCeEE
Q 035423            6 KPGDVIQCRECGYRIL   21 (35)
Q Consensus         6 k~~~~irC~~CG~RIl   21 (35)
                      ......+|..||..|.
T Consensus         7 ~~~~~~~C~~C~~~I~   22 (77)
T 1g47_A            7 NALASATCERCKGGFA   22 (77)
T ss_dssp             SCCCCCBCSSSCCBCC
T ss_pred             cCCCCCCchhcCCccC
Confidence            3455678999998763


No 335
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2}
Probab=27.17  E-value=18  Score=18.74  Aligned_cols=9  Identities=22%  Similarity=0.829  Sum_probs=6.3

Q ss_pred             ecCCCCCeE
Q 035423           12 QCRECGYRI   20 (35)
Q Consensus        12 rC~~CG~RI   20 (35)
                      .||+||..+
T Consensus        33 fCPeCgq~L   41 (81)
T 2jrp_A           33 LCPDCRQPL   41 (81)
T ss_dssp             ECSSSCSCC
T ss_pred             cCcchhhHH
Confidence            678887653


No 336
>1q1a_A HST2 protein; ternary complex, histone deacetylase, 2'-O-ADP ribose,, gene regulation; HET: ALY OAD; 1.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 PDB: 1szd_A* 1szc_A* 2od7_A* 2od9_A* 2qqf_A* 2qqg_A* 1q17_A* 2od2_A*
Probab=27.17  E-value=23  Score=21.04  Aligned_cols=11  Identities=36%  Similarity=0.966  Sum_probs=8.6

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..-+||.||..
T Consensus       162 ~~P~C~~Cgg~  172 (289)
T 1q1a_A          162 DFVKCDVCGEL  172 (289)
T ss_dssp             SCCBCTTTCCB
T ss_pred             CCccCCCCCCE
Confidence            34699999975


No 337
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z
Probab=27.03  E-value=16  Score=20.21  Aligned_cols=16  Identities=19%  Similarity=0.439  Sum_probs=11.2

Q ss_pred             ccCCCCceecCCCCCe
Q 035423            4 TLKPGDVIQCRECGYR   19 (35)
Q Consensus         4 ~lk~~~~irC~~CG~R   19 (35)
                      +++......||+||..
T Consensus        54 E~~q~akytCPfCGk~   69 (116)
T 3cc2_Z           54 ESEMNEDHACPNCGED   69 (116)
T ss_dssp             HHHHHSCEECSSSCCE
T ss_pred             HHHhccCCcCCCCCCc
Confidence            3445567789999874


No 338
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1
Probab=26.86  E-value=29  Score=15.84  Aligned_cols=11  Identities=27%  Similarity=0.842  Sum_probs=7.2

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        63 ~~~~C~~C~~~   73 (96)
T 2dmd_A           63 RPFKCQICPYA   73 (96)
T ss_dssp             CCEECSSSSCE
T ss_pred             CCccCCCCCCc
Confidence            35677777764


No 339
>2yrc_A Protein transport protein SEC23A; zinc binding, copii, coat protein complex-II, endoplasmic reticulum, golgi, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yrd_A
Probab=26.83  E-value=26  Score=16.81  Aligned_cols=12  Identities=25%  Similarity=0.816  Sum_probs=8.7

Q ss_pred             CCCceecCC--CCC
Q 035423            7 PGDVIQCRE--CGY   18 (35)
Q Consensus         7 ~~~~irC~~--CG~   18 (35)
                      ..+++||..  |+.
T Consensus         6 ~~~pvRC~r~~Cra   19 (59)
T 2yrc_A            6 SGEPVLCSRTTCRA   19 (59)
T ss_dssp             CCCCCBCSCTTTCC
T ss_pred             CCCCcccCCCCCCe
Confidence            467888887  854


No 340
>3j21_j 50S ribosomal protein L44E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus}
Probab=26.68  E-value=21  Score=18.95  Aligned_cols=16  Identities=25%  Similarity=0.428  Sum_probs=12.1

Q ss_pred             CCceecCCCCCeEEEe
Q 035423            8 GDVIQCRECGYRILYK   23 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK   23 (35)
                      .--..|.+||+..+..
T Consensus        66 ~Lrl~C~eC~~~~~~~   81 (94)
T 3j21_j           66 DLRFRCTECGKAHTRG   81 (94)
T ss_dssp             CCCEEESSSCCEECCC
T ss_pred             EEEEEecccCccceec
Confidence            3457899999987654


No 341
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1
Probab=26.67  E-value=20  Score=16.09  Aligned_cols=11  Identities=36%  Similarity=0.866  Sum_probs=8.6

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      ...||.|+..+
T Consensus        43 ~~~CP~Cr~~~   53 (65)
T 1g25_A           43 AGNCPECGTPL   53 (65)
T ss_dssp             SSSCTTTCCCC
T ss_pred             CCcCCCCCCcc
Confidence            56899998774


No 342
>1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1
Probab=26.66  E-value=36  Score=18.57  Aligned_cols=13  Identities=15%  Similarity=0.693  Sum_probs=10.2

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      .....|.+|.++|
T Consensus        70 ~~g~~C~~C~~~V   82 (134)
T 1zbd_B           70 SASVVCEDCKKNV   82 (134)
T ss_dssp             CCEEECTTTCCEE
T ss_pred             CCCCCCCCCCccc
Confidence            4568899998885


No 343
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1
Probab=26.66  E-value=41  Score=15.26  Aligned_cols=10  Identities=30%  Similarity=0.747  Sum_probs=5.3

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus         7 ~~~C~~C~~~   16 (95)
T 2yt9_A            7 GVACEICGKI   16 (95)
T ss_dssp             CEECSSSCCE
T ss_pred             CeECCCCCCc
Confidence            4555555543


No 344
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}
Probab=26.31  E-value=28  Score=15.93  Aligned_cols=13  Identities=31%  Similarity=0.733  Sum_probs=9.9

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      .....||.|+..+
T Consensus        51 ~~~~~CP~Cr~~~   63 (79)
T 2egp_A           51 GGKSSCPVCGISY   63 (79)
T ss_dssp             CCCCCCSSSCCCC
T ss_pred             CCCCcCCCCCCcC
Confidence            3478999998775


No 345
>2iv2_X Formate dehydrogenase H; oxidoreductase, 4Fe-4S, anaerobic, complete proteome, direct protein sequencing, Fe4S4, iron, iron sulfur cluster; HET: 2MD MGD; 2.27A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 1fdi_A* 1fdo_A* 1aa6_A*
Probab=26.25  E-value=80  Score=20.50  Aligned_cols=24  Identities=33%  Similarity=0.533  Sum_probs=18.0

Q ss_pred             eecCCC--CCeEEEeecCCceEEEEe
Q 035423           11 IQCREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        11 irC~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      --|+.|  |+.|....+..+++.++.
T Consensus         6 t~C~~C~~gC~i~v~v~~g~v~~v~g   31 (715)
T 2iv2_X            6 TVCPYCASGCKINLVVDNGKIVRAEA   31 (715)
T ss_dssp             EECSSBTTCCEEEEEEETTEEEEEEE
T ss_pred             EECCCCCCCCCeEEEEECCEEEEEEe
Confidence            458888  577888888877777764


No 346
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=26.17  E-value=38  Score=17.08  Aligned_cols=10  Identities=20%  Similarity=0.873  Sum_probs=6.4

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|++||..
T Consensus        18 py~C~~Cgk~   27 (102)
T 2ghf_A           18 GYECKYCTFQ   27 (102)
T ss_dssp             SEECSSCSCE
T ss_pred             CcCCCCCCCc
Confidence            4567777654


No 347
>2zkr_2 60S ribosomal protein L37E; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} SCOP: i.1.1.1
Probab=26.10  E-value=20  Score=19.34  Aligned_cols=16  Identities=25%  Similarity=0.524  Sum_probs=10.4

Q ss_pred             CCceecCCCCCeEEEe
Q 035423            8 GDVIQCRECGYRILYK   23 (35)
Q Consensus         8 ~~~irC~~CG~RIlyK   23 (35)
                      ..-+.|+.||.+.+-+
T Consensus        14 KtH~lCrRCG~~sfH~   29 (97)
T 2zkr_2           14 KTHTLCRRCGSKAYHL   29 (97)
T ss_dssp             CCEECCTTTCSSCEET
T ss_pred             CCCCcCCCCCCccCcC
Confidence            3456788888776544


No 348
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1
Probab=26.05  E-value=23  Score=17.54  Aligned_cols=14  Identities=21%  Similarity=0.584  Sum_probs=7.6

Q ss_pred             CceecCCCCCeEEE
Q 035423            9 DVIQCRECGYRILY   22 (35)
Q Consensus         9 ~~irC~~CG~RIly   22 (35)
                      +.+.||.|+...-|
T Consensus         7 eiL~CP~ck~~L~~   20 (69)
T 2pk7_A            7 DILACPICKGPLKL   20 (69)
T ss_dssp             GTCCCTTTCCCCEE
T ss_pred             hheeCCCCCCcCeE
Confidence            34556666655444


No 349
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=26.02  E-value=32  Score=16.67  Aligned_cols=11  Identities=18%  Similarity=0.582  Sum_probs=8.1

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        33 ~~~~C~~C~k~   43 (96)
T 2ctd_A           33 GSVSCPTCQAV   43 (96)
T ss_dssp             SCEECTTTCSC
T ss_pred             CCcCCCCCCCC
Confidence            45788888865


No 350
>4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens}
Probab=25.96  E-value=36  Score=16.17  Aligned_cols=12  Identities=42%  Similarity=0.830  Sum_probs=10.3

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      .+..|-.||.+|
T Consensus        18 ~~~~C~~Cg~~i   29 (61)
T 4b6d_A           18 KPESCVPCGKRI   29 (61)
T ss_dssp             SCEECTTTCCEE
T ss_pred             CCcccccccCEE
Confidence            468999999998


No 351
>2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli}
Probab=25.89  E-value=26  Score=23.84  Aligned_cols=14  Identities=21%  Similarity=0.380  Sum_probs=11.3

Q ss_pred             CCceecCCCCCeEE
Q 035423            8 GDVIQCRECGYRIL   21 (35)
Q Consensus         8 ~~~irC~~CG~RIl   21 (35)
                      ..+-.||.||..+.
T Consensus       403 ~~P~~CP~Cgs~l~  416 (671)
T 2owo_A          403 VFPTHCPVCGSDVE  416 (671)
T ss_dssp             CCCSBCTTTCCBEE
T ss_pred             cCCCCCCCCCCEeE
Confidence            34678999999875


No 352
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens}
Probab=25.83  E-value=36  Score=15.37  Aligned_cols=11  Identities=27%  Similarity=0.664  Sum_probs=8.3

Q ss_pred             eecCCCCCeEE
Q 035423           11 IQCRECGYRIL   21 (35)
Q Consensus        11 irC~~CG~RIl   21 (35)
                      .+|..||..|.
T Consensus         3 ~~C~~C~~~I~   13 (65)
T 2iyb_E            3 VVCQGCHNAID   13 (65)
T ss_dssp             EECTTTSSEEC
T ss_pred             CCCcCCCCeec
Confidence            47888888765


No 353
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=25.76  E-value=22  Score=16.29  Aligned_cols=13  Identities=15%  Similarity=0.324  Sum_probs=9.5

Q ss_pred             CceecCCCCCeEE
Q 035423            9 DVIQCRECGYRIL   21 (35)
Q Consensus         9 ~~irC~~CG~RIl   21 (35)
                      ....||.|+..+-
T Consensus        58 ~~~~CP~Cr~~~~   70 (85)
T 2ecv_A           58 GESSCPVCRISYQ   70 (85)
T ss_dssp             SCCCCTTTCCSSC
T ss_pred             CCCcCCCCCCccC
Confidence            4678999987653


No 354
>1x0t_A Ribonuclease P protein component 4; pyrococcus horikoshii OT3, hydrolase; 1.60A {Pyrococcus horikoshii} PDB: 2zae_B
Probab=25.67  E-value=25  Score=18.79  Aligned_cols=15  Identities=53%  Similarity=1.074  Sum_probs=10.9

Q ss_pred             CceecCCCCCeEEEe
Q 035423            9 DVIQCRECGYRILYK   23 (35)
Q Consensus         9 ~~irC~~CG~RIlyK   23 (35)
                      -.+.|-.||+.=-|-
T Consensus        93 vv~tCl~Cg~~kR~p  107 (120)
T 1x0t_A           93 VVITCLECGYIMRYP  107 (120)
T ss_dssp             EEEEETTTCCEEEEE
T ss_pred             EEEECCCCCCEEEEc
Confidence            467899999864443


No 355
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=25.66  E-value=33  Score=16.38  Aligned_cols=17  Identities=24%  Similarity=0.397  Sum_probs=12.3

Q ss_pred             cCCCCceecCCCCCeEE
Q 035423            5 LKPGDVIQCRECGYRIL   21 (35)
Q Consensus         5 lk~~~~irC~~CG~RIl   21 (35)
                      .+....-+|..|+..|.
T Consensus        10 ~~~~~~~~C~~C~~~I~   26 (80)
T 2dj7_A           10 IKIRGPSHCAGCKEEIK   26 (80)
T ss_dssp             CCCSSCSCCTTTCCCCS
T ss_pred             cCCCCCCCCcCcCCeeC
Confidence            34556678999998774


No 356
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1
Probab=25.65  E-value=23  Score=17.45  Aligned_cols=14  Identities=14%  Similarity=0.717  Sum_probs=7.7

Q ss_pred             CceecCCCCCeEEE
Q 035423            9 DVIQCRECGYRILY   22 (35)
Q Consensus         9 ~~irC~~CG~RIly   22 (35)
                      +.+.||.|+..+-|
T Consensus         7 ~iL~CP~ck~~L~~   20 (68)
T 2hf1_A            7 EILVCPLCKGPLVF   20 (68)
T ss_dssp             EECBCTTTCCBCEE
T ss_pred             hheECCCCCCcCeE
Confidence            34556666655444


No 357
>2yre_A F-box only protein 30; zinc binding, E3 ubiquitin ligase, SCF, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=25.59  E-value=40  Score=18.02  Aligned_cols=12  Identities=42%  Similarity=0.919  Sum_probs=9.2

Q ss_pred             CceecC-CCCCeE
Q 035423            9 DVIQCR-ECGYRI   20 (35)
Q Consensus         9 ~~irC~-~CG~RI   20 (35)
                      .+|.|| .||-.|
T Consensus        36 ~~i~CP~~Cga~i   48 (100)
T 2yre_A           36 DLIGCPLVCGAVF   48 (100)
T ss_dssp             CEEECTTCCSCEE
T ss_pred             eeeeCCcccCCee
Confidence            478899 899843


No 358
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B
Probab=25.46  E-value=34  Score=21.20  Aligned_cols=15  Identities=20%  Similarity=0.505  Sum_probs=12.4

Q ss_pred             CCCCceecCCCCCeE
Q 035423            6 KPGDVIQCRECGYRI   20 (35)
Q Consensus         6 k~~~~irC~~CG~RI   20 (35)
                      ..+|.++|-+||.-+
T Consensus        36 g~~D~v~Cf~C~~~l   50 (345)
T 3t6p_A           36 GRNDDVKCFSCDGGL   50 (345)
T ss_dssp             SSTTCEEETTTCCEE
T ss_pred             CCCCeEEecCCCCCc
Confidence            357899999999764


No 359
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1
Probab=25.29  E-value=33  Score=16.26  Aligned_cols=10  Identities=20%  Similarity=0.740  Sum_probs=6.1

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus        94 ~~~C~~C~~~  103 (124)
T 2dlq_A           94 PYKCSSCSQQ  103 (124)
T ss_dssp             SEECSSSCCE
T ss_pred             CccCCCccch
Confidence            4666666654


No 360
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A
Probab=25.27  E-value=33  Score=15.66  Aligned_cols=10  Identities=40%  Similarity=0.730  Sum_probs=5.6

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus         3 ~~~C~~C~k~   12 (88)
T 1llm_C            3 PFQCRICMRN   12 (88)
T ss_dssp             CEECTTTCCE
T ss_pred             CCcCCCCCCc
Confidence            3556666654


No 361
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A*
Probab=25.25  E-value=56  Score=17.30  Aligned_cols=19  Identities=21%  Similarity=0.419  Sum_probs=14.4

Q ss_pred             cCCCCceecCCCCCeEEEe
Q 035423            5 LKPGDVIQCRECGYRILYK   23 (35)
Q Consensus         5 lk~~~~irC~~CG~RIlyK   23 (35)
                      ++......|+.|+.+..++
T Consensus       167 ~~~~~~~~~~~~~~~~~~~  185 (192)
T 3mqg_A          167 LRGNAEATCPHTGERYILT  185 (192)
T ss_dssp             SSSSEEEECTTTCCEEEEE
T ss_pred             ccccccccccccCCeEEEc
Confidence            4455579999999997664


No 362
>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens}
Probab=25.22  E-value=44  Score=16.21  Aligned_cols=13  Identities=38%  Similarity=0.756  Sum_probs=9.5

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      ....+|..|++.+
T Consensus        49 kqG~~C~~C~~~~   61 (77)
T 2enn_A           49 KQGYQCRQCNAAI   61 (77)
T ss_dssp             CCEEECSSSCCEE
T ss_pred             ccccCcCCCCCcC
Confidence            3678888888764


No 363
>1vzi_A Desulfoferrodoxin; ferrocyanide, microspectrophotometry, redox states, photoreduction, dinuclear iron cluster, oxidoreductase; 1.15A {Desulfovibrio baarsii} SCOP: b.1.13.1 g.41.5.2 PDB: 1vzh_A* 1vzg_A 2ji1_A 2ji2_A 2ji3_A 1dfx_A
Probab=25.11  E-value=37  Score=18.28  Aligned_cols=16  Identities=25%  Similarity=0.534  Sum_probs=12.0

Q ss_pred             CCCCceecCCCCCeEE
Q 035423            6 KPGDVIQCRECGYRIL   21 (35)
Q Consensus         6 k~~~~irC~~CG~RIl   21 (35)
                      +...-.+|+.||.=|.
T Consensus         3 ~~~~fYkC~~CGnive   18 (126)
T 1vzi_A            3 ERLQVYKCEVCGNIVE   18 (126)
T ss_dssp             CTTCEEECTTTCCEEE
T ss_pred             ccCcEEEcCCCCeEEE
Confidence            3456789999998664


No 364
>2kw0_A CCMH protein; oxidoreductase, cytochrome C maturation; NMR {Escherichia coli}
Probab=24.49  E-value=24  Score=18.59  Aligned_cols=11  Identities=18%  Similarity=0.797  Sum_probs=8.7

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..+|||.|...
T Consensus        22 ~~LRCpvCqnq   32 (90)
T 2kw0_A           22 EELRCPKCQNN   32 (90)
T ss_dssp             HSSBCSCTTSC
T ss_pred             HcCcCCCCCCC
Confidence            46899999864


No 365
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens}
Probab=24.29  E-value=28  Score=15.96  Aligned_cols=11  Identities=27%  Similarity=0.634  Sum_probs=7.6

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        74 ~~~~C~~C~~~   84 (100)
T 2ebt_A           74 KPFQCGVCNRS   84 (100)
T ss_dssp             CSCBCSSSCCB
T ss_pred             CCeECCCCcCc
Confidence            35678888764


No 366
>2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens}
Probab=24.02  E-value=24  Score=17.78  Aligned_cols=7  Identities=29%  Similarity=1.037  Sum_probs=5.1

Q ss_pred             ecCCCCC
Q 035423           12 QCRECGY   18 (35)
Q Consensus        12 rC~~CG~   18 (35)
                      +|+.||.
T Consensus        57 kC~~C~S   63 (79)
T 2k2d_A           57 KCKICES   63 (79)
T ss_dssp             CCTTTSC
T ss_pred             cCcCCCC
Confidence            7777774


No 367
>3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A*
Probab=23.93  E-value=43  Score=15.52  Aligned_cols=11  Identities=27%  Similarity=1.050  Sum_probs=8.6

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+.+|..|++.
T Consensus        36 qg~~C~~C~~~   46 (65)
T 3uej_A           36 QGLKCEDCGMN   46 (65)
T ss_dssp             CEEEETTTCCE
T ss_pred             eeeECCCCCCe
Confidence            56888888865


No 368
>1vq8_3 50S ribosomal protein L44E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.3 PDB: 1jj2_2 1k73_4* 1k8a_4* 1k9m_4* 1kc8_4* 1kd1_4* 1kqs_2* 1m1k_4* 1m90_4* 1n8r_4* 1nji_4* 1q7y_4* 1q81_4* 1q82_4* 1q86_4* 1qvf_2 1qvg_2 1s72_3* 1vq4_3* 1vq5_3* ...
Probab=23.90  E-value=29  Score=18.46  Aligned_cols=13  Identities=38%  Similarity=0.733  Sum_probs=10.4

Q ss_pred             ceecCCCCCeEEE
Q 035423           10 VIQCRECGYRILY   22 (35)
Q Consensus        10 ~irC~~CG~RIly   22 (35)
                      -.+|.+||+..+.
T Consensus        68 rl~C~~C~~~~~~   80 (92)
T 1vq8_3           68 KYRCGECGKAHLR   80 (92)
T ss_dssp             EEEETTTCCEECC
T ss_pred             EEEecccChhhcc
Confidence            4689999998654


No 369
>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus}
Probab=23.69  E-value=33  Score=16.10  Aligned_cols=11  Identities=36%  Similarity=1.096  Sum_probs=8.5

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ...+|..|++.
T Consensus        40 qg~~C~~C~~~   50 (66)
T 1y8f_A           40 QGMRCTECGVK   50 (66)
T ss_dssp             EEEEETTTCCE
T ss_pred             ceeEcCCCCCe
Confidence            56788888875


No 370
>3bbo_3 Ribosomal protein L33; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}
Probab=23.64  E-value=15  Score=18.36  Aligned_cols=13  Identities=15%  Similarity=0.294  Sum_probs=9.2

Q ss_pred             ecCCCCCeEEEee
Q 035423           12 QCRECGYRILYKK   24 (35)
Q Consensus        12 rC~~CG~RIlyK~   24 (35)
                      -||.|....|+|+
T Consensus        51 ycp~c~kHtlhkE   63 (66)
T 3bbo_3           51 FCPYCYKHTIHGE   63 (66)
T ss_dssp             CCCSSSSCCCCCC
T ss_pred             cCCCCCCeeeEEe
Confidence            3778877777765


No 371
>3j21_e 50S ribosomal protein L37E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus}
Probab=23.48  E-value=29  Score=17.38  Aligned_cols=12  Identities=42%  Similarity=0.905  Sum_probs=9.1

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      .-+.|+-||.+-
T Consensus        16 tH~lCrRCG~~s   27 (62)
T 3j21_e           16 THIRCRRCGRVS   27 (62)
T ss_dssp             CCCBCSSSCSBC
T ss_pred             ceeeecccCcch
Confidence            467888888873


No 372
>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=23.47  E-value=45  Score=16.30  Aligned_cols=13  Identities=31%  Similarity=0.726  Sum_probs=9.5

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      ....+|..|++.+
T Consensus        43 kqg~~C~~C~~~~   55 (83)
T 2yuu_A           43 KQGYKCRQCNAAI   55 (83)
T ss_dssp             CCEEEETTTCCEE
T ss_pred             ccccccCCcCCee
Confidence            3578898888753


No 373
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis}
Probab=23.30  E-value=30  Score=17.29  Aligned_cols=10  Identities=20%  Similarity=0.421  Sum_probs=7.7

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .+.|+.||-.
T Consensus         5 ~~~c~~c~~~   14 (148)
T 3p2a_A            5 NTVCTACMAT   14 (148)
T ss_dssp             EEECTTTCCE
T ss_pred             EEECcccccc
Confidence            4679999973


No 374
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=23.21  E-value=38  Score=15.94  Aligned_cols=11  Identities=27%  Similarity=0.709  Sum_probs=7.7

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        64 ~~~~C~~C~~~   74 (110)
T 2csh_A           64 KPYECNICAKR   74 (110)
T ss_dssp             CCEECSSSCCE
T ss_pred             CCeeCCCCcch
Confidence            35678888865


No 375
>2vpz_A Thiosulfate reductase; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_A* 2vpw_A* 2vpy_A*
Probab=23.15  E-value=1.1e+02  Score=20.09  Aligned_cols=24  Identities=21%  Similarity=0.397  Sum_probs=17.9

Q ss_pred             eecCCC--CCeEEEeecCCceEEEEe
Q 035423           11 IQCREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        11 irC~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      --|++|  |+.|....+.-+++.++.
T Consensus        42 t~C~~C~~gC~i~v~v~~g~v~~v~g   67 (765)
T 2vpz_A           42 QICEGCFWRCGIVAHAVGNRVYKVEG   67 (765)
T ss_dssp             EECCSSTTCCEEEEEESSSCEEEEEE
T ss_pred             eECCCCcCCCceEEEEECCEEEEEEc
Confidence            459988  578888888777777763


No 376
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=23.13  E-value=27  Score=16.58  Aligned_cols=11  Identities=18%  Similarity=0.462  Sum_probs=8.3

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      .+..|+.||..
T Consensus        23 ~~~~C~~C~k~   33 (98)
T 2gqj_A           23 GEAVCPTCNVV   33 (98)
T ss_dssp             SCCCCTTTCCC
T ss_pred             CCcCCCCCCCC
Confidence            45788888875


No 377
>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=23.06  E-value=48  Score=16.33  Aligned_cols=13  Identities=15%  Similarity=0.669  Sum_probs=9.6

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      ....+|..|++.+
T Consensus        43 kqG~~C~~C~~~~   55 (85)
T 2eli_A           43 HQGMKCDTCDMNV   55 (85)
T ss_dssp             SCEEECSSSCCEE
T ss_pred             cCCCcCCCcCCcc
Confidence            3678899888763


No 378
>3mhs_E SAGA-associated factor 73; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_E 4fip_D 4fjc_D 4fk5_E 3m99_D
Probab=22.87  E-value=17  Score=19.61  Aligned_cols=12  Identities=25%  Similarity=0.719  Sum_probs=9.4

Q ss_pred             eecCCCCCeEEE
Q 035423           11 IQCRECGYRILY   22 (35)
Q Consensus        11 irC~~CG~RIly   22 (35)
                      =-|..||..|.+
T Consensus        76 RvCn~CGkPI~l   87 (96)
T 3mhs_E           76 RVCEKCGKPLAL   87 (96)
T ss_dssp             EEETTTCCEECG
T ss_pred             hhhhccCCceeH
Confidence            359999998754


No 379
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=22.87  E-value=32  Score=15.98  Aligned_cols=12  Identities=17%  Similarity=0.473  Sum_probs=8.9

Q ss_pred             CceecCCCCCeE
Q 035423            9 DVIQCRECGYRI   20 (35)
Q Consensus         9 ~~irC~~CG~RI   20 (35)
                      ....||.|...+
T Consensus        55 ~~~~CP~Cr~~~   66 (88)
T 2ct2_A           55 NGVRCPFCSKIT   66 (88)
T ss_dssp             SCBCCTTTCCCB
T ss_pred             CCcCCCCCCCcc
Confidence            357899998764


No 380
>3ml1_A NAPA, periplasmic nitrate reductase; heterodimer, oxidoreductase; HET: MGD HEC; 1.60A {Ralstonia eutropha} PDB: 3o5a_A* 1ogy_A* 2nya_A*
Probab=22.74  E-value=1e+02  Score=20.71  Aligned_cols=24  Identities=21%  Similarity=0.540  Sum_probs=18.2

Q ss_pred             eecCCCC--CeEEEeecCCceEEEEe
Q 035423           11 IQCRECG--YRILYKKRTRRIVQYEA   34 (35)
Q Consensus        11 irC~~CG--~RIlyK~R~~~~~~~~A   34 (35)
                      --|++||  +.|....+..+++.++.
T Consensus        17 t~C~~C~~gC~i~v~v~~g~iv~v~g   42 (802)
T 3ml1_A           17 APCRFCGTGCGVTVAVKDNKVVATQG   42 (802)
T ss_dssp             EECSSCTTCCEEEEEEETTEEEEEEE
T ss_pred             EECCCCCCCCCeEEEEECCEEEEEEc
Confidence            3699995  77888888777777653


No 381
>1x4s_A Protein FON, zinc finger HIT domain containing protein 2; structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.85.1.2
Probab=22.68  E-value=34  Score=16.80  Aligned_cols=11  Identities=18%  Similarity=0.510  Sum_probs=8.3

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ...+||.||-|
T Consensus        25 akY~CPrC~~r   35 (59)
T 1x4s_A           25 ARYTCPRCNAP   35 (59)
T ss_dssp             ECEECTTTCCE
T ss_pred             ccccCcCCCCC
Confidence            46789999865


No 382
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1
Probab=22.43  E-value=44  Score=15.52  Aligned_cols=12  Identities=25%  Similarity=0.661  Sum_probs=7.6

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        15 ~~~~~C~~C~~~   26 (106)
T 2ee8_A           15 KKEFICKFCGRH   26 (106)
T ss_dssp             CCCCBCSSSCCB
T ss_pred             CcCeECCCCCCc
Confidence            345677777754


No 383
>2vy4_A U11/U12 small nuclear ribonucleoprotein 48 kDa protein; splicing, mRNA processing, alternative splicing, transcription, nucleus, spliceosome; NMR {Homo sapiens} SCOP: g.37.1.7 PDB: 2vy5_A
Probab=22.43  E-value=51  Score=14.34  Aligned_cols=14  Identities=14%  Similarity=0.472  Sum_probs=10.7

Q ss_pred             CCceecC-CCCCeEE
Q 035423            8 GDVIQCR-ECGYRIL   21 (35)
Q Consensus         8 ~~~irC~-~CG~RIl   21 (35)
                      .+-+.|| +..|+|+
T Consensus         3 ~~~v~CPyd~~H~i~   17 (37)
T 2vy4_A            3 DEVVICPYDSNHHMP   17 (37)
T ss_dssp             CCCEECTTTSSCEEC
T ss_pred             ceEEECCCCCCeEeC
Confidence            4678999 7788865


No 384
>1q14_A HST2 protein; histone deacetylase, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5
Probab=22.38  E-value=32  Score=21.51  Aligned_cols=10  Identities=30%  Similarity=0.906  Sum_probs=8.2

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .-+||.||..
T Consensus       171 ~P~Cp~Cgg~  180 (361)
T 1q14_A          171 FVKCDVCGEL  180 (361)
T ss_dssp             CCBCTTTCCB
T ss_pred             CCCCcCCCCE
Confidence            4699999975


No 385
>4g9i_A Hydrogenase maturation protein HYPF; zinc finger, ATP binding, carbamoyla transferase; 4.50A {Thermococcus kodakarensis}
Probab=22.35  E-value=38  Score=23.21  Aligned_cols=15  Identities=20%  Similarity=0.414  Sum_probs=12.6

Q ss_pred             CceecCCCCCeEEEe
Q 035423            9 DVIQCRECGYRILYK   23 (35)
Q Consensus         9 ~~irC~~CG~RIlyK   23 (35)
                      .++-||.||=++.+.
T Consensus       177 qp~aC~~CGP~l~l~  191 (772)
T 4g9i_A          177 EPTACPVCGPSYRLY  191 (772)
T ss_dssp             TTCCCTTTSCCEEEE
T ss_pred             CCCCCccCCceEEEE
Confidence            578999999998664


No 386
>3flo_B DNA polymerase alpha catalytic subunit A; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae}
Probab=22.31  E-value=51  Score=19.25  Aligned_cols=14  Identities=21%  Similarity=0.686  Sum_probs=10.5

Q ss_pred             ceecCCCCCeEEEe
Q 035423           10 VIQCRECGYRILYK   23 (35)
Q Consensus        10 ~irC~~CG~RIlyK   23 (35)
                      .++||.||..-.|.
T Consensus        22 ~l~Cp~C~~~~~F~   35 (206)
T 3flo_B           22 ELSCPSCDKRFPFG   35 (206)
T ss_dssp             EEECTTTCCEEEEC
T ss_pred             EEECCCCCCccCCC
Confidence            47899999876554


No 387
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}
Probab=22.16  E-value=39  Score=16.46  Aligned_cols=10  Identities=30%  Similarity=0.773  Sum_probs=5.4

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|++||..
T Consensus        56 ~~~C~~C~k~   65 (85)
T 2lv2_A           56 VFPCKYCPAT   65 (85)
T ss_dssp             SEECTTSSCE
T ss_pred             ccCCCCCCCE
Confidence            4556666543


No 388
>2w0t_A Lethal(3)malignant brain tumor-like 2 protein; zinc, YACG, LMBL2, nucleus, zinc-finger, RNA binding, MBT repeats, PCG proteins, polymorphism; NMR {Homo sapiens}
Probab=21.97  E-value=46  Score=15.44  Aligned_cols=11  Identities=27%  Similarity=0.797  Sum_probs=9.0

Q ss_pred             CCceecCCCCC
Q 035423            8 GDVIQCRECGY   18 (35)
Q Consensus         8 ~~~irC~~CG~   18 (35)
                      .+...|-.||.
T Consensus         4 ~~~~~CE~CG~   14 (43)
T 2w0t_A            4 SEPAVCEMCGI   14 (43)
T ss_dssp             CCEEECTTTCC
T ss_pred             CceehhhhhcC
Confidence            45689999996


No 389
>1ti6_A Pyrogallol hydroxytransferase large subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.52.2.2 c.81.1.1 PDB: 1ti2_A* 1ti4_A* 1vld_M* 1vle_M* 1vlf_M*
Probab=21.87  E-value=1e+02  Score=20.67  Aligned_cols=25  Identities=8%  Similarity=0.181  Sum_probs=17.9

Q ss_pred             ceecCCCCCeEEEeecCCceEEEEe
Q 035423           10 VIQCRECGYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        10 ~irC~~CG~RIlyK~R~~~~~~~~A   34 (35)
                      ...|++||..++...+.-+++.++.
T Consensus         6 ~~~~~~cg~~~~v~v~dg~vv~v~g   30 (875)
T 1ti6_A            6 RLTNSSTGGPVFVYVKDGKIIRMTP   30 (875)
T ss_dssp             EEEECCTTCCEEEEEETTEEEEEEC
T ss_pred             eeeccCcCCCeEEEEECCEEEEEeC
Confidence            3578999998866666666666653


No 390
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1
Probab=21.60  E-value=37  Score=12.18  Aligned_cols=10  Identities=20%  Similarity=0.567  Sum_probs=7.6

Q ss_pred             ceecC--CCCCe
Q 035423           10 VIQCR--ECGYR   19 (35)
Q Consensus        10 ~irC~--~CG~R   19 (35)
                      +..|+  .||..
T Consensus         3 ~~~C~~~~C~k~   14 (32)
T 1zfd_A            3 PYSCDHPGCDKA   14 (32)
T ss_dssp             SBCCCCTTCCCC
T ss_pred             CCcCcCCCCCCc
Confidence            46798  89975


No 391
>1ma3_A SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1s7g_A* 1yc2_A*
Probab=21.53  E-value=32  Score=20.02  Aligned_cols=10  Identities=40%  Similarity=1.275  Sum_probs=8.1

Q ss_pred             CceecCCCCC
Q 035423            9 DVIQCRECGY   18 (35)
Q Consensus         9 ~~irC~~CG~   18 (35)
                      +.-+||.||.
T Consensus       146 ~~p~C~~Cgg  155 (253)
T 1ma3_A          146 EIPRCRKCGS  155 (253)
T ss_dssp             CCCCCTTTCC
T ss_pred             CCCCCCCCCC
Confidence            4569999998


No 392
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=21.48  E-value=38  Score=15.33  Aligned_cols=14  Identities=29%  Similarity=0.703  Sum_probs=10.2

Q ss_pred             CCceecCCCCCeEE
Q 035423            8 GDVIQCRECGYRIL   21 (35)
Q Consensus         8 ~~~irC~~CG~RIl   21 (35)
                      +...+|..|+..|.
T Consensus         3 ~~~~~C~~C~~~I~   16 (70)
T 2d8x_A            3 SGSSGCHQCGEFII   16 (70)
T ss_dssp             CCSSBCSSSCCBCC
T ss_pred             CCCCcCccCCCEec
Confidence            34567889988774


No 393
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=21.41  E-value=43  Score=16.23  Aligned_cols=12  Identities=25%  Similarity=0.830  Sum_probs=9.4

Q ss_pred             CCceecCCCCCe
Q 035423            8 GDVIQCRECGYR   19 (35)
Q Consensus         8 ~~~irC~~CG~R   19 (35)
                      ..+..|+.||..
T Consensus        23 ~kpy~C~~C~k~   34 (88)
T 1x6f_A           23 NSTYQCKHCDSK   34 (88)
T ss_dssp             CSCEECSSSCCE
T ss_pred             CCCCcCCCCCCE
Confidence            346889999976


No 394
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=21.38  E-value=32  Score=15.41  Aligned_cols=11  Identities=27%  Similarity=0.631  Sum_probs=6.5

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      ...||.|+..|
T Consensus        50 ~~~CP~Cr~~~   60 (66)
T 2ecy_A           50 SPKCTACQESI   60 (66)
T ss_dssp             SCCCTTTCCCC
T ss_pred             cCCCCCCCcCC
Confidence            44677776553


No 395
>3ttc_A HYPF, transcriptional regulatory protein; Zn finger, nucleotide binding, hydrogenase maturation factor transferase; HET: ADP; 1.86A {Escherichia coli} PDB: 3tsp_A* 3tsu_A* 3ttf_A* 3ttd_A 3tsq_A
Probab=21.32  E-value=41  Score=22.82  Aligned_cols=14  Identities=29%  Similarity=0.724  Sum_probs=11.8

Q ss_pred             CceecCCCCCeE-EE
Q 035423            9 DVIQCRECGYRI-LY   22 (35)
Q Consensus         9 ~~irC~~CG~RI-ly   22 (35)
                      .++-||.||=++ ++
T Consensus        88 qp~aCp~CGP~l~~l  102 (657)
T 3ttc_A           88 QPVACPECGPYLEWV  102 (657)
T ss_dssp             TTCCCTTTSCCEEEE
T ss_pred             CCCcCcccCccceEe
Confidence            579999999998 54


No 396
>1pg5_B Aspartate carbamoyltransferase regulatory chain; 2.60A {Sulfolobus acidocaldarius} SCOP: d.58.2.1 g.41.7.1 PDB: 2be9_B*
Probab=21.31  E-value=52  Score=19.15  Aligned_cols=13  Identities=23%  Similarity=0.419  Sum_probs=10.1

Q ss_pred             CCceecCCCCCeE
Q 035423            8 GDVIQCRECGYRI   20 (35)
Q Consensus         8 ~~~irC~~CG~RI   20 (35)
                      ....||.||+.-+
T Consensus       141 ~~~lrC~YCe~~~  153 (168)
T 1pg5_B          141 PLKMRCEYCETII  153 (168)
T ss_dssp             TTEEEETTTCCEE
T ss_pred             CCEEEeeCCCCEe
Confidence            4458999999764


No 397
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1
Probab=21.30  E-value=28  Score=16.99  Aligned_cols=11  Identities=36%  Similarity=0.594  Sum_probs=8.4

Q ss_pred             ceecCCCCCeE
Q 035423           10 VIQCRECGYRI   20 (35)
Q Consensus        10 ~irC~~CG~RI   20 (35)
                      ...||.|+..+
T Consensus        58 ~~~CP~Cr~~~   68 (112)
T 1jm7_A           58 PSQCPLCKNDI   68 (112)
T ss_dssp             SCCCTTTSCCC
T ss_pred             CCCCcCCCCcC
Confidence            46899998764


No 398
>1j8f_A SIRT2, sirtuin 2, isoform 1, silencing INFO; gene regulation, transferase; 1.70A {Homo sapiens} SCOP: c.31.1.5
Probab=21.29  E-value=35  Score=20.84  Aligned_cols=11  Identities=18%  Similarity=0.516  Sum_probs=8.5

Q ss_pred             CceecCCCCCe
Q 035423            9 DVIQCRECGYR   19 (35)
Q Consensus         9 ~~irC~~CG~R   19 (35)
                      ..-+||.||..
T Consensus       184 ~~P~C~~Cgg~  194 (323)
T 1j8f_A          184 VTPKCEDCQSL  194 (323)
T ss_dssp             CCCBCTTTCCB
T ss_pred             CCCCCcCCCCc
Confidence            34599999975


No 399
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus}
Probab=21.11  E-value=35  Score=17.67  Aligned_cols=10  Identities=30%  Similarity=0.863  Sum_probs=8.2

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      .+.|+.|+..
T Consensus        14 ~~~c~~c~~~   23 (155)
T 2ppt_A           14 RLTCLACGQA   23 (155)
T ss_dssp             EEECTTTCCE
T ss_pred             eEECcccccc
Confidence            4899999864


No 400
>3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B
Probab=20.93  E-value=39  Score=22.99  Aligned_cols=13  Identities=15%  Similarity=0.549  Sum_probs=9.6

Q ss_pred             CCCceecCCCCCe
Q 035423            7 PGDVIQCRECGYR   19 (35)
Q Consensus         7 ~~~~irC~~CG~R   19 (35)
                      ..+++||..|+--
T Consensus        95 ~~~pvRC~rCray  107 (770)
T 3efo_B           95 ESGPVRCNRCKAY  107 (770)
T ss_dssp             TTCSCBCTTTCCB
T ss_pred             CCCCCccCCCCCC
Confidence            4568899999753


No 401
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3*
Probab=20.84  E-value=1.1e+02  Score=20.51  Aligned_cols=25  Identities=24%  Similarity=0.497  Sum_probs=18.0

Q ss_pred             ceecCCC--CCeEEEeecCCceEEEEe
Q 035423           10 VIQCREC--GYRILYKKRTRRIVQYEA   34 (35)
Q Consensus        10 ~irC~~C--G~RIlyK~R~~~~~~~~A   34 (35)
                      .--|++|  |+.|....|..+++.++.
T Consensus       253 ~s~C~~C~~gC~i~v~v~~g~v~rv~~  279 (783)
T 3i9v_3          253 PTTCALCPVGCGITADTRSGELLRIRA  279 (783)
T ss_dssp             EEECCSSSSCCEEEEEEETBEEEEEEE
T ss_pred             EEeCCCCCCcccceeeeECCEEEeccC
Confidence            3468888  467888887777777664


No 402
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3
Probab=20.65  E-value=34  Score=15.59  Aligned_cols=13  Identities=23%  Similarity=0.422  Sum_probs=9.1

Q ss_pred             CceecCCCCCeEE
Q 035423            9 DVIQCRECGYRIL   21 (35)
Q Consensus         9 ~~irC~~CG~RIl   21 (35)
                      ...+|..|+..|.
T Consensus         4 ~~~~C~~C~~~I~   16 (72)
T 1x4l_A            4 GSSGCAGCTNPIS   16 (72)
T ss_dssp             CSCSBTTTTBCCC
T ss_pred             CCCCCcCCCcccc
Confidence            3467888887764


No 403
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1}
Probab=20.46  E-value=45  Score=16.19  Aligned_cols=10  Identities=20%  Similarity=0.395  Sum_probs=7.3

Q ss_pred             ceecCCCCCe
Q 035423           10 VIQCRECGYR   19 (35)
Q Consensus        10 ~irC~~CG~R   19 (35)
                      +..|+.||..
T Consensus        74 ~~~C~~C~k~   83 (129)
T 2wbt_A           74 QFVCPLCLMP   83 (129)
T ss_dssp             SEECTTTCCE
T ss_pred             CeECCCCCcc
Confidence            5678888865


No 404
>2k1p_A Zinc finger RAN-binding domain-containing protein 2; ZNF265, RNA binding, ranbp2, RBZ, ZIS, alternative splicing, metal-binding, mRNA processing; NMR {Homo sapiens} PDB: 3g9y_A
Probab=20.33  E-value=35  Score=14.43  Aligned_cols=9  Identities=33%  Similarity=0.870  Sum_probs=7.1

Q ss_pred             eecCCCCCe
Q 035423           11 IQCRECGYR   19 (35)
Q Consensus        11 irC~~CG~R   19 (35)
                      -.|+.||+-
T Consensus         7 W~C~~C~~~   15 (33)
T 2k1p_A            7 WQCKTCSNV   15 (33)
T ss_dssp             CBCSSSCCB
T ss_pred             cccCCCCCc
Confidence            679999864


No 405
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus}
Probab=20.07  E-value=35  Score=22.00  Aligned_cols=11  Identities=27%  Similarity=0.975  Sum_probs=8.7

Q ss_pred             CCceecCCCCC
Q 035423            8 GDVIQCRECGY   18 (35)
Q Consensus         8 ~~~irC~~CG~   18 (35)
                      -+-|.||-||-
T Consensus       269 ~~~ISCPtCGR  279 (366)
T 3noy_A          269 VEIVACPTCGR  279 (366)
T ss_dssp             CEEEECCCCTT
T ss_pred             CEEEECCCCCC
Confidence            35689999994


Done!