Query         035434
Match_columns 48
No_of_seqs    15 out of 17
Neff          1.8 
Searched_HMMs 46136
Date          Fri Mar 29 02:57:38 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035434.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035434hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF15365 PNRC:  Proline-rich nu  98.5 5.3E-08 1.2E-12   55.6   1.3   40    8-47     15-57  (58)
  2 COG3807 Uncharacterized protei  91.7   0.072 1.6E-06   36.8   0.7   19    5-23     24-43  (171)
  3 PRK11187 replication initiatio  49.4      10 0.00023   26.1   1.3   15   33-47     21-35  (182)
  4 PF08100 Dimerisation:  Dimeris  44.5      14 0.00029   20.2   1.1   15   33-47     35-49  (51)
  5 PF14983 DUF4513:  Domain of un  42.0      12 0.00025   25.2   0.7   31   10-40     29-77  (132)
  6 PF03925 SeqA:  SeqA protein;    41.7      14 0.00031   25.4   1.1   15   33-47     21-35  (190)
  7 PF01186 Lysyl_oxidase:  Lysyl   40.9     5.8 0.00013   27.6  -0.9   23   25-47     25-53  (205)
  8 TIGR01745 asd_gamma aspartate-  39.5      14 0.00031   27.0   0.9   15   33-47    350-364 (366)
  9 PF15148 Apolipo_F:  Apolipopro  36.7     8.9 0.00019   27.0  -0.5   23    9-31     14-42  (200)
 10 COG3382 Solo B3/4 domain (OB-f  36.7      19  0.0004   25.5   1.0   22   16-46     72-93  (229)
 11 PF05720 Dicty_CAD:  Cell-cell   32.7      19 0.00042   22.1   0.5   15    2-16      5-19  (82)
 12 cd07031 RNAP_II_RPB3 RPB3 subu  30.7      26 0.00055   24.1   0.9   20   26-45     13-32  (265)
 13 cd07032 RNAP_I_II_AC40 AC40 su  29.1      29 0.00063   24.7   1.0   20   26-45     13-32  (291)
 14 KOG1521 RNA polymerase I and I  27.7      30 0.00066   26.1   0.9   15   31-45     63-77  (338)
 15 KOG2801 Probable Rab-GAPs [Int  26.0      25 0.00055   27.6   0.3   17    7-23     85-101 (559)
 16 PRK10178 D-alanyl-D-alanine di  25.5      53  0.0012   22.1   1.7   38    6-46    110-148 (184)
 17 PF01427 Peptidase_M15:  D-ala-  24.5      48   0.001   21.9   1.3   38    6-46    125-163 (198)
 18 PRK00783 DNA-directed RNA poly  23.8      43 0.00094   22.2   1.0   15   31-45     18-32  (263)
 19 PF07621 DUF1582:  Protein of u  23.0      37 0.00081   17.5   0.5   19   11-29      2-23  (29)
 20 PHA02682 ORF080 virion core pr  22.9      43 0.00092   24.7   0.9   12   34-45    245-256 (280)
 21 PF09802 Sec66:  Preprotein tra  21.4      42 0.00091   22.9   0.6   13   36-48     81-93  (190)
 22 cd07030 RNAP_D D subunit of Ar  20.7      54  0.0012   21.7   1.0   14   32-45     19-32  (259)
 23 PF07769 PsiF_repeat:  psiF rep  20.3      30 0.00066   18.5  -0.2   11   23-33      9-19  (35)

No 1  
>PF15365 PNRC:  Proline-rich nuclear receptor coactivator
Probab=98.48  E-value=5.3e-08  Score=55.61  Aligned_cols=40  Identities=28%  Similarity=0.321  Sum_probs=32.2

Q ss_pred             cCCcccccccccccccc--ccchh-hhccCcchhHHHHHhhhc
Q 035434            8 SGDCYASGEFALRPKLI--SCNAE-AAGVDAGATDNLRRLLRL   47 (48)
Q Consensus         8 ~~~~lPlP~FSlk~K~~--~CnaE-aagvdd~atdnLRRLLRL   47 (48)
                      +|++||+|.|+.+++..  +|..| ....++.+|++||||||+
T Consensus        15 ~PssLP~P~f~~~~~~~~~~~~~~~~~~~~~~~T~~Lr~LL~v   57 (58)
T PF15365_consen   15 SPSSLPLPPFHWKSSPSSLSSCPESPSSDDESMTRQLRRLLKV   57 (58)
T ss_pred             ChhhcCCCCcccccCccccccccccccccHHHHHHHHHHHHcc
Confidence            68899999999998663  33333 557889999999999997


No 2  
>COG3807 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=91.69  E-value=0.072  Score=36.81  Aligned_cols=19  Identities=21%  Similarity=0.260  Sum_probs=16.5

Q ss_pred             ccccCCccccccc-cccccc
Q 035434            5 RTISGDCYASGEF-ALRPKL   23 (48)
Q Consensus         5 ~~~~~~~lPlP~F-Slk~K~   23 (48)
                      -||.++-||+|+| |||++.
T Consensus        24 ~tig~sgLplPRfVSlKs~~   43 (171)
T COG3807          24 TTIGASGLPLPRFVSLKSAE   43 (171)
T ss_pred             CccCCCCCcccceEEecccc
Confidence            4788999999999 888876


No 3  
>PRK11187 replication initiation regulator SeqA; Provisional
Probab=49.36  E-value=10  Score=26.11  Aligned_cols=15  Identities=53%  Similarity=0.833  Sum_probs=12.2

Q ss_pred             cCcchhHHHHHhhhc
Q 035434           33 VDAGATDNLRRLLRL   47 (48)
Q Consensus        33 vdd~atdnLRRLLRL   47 (48)
                      +-.+|-|=|||||.|
T Consensus        21 IGESASDILRRLL~l   35 (182)
T PRK11187         21 IGESASDILRRLLKL   35 (182)
T ss_pred             cCCCHHHHHHHHhCC
Confidence            445688999999987


No 4  
>PF08100 Dimerisation:  Dimerisation domain;  InterPro: IPR012967 This domain is found at the N terminus of a variety of plant O-methyltransferases. It has been shown to mediate dimerisation of these proteins [].; GO: 0008168 methyltransferase activity, 0046983 protein dimerization activity; PDB: 1ZGJ_A 1ZG3_A 1ZHF_A 1ZGA_A 2QYO_A 1KYW_A 1KYZ_A 3REO_D 1FPX_A 1FP2_A ....
Probab=44.52  E-value=14  Score=20.19  Aligned_cols=15  Identities=33%  Similarity=0.539  Sum_probs=11.3

Q ss_pred             cCcchhHHHHHhhhc
Q 035434           33 VDAGATDNLRRLLRL   47 (48)
Q Consensus        33 vdd~atdnLRRLLRL   47 (48)
                      .+..+.+.|+|+||+
T Consensus        35 ~~p~~~~~L~RimR~   49 (51)
T PF08100_consen   35 SNPSAPPMLDRIMRL   49 (51)
T ss_dssp             T-TTHHHHHHHHHHH
T ss_pred             CCcchHHHHHHHHHH
Confidence            445678899999995


No 5  
>PF14983 DUF4513:  Domain of unknown function (DUF4513)
Probab=41.98  E-value=12  Score=25.17  Aligned_cols=31  Identities=26%  Similarity=0.389  Sum_probs=22.3

Q ss_pred             Ccccccccccccccc------------------ccchhhhccCcchhHH
Q 035434           10 DCYASGEFALRPKLI------------------SCNAEAAGVDAGATDN   40 (48)
Q Consensus        10 ~~lPlP~FSlk~K~~------------------~CnaEaagvdd~atdn   40 (48)
                      +..-+|+||++-..|                  -=|||++|+-.|.-++
T Consensus        29 ~~iHlPrFS~~~~~IPrrYVmpWK~dMkfR~~nlK~ae~~GIy~GPlee   77 (132)
T PF14983_consen   29 EEIHLPRFSLKQGMIPRRYVMPWKEDMKFRNVNLKNAELCGIYTGPLEE   77 (132)
T ss_pred             cccccchhhhhcCCCcccccCchhhhhhhhHHhhhhhhhcccccCCchh
Confidence            345689999876554                  4578899998877553


No 6  
>PF03925 SeqA:  SeqA protein;  InterPro: IPR005621 The binding of SeqA protein to hemimethylated GATC sequences is important in the negative modulation of chromosomal initiation at oriC, and in the formation of SeqA foci necessary for Escherichia coli chromosome segregation []. SeqA tetramers are able to aggregate or multimerize in a reversible, concentration-dependent manner []. Apart from its function in the control of DNA replication, SeqA may also be a specific transcription factor []. The C-terminal domain binds DNA, binding to fully methylated and hemimethylated GATC sequences at oriC. The structure of the C-terminal domain consists of seven alpha-helices and three-stranded beta-sheet.; GO: 0003677 DNA binding, 0032297 negative regulation of DNA-dependent DNA replication initiation; PDB: 3FMT_A 1J3E_A 1XRX_D 1IU3_C 1LRR_D.
Probab=41.72  E-value=14  Score=25.41  Aligned_cols=15  Identities=53%  Similarity=0.780  Sum_probs=10.7

Q ss_pred             cCcchhHHHHHhhhc
Q 035434           33 VDAGATDNLRRLLRL   47 (48)
Q Consensus        33 vdd~atdnLRRLLRL   47 (48)
                      +-.+|-|=|||||.|
T Consensus        21 IGESASdILRRLL~l   35 (190)
T PF03925_consen   21 IGESASDILRRLLNL   35 (190)
T ss_dssp             TT--HHHHHHHHHTH
T ss_pred             cCCCHHHHHHHhcCC
Confidence            345678999999976


No 7  
>PF01186 Lysyl_oxidase:  Lysyl oxidase ;  InterPro: IPR001695 Lysyl oxidase (1.4.3.13 from EC) (LOX) [] is an extracellular copper-dependent enzyme that catalyses the oxidative deamination of peptidyl lysine residues in precursors of various collagens and elastins, yielding alpha-aminoadipic-delta-semialdehyde. The deaminated lysines are then able to form semialdehyde cross-links, resulting in the formation of insoluble collagen and elastin fibres in the extracellular matrix []. The active site of LOX resides towards the C terminus: this region also binds a single copper atom in an octahedral coordination complex involving at least 3 His residues []. Four histidine residues are clustered in a central region of the enzyme. This region is thought to be involved in cooper-binding and is called the 'copper-talon' [].; GO: 0005507 copper ion binding, 0016641 oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor, 0055114 oxidation-reduction process
Probab=40.92  E-value=5.8  Score=27.65  Aligned_cols=23  Identities=39%  Similarity=0.550  Sum_probs=18.3

Q ss_pred             ccchhhhccCcchh------HHHHHhhhc
Q 035434           25 SCNAEAAGVDAGAT------DNLRRLLRL   47 (48)
Q Consensus        25 ~CnaEaagvdd~at------dnLRRLLRL   47 (48)
                      +|-+|-.++..+|.      -+.|||||.
T Consensus        25 ~CA~eEnCl~~say~~~~~~~~~RrLLRF   53 (205)
T PF01186_consen   25 RCAAEENCLSSSAYRIQNWPYGERRLLRF   53 (205)
T ss_pred             hhhhhcccccccccccCCCCCCcceEEec
Confidence            89999888888763      367999985


No 8  
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial.
Probab=39.46  E-value=14  Score=26.96  Aligned_cols=15  Identities=47%  Similarity=0.740  Sum_probs=11.7

Q ss_pred             cCcchhHHHHHhhhc
Q 035434           33 VDAGATDNLRRLLRL   47 (48)
Q Consensus        33 vdd~atdnLRRLLRL   47 (48)
                      +--||+-||||+|.+
T Consensus       350 lrkGAA~~~~~~~~~  364 (366)
T TIGR01745       350 LLWGAAEPLRRMLRI  364 (366)
T ss_pred             hhhhhHhHHHHHHHH
Confidence            335799999999874


No 9  
>PF15148 Apolipo_F:  Apolipoprotein F
Probab=36.73  E-value=8.9  Score=26.96  Aligned_cols=23  Identities=39%  Similarity=0.395  Sum_probs=15.6

Q ss_pred             CCccccccc----cccc--cccccchhhh
Q 035434            9 GDCYASGEF----ALRP--KLISCNAEAA   31 (48)
Q Consensus         9 ~~~lPlP~F----Slk~--K~~~CnaEaa   31 (48)
                      +.--|||+|    +++.  ..++|++||-
T Consensus        14 ~~~aPLp~~L~~LaLr~aLe~aGC~aea~   42 (200)
T PF15148_consen   14 PHMAPLPEFLSGLALRVALEEAGCQAEAW   42 (200)
T ss_pred             CCCCcchHHHHHHHHHHHHHHcCCcHHHH
Confidence            456689998    3343  2259999985


No 10 
>COG3382 Solo B3/4 domain (OB-fold DNA/RNA-binding) of Phe-aaRS-beta [General function prediction only]
Probab=36.70  E-value=19  Score=25.46  Aligned_cols=22  Identities=41%  Similarity=0.683  Sum_probs=17.0

Q ss_pred             cccccccccccchhhhccCcchhHHHHHhhh
Q 035434           16 EFALRPKLISCNAEAAGVDAGATDNLRRLLR   46 (48)
Q Consensus        16 ~FSlk~K~~~CnaEaagvdd~atdnLRRLLR   46 (48)
                      +|-++|....|.+||-         +||++|
T Consensus        72 ~~g~kp~k~r~S~EAL---------lrRv~k   93 (229)
T COG3382          72 RFGIKPTKTRPSAEAL---------LRRVLK   93 (229)
T ss_pred             HhCCCcCCCCCcHHHH---------HHHHHc
Confidence            5777885459999987         888876


No 11 
>PF05720 Dicty_CAD:  Cell-cell adhesion domain;  InterPro: IPR008601 This family is based on a group of Dictyostelium discoideum (Slime mould) proteins that are essential in early development []. P16642 from SWISSPROT and P16643 from SWISSPROT are located on the cell surface and mediate cell-cell adhesion.; GO: 0007155 cell adhesion
Probab=32.69  E-value=19  Score=22.14  Aligned_cols=15  Identities=33%  Similarity=0.262  Sum_probs=12.9

Q ss_pred             CccccccCCcccccc
Q 035434            2 LGLRTISGDCYASGE   16 (48)
Q Consensus         2 ~~~~~~~~~~lPlP~   16 (48)
                      .|-.||||.+.|||.
T Consensus         5 ~GeStI~G~a~~lP~   19 (82)
T PF05720_consen    5 DGESTISGKAIPLPT   19 (82)
T ss_pred             CCeeEeecccccCCC
Confidence            477899999999997


No 12 
>cd07031 RNAP_II_RPB3 RPB3 subunit of Eukaryotic RNA polymerase II. The eukaryotic RPB3 subunit of RNA polymerase (RNAP) II is involved in the assembly of RNAP subunits. RNAP is a large multi-subunit complex responsible for the synthesis of RNA. It is the principal enzyme of the transcription process, and is a final target in many regulatory pathways that control gene expression in all living cells. At least three distinct RNAP complexes are found in eukaryotic nuclei: RNAP I, RNAP II, and RNAP III. RNAP II is responsible for the synthesis of mRNA precursor. The RPB3 subunit is similar to the bacterial RNAP alpha subunit in that it contains two subdomains: one subdomain is similar the eukaryotic Rpb11/AC19/archaeal L subunit which is involved in dimerization, and the other is an inserted beta sheet subdomain. The RPB3 subunit heterodimerizes with the RPB11 subunit, and together with RPB10 and RPB12, anchors the two largest subunits, RPB1 and RPB2, and stabilizes their association.
Probab=30.70  E-value=26  Score=24.07  Aligned_cols=20  Identities=20%  Similarity=0.346  Sum_probs=15.1

Q ss_pred             cchhhhccCcchhHHHHHhh
Q 035434           26 CNAEAAGVDAGATDNLRRLL   45 (48)
Q Consensus        26 CnaEaagvdd~atdnLRRLL   45 (48)
                      +.-+.-|+|..-+|.|||+|
T Consensus        13 ~~F~l~~~~~s~aNALRRil   32 (265)
T cd07031          13 VKFILENTDLSVANSLRRVM   32 (265)
T ss_pred             EEEEEEcCcHHHHHHHHHHH
Confidence            34445577788999999987


No 13 
>cd07032 RNAP_I_II_AC40 AC40 subunit of Eukaryotic RNA polymerase (RNAP) I and RNAP III. The eukaryotic AC40 subunit of RNA polymerase (RNAP) I and RNAP III is involved in the assembly of RNAP subunits. RNAP is a large multi-subunit complex responsible for the synthesis of RNA. It is the principal enzyme of the transcription process, and is a final target in many regulatory pathways that control gene expression in all living cells. At least three distinct RNAP complexes are found in eukaryotic nuclei: RNAP I, RNAP II, and RNAP III. RNAP I is responsible for the synthesis of ribosomal RNA precursor, while RNAP III functions in the synthesis of 5S and tRNA. The AC40 subunit is the equivalent of the RPB3 subunit of RNAP II. The RPB3 subunit is similar to the bacterial RNAP alpha subunit in that it contains two subdomains: one subdomain is similar the eukaryotic Rpb11/AC19/archaeal L subunit which is involved in dimerization; and the other is an inserted beta sheet subdomain. The RPB3 subun
Probab=29.11  E-value=29  Score=24.65  Aligned_cols=20  Identities=35%  Similarity=0.587  Sum_probs=16.1

Q ss_pred             cchhhhccCcchhHHHHHhh
Q 035434           26 CNAEAAGVDAGATDNLRRLL   45 (48)
Q Consensus        26 CnaEaagvdd~atdnLRRLL   45 (48)
                      +.-+--|+|.+-+|.|||++
T Consensus        13 ~~f~l~~~d~s~ANAlRRim   32 (291)
T cd07032          13 LEFDLIGVDASIANAFRRIL   32 (291)
T ss_pred             EEEEEecCCHHHHHHHHHHH
Confidence            44455689999999999986


No 14 
>KOG1521 consensus RNA polymerase I and III, subunit RPA40/RPC40 [Transcription]
Probab=27.65  E-value=30  Score=26.15  Aligned_cols=15  Identities=40%  Similarity=0.806  Sum_probs=13.9

Q ss_pred             hccCcchhHHHHHhh
Q 035434           31 AGVDAGATDNLRRLL   45 (48)
Q Consensus        31 agvdd~atdnLRRLL   45 (48)
                      .|||++-+|-+||+|
T Consensus        63 igIda~IANAfRRIL   77 (338)
T KOG1521|consen   63 IGIDASIANAFRRIL   77 (338)
T ss_pred             eeccHHHHHHHHHHH
Confidence            499999999999997


No 15 
>KOG2801 consensus Probable Rab-GAPs [Intracellular trafficking, secretion, and vesicular transport]
Probab=26.02  E-value=25  Score=27.61  Aligned_cols=17  Identities=24%  Similarity=0.382  Sum_probs=12.4

Q ss_pred             ccCCccccccccccccc
Q 035434            7 ISGDCYASGEFALRPKL   23 (48)
Q Consensus         7 ~~~~~lPlP~FSlk~K~   23 (48)
                      -|.+|||+|.|--..+.
T Consensus        85 hsssclplpefvdntqv  101 (559)
T KOG2801|consen   85 HSSSCLPLPEFVDNTQV  101 (559)
T ss_pred             CCcccccchhhcccCcC
Confidence            47789999999544443


No 16 
>PRK10178 D-alanyl-D-alanine dipeptidase; Provisional
Probab=25.52  E-value=53  Score=22.10  Aligned_cols=38  Identities=26%  Similarity=0.242  Sum_probs=20.8

Q ss_pred             cccCCcccccc-ccccccccccchhhhccCcchhHHHHHhhh
Q 035434            6 TISGDCYASGE-FALRPKLISCNAEAAGVDAGATDNLRRLLR   46 (48)
Q Consensus         6 ~~~~~~lPlP~-FSlk~K~~~CnaEaagvdd~atdnLRRLLR   46 (48)
                      .-+|..++|+. |.--...+++..  .+++..+.+| |+|||
T Consensus       110 d~~G~~ldMGt~fD~f~~~s~~~~--~~~s~~~~~n-R~lL~  148 (184)
T PRK10178        110 DAHGNILDMGTGFDEMHARSHHFH--PGVPPAAQRN-RLLLL  148 (184)
T ss_pred             CCCCCEecCCCCcCcCCccccccC--CCCCHHHHHH-HHHHH
Confidence            34577788875 322222224432  3676666665 88876


No 17 
>PF01427 Peptidase_M15:  D-ala-D-ala dipeptidase This is family M15 in the peptidase classification. ;  InterPro: IPR000755 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M15 (clan MD), subfamily M15D (vanX D-Ala-D-Ala dipeptidase). The D-alanyl-D-alanine dipeptidase enzyme from Enterococcus faecalis is also known as the vancomycin resistance protein VanX, and hydrolyses D-ala-D-ala. It has a 250-fold differential in catalytic efficiency for hydrolysis of D-ala-D-ala versus D-ala-D-lactate. The latter therefore remains intact for subsequent incorporation into peptidoglycan precursors that terminate in the dipeptide D-ala-D-lactate rather than the dipeptide D-ala-D-ala, thereby preventing vancomycin from binding. The enzyme requires a metal cofactor, and is induced by vancomycin through regulation by VanS and VanR.; GO: 0008237 metallopeptidase activity, 0016805 dipeptidase activity, 0006508 proteolysis, 0005618 cell wall; PDB: 1R44_B.
Probab=24.47  E-value=48  Score=21.87  Aligned_cols=38  Identities=29%  Similarity=0.391  Sum_probs=15.2

Q ss_pred             cccCCcccccc-ccccccccccchhhhccCcchhHHHHHhhh
Q 035434            6 TISGDCYASGE-FALRPKLISCNAEAAGVDAGATDNLRRLLR   46 (48)
Q Consensus         6 ~~~~~~lPlP~-FSlk~K~~~CnaEaagvdd~atdnLRRLLR   46 (48)
                      .-.|..|+||+ |---...+....  .+++..+..| |+||+
T Consensus       125 ~~~G~~ldMGt~fD~f~~~s~~~~--~~i~~~~~~N-R~lL~  163 (198)
T PF01427_consen  125 DATGEELDMGTPFDEFTERSHTDY--YGISPEARRN-RRLLR  163 (198)
T ss_dssp             TTT--B---SS-TT--SGGGSTT---SSS-HHHHHH-HHHHH
T ss_pred             cCCCCeeccCcCCCCCChhHHHhc--cCCCHHHHHH-HHHHH
Confidence            34577788875 221122212222  2367777777 88886


No 18 
>PRK00783 DNA-directed RNA polymerase subunit D; Provisional
Probab=23.75  E-value=43  Score=22.21  Aligned_cols=15  Identities=27%  Similarity=0.552  Sum_probs=13.1

Q ss_pred             hccCcchhHHHHHhh
Q 035434           31 AGVDAGATDNLRRLL   45 (48)
Q Consensus        31 agvdd~atdnLRRLL   45 (48)
                      -|++..-+|.|||+|
T Consensus        18 ~g~~~t~~NalRRvl   32 (263)
T PRK00783         18 EGVTPAFANAIRRAM   32 (263)
T ss_pred             eCCCHHHHHHHHHHH
Confidence            388888999999987


No 19 
>PF07621 DUF1582:  Protein of unknown function (DUF1582);  InterPro: IPR011476 This is a family of hypothetical proteins found in Rhodopirellula baltica.
Probab=23.02  E-value=37  Score=17.53  Aligned_cols=19  Identities=32%  Similarity=0.576  Sum_probs=12.9

Q ss_pred             ccccccccccccc---cccchh
Q 035434           11 CYASGEFALRPKL---ISCNAE   29 (48)
Q Consensus        11 ~lPlP~FSlk~K~---~~CnaE   29 (48)
                      .||.|.||+....   ++|..|
T Consensus         2 ~lpsp~~l~~~ri~~~~nc~~~   23 (29)
T PF07621_consen    2 ALPSPEFLLEARISTLSNCVQE   23 (29)
T ss_pred             CcCCCCcChhhhcCCCcchhcc
Confidence            5788999876543   466554


No 20 
>PHA02682 ORF080 virion core protein; Provisional
Probab=22.90  E-value=43  Score=24.72  Aligned_cols=12  Identities=58%  Similarity=0.844  Sum_probs=9.7

Q ss_pred             CcchhHHHHHhh
Q 035434           34 DAGATDNLRRLL   45 (48)
Q Consensus        34 dd~atdnLRRLL   45 (48)
                      ..+|.|+|||||
T Consensus       245 Tq~AIdDLRrLl  256 (280)
T PHA02682        245 TQAAIDDLRRLL  256 (280)
T ss_pred             HHHHHHHHHHHH
Confidence            346889999998


No 21 
>PF09802 Sec66:  Preprotein translocase subunit Sec66;  InterPro: IPR018624  Members of this family of proteins are a component of the heterotetrameric Sec62/63 complex composed of SEC62, SEC63, SEC66 and SEC72. The Sec62/63 complex associates with the Sec61 complex to form the Sec complex. Sec 66 is involved in SRP-independent post-translational translocation across the endoplasmic reticulum and functions together with the Sec61 complex and KAR2 in a channel-forming translocon complex. Furthermore, Sec66 is also required for growth at elevated temperatures [, , , ]. 
Probab=21.38  E-value=42  Score=22.92  Aligned_cols=13  Identities=38%  Similarity=0.910  Sum_probs=10.7

Q ss_pred             chhHHHHHhhhcC
Q 035434           36 GATDNLRRLLRLR   48 (48)
Q Consensus        36 ~atdnLRRLLRLr   48 (48)
                      -|+.+|||+++||
T Consensus        81 RavedIrR~~klr   93 (190)
T PF09802_consen   81 RAVEDIRRIIKLR   93 (190)
T ss_pred             HHHHHHHHHHHHH
Confidence            4678999999885


No 22 
>cd07030 RNAP_D D subunit of Archaeal RNA polymerase. The D subunit of archaeal RNA polymerase (RNAP) is involved in the assembly of RNAP subunits. RNAP is a large multi-subunit complex responsible for the synthesis of RNA. It is the principal enzyme of the transcription process, and is a final target in many regulatory pathways that control gene expression in all living cells. A single distinct RNAP complex is found in archaea, which may be responsible for the synthesis of all RNAs. The archaeal RNAP harbors homologues of all eukaryotic RNAP II subunits with two exceptions (RPB8 and RPB9). The 12 archaeal subunits are designated by letters and can be divided into three functional groups that are engaged in: (I) catalysis (A'/A", B'/B" or B); (II) assembly (L, N, D and P); and (III) auxiliary functions (F, E, H and K). The D subunit is equivalent to the RPB3 subunit of eukaryotic RNAP II. It contains two subdomains: one subdomain is similar the eukaryotic Rpb11/AC19/archaeal L subunit w
Probab=20.73  E-value=54  Score=21.69  Aligned_cols=14  Identities=29%  Similarity=0.574  Sum_probs=12.7

Q ss_pred             ccCcchhHHHHHhh
Q 035434           32 GVDAGATDNLRRLL   45 (48)
Q Consensus        32 gvdd~atdnLRRLL   45 (48)
                      |++..-+|-|||+|
T Consensus        19 g~~~s~~NalRRil   32 (259)
T cd07030          19 GVPPAFANAIRRAI   32 (259)
T ss_pred             CCCHHHHHHHHHHH
Confidence            88888999999987


No 23 
>PF07769 PsiF_repeat:  psiF repeat;  InterPro: IPR011690 This region is approximately 35 residues long. It is found repeated in a number of putative phosphate starvation-inducible proteins expressed by various bacterial species. PsiF (Q7AH28 from SWISSPROT) is known to be an example of such phosphate starvation-inducible proteins [].
Probab=20.29  E-value=30  Score=18.46  Aligned_cols=11  Identities=45%  Similarity=0.697  Sum_probs=8.4

Q ss_pred             ccccchhhhcc
Q 035434           23 LISCNAEAAGV   33 (48)
Q Consensus        23 ~~~CnaEaagv   33 (48)
                      -..||+||.+.
T Consensus         9 M~~Cn~~A~~k   19 (35)
T PF07769_consen    9 MKTCNAEAKEK   19 (35)
T ss_pred             HHHHHHHHHhC
Confidence            34799999865


Done!