BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035445
         (38 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q8W486|Y1491_ARATH Uncharacterized protein At1g04910 OS=Arabidopsis thaliana
           GN=At1g04910 PE=1 SV=1
          Length = 519

 Score = 31.6 bits (70), Expect = 1.6,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 2/38 (5%)

Query: 2   AALDYMVSVESDVFIPSHLG--NMARAVEGHLMLSVFQ 37
           +A+DYMV + SD+F+P++ G  N A  + GH +   F+
Sbjct: 377 SAVDYMVCLLSDIFMPTYDGPSNFANNLLGHRLYYGFR 414


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.325    0.135    0.377 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,750,199
Number of Sequences: 539616
Number of extensions: 180350
Number of successful extensions: 513
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 513
Number of HSP's gapped (non-prelim): 1
length of query: 38
length of database: 191,569,459
effective HSP length: 12
effective length of query: 26
effective length of database: 185,094,067
effective search space: 4812445742
effective search space used: 4812445742
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)