Citrus Sinensis ID: 035446


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------6
MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFKGSE
ccccccccccccccccccEEEEcccccccHHHHHHHHHHccccccccccccccEEcccc
ccccccccccccccccccEEEEccccHHHHHHHHHHHcccccccccccccccEEEcccc
mafdgccpdcklpgddcpliwgacnhAFHLHCILKWvnsqtpqahcpmcrrewqfkgse
MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFKGSE
MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFKGSE
***DGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREW******
MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFK***
MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFKGSE
**FDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQF****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
oooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFKGSE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query59 2.2.26 [Sep-21-2011]
Q9M9L084 Anaphase-promoting comple yes no 0.949 0.666 0.982 6e-27
Q9CPX984 Anaphase-promoting comple yes no 0.949 0.666 0.75 3e-21
Q3ZCF684 Anaphase-promoting comple yes no 0.949 0.666 0.75 3e-21
Q5R8A284 Anaphase-promoting comple yes no 0.949 0.666 0.732 1e-20
Q9NYG584 Anaphase-promoting comple yes no 0.949 0.666 0.732 1e-20
Q54L4887 Anaphase-promoting comple yes no 0.983 0.666 0.711 2e-19
Q12157165 Anaphase-promoting comple yes no 0.932 0.333 0.490 2e-12
Q9UT8694 Anaphase-promoting comple yes no 0.983 0.617 0.482 7e-12
O13959107 RING-box protein pip1 OS= no no 0.796 0.439 0.418 1e-06
Q23457110 RING-box protein 1 OS=Cae no no 0.661 0.354 0.476 2e-06
>sp|Q9M9L0|APC11_ARATH Anaphase-promoting complex subunit 11 OS=Arabidopsis thaliana GN=APC11 PE=1 SV=2 Back     alignment and function desciption
 Score =  119 bits (298), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 55/56 (98%)

Query: 1  MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFK 56
          MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQT QAHCPMCRREWQFK
Sbjct: 28 MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTSQAHCPMCRREWQFK 83




Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex controls several key steps in the cell cycle by mediating ubiquitination and subsequent degradation of target proteins such as cyclins. The APC/C complex is required for the female gametophyte development and is involved in several aspect of development by controlling cell division and cell elongation. Involved in the control of endoreduplication. May recruit the E2 ubiquitin-conjugating enzymes to the complex.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9CPX9|APC11_MOUSE Anaphase-promoting complex subunit 11 OS=Mus musculus GN=Anapc11 PE=3 SV=1 Back     alignment and function description
>sp|Q3ZCF6|APC11_BOVIN Anaphase-promoting complex subunit 11 OS=Bos taurus GN=ANAPC11 PE=3 SV=1 Back     alignment and function description
>sp|Q5R8A2|APC11_PONAB Anaphase-promoting complex subunit 11 OS=Pongo abelii GN=ANAPC11 PE=3 SV=1 Back     alignment and function description
>sp|Q9NYG5|APC11_HUMAN Anaphase-promoting complex subunit 11 OS=Homo sapiens GN=ANAPC11 PE=1 SV=1 Back     alignment and function description
>sp|Q54L48|APC11_DICDI Anaphase-promoting complex subunit 11 OS=Dictyostelium discoideum GN=anapc11 PE=3 SV=1 Back     alignment and function description
>sp|Q12157|APC11_YEAST Anaphase-promoting complex subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APC11 PE=1 SV=1 Back     alignment and function description
>sp|Q9UT86|APC11_SCHPO Anaphase-promoting complex subunit 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc11 PE=1 SV=1 Back     alignment and function description
>sp|O13959|RBX1_SCHPO RING-box protein pip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pip1 PE=1 SV=2 Back     alignment and function description
>sp|Q23457|RBX1_CAEEL RING-box protein 1 OS=Caenorhabditis elegans GN=rbx-1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query59
449475614 229 PREDICTED: E3 ubiquitin-protein ligase h 0.966 0.248 0.982 8e-28
12436554295 Zinc finger, RING-type [Medicago truncat 0.966 0.6 0.982 1e-26
255543044127 ring finger, putative [Ricinus communis] 0.966 0.448 0.964 1e-26
356574062129 PREDICTED: anaphase-promoting complex su 0.966 0.441 0.964 2e-26
35948759381 PREDICTED: anaphase-promoting complex su 0.966 0.703 1.0 2e-26
35750142777 Anaphase promoting complex subunit [Medi 0.966 0.740 0.982 7e-26
35746799183 Anaphase promoting complex subunit [Medi 0.966 0.686 0.982 7e-26
38851165584 unknown [Lotus japonicus] 0.966 0.678 0.964 2e-25
33418511187 anaphase-promoting complex subunit 11 [A 0.949 0.643 0.982 2e-25
30259593684 RecName: Full=Anaphase-promoting complex 0.949 0.666 0.982 2e-25
>gi|449475614|ref|XP_004154502.1| PREDICTED: E3 ubiquitin-protein ligase hrd-1-like, partial [Cucumis sativus] Back     alignment and taxonomy information
 Score =  127 bits (319), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 56/57 (98%), Positives = 56/57 (98%)

Query: 1   MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFKG 57
           MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQT QAHCPMCRREWQFKG
Sbjct: 173 MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTSQAHCPMCRREWQFKG 229




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|124365542|gb|ABN09776.1| Zinc finger, RING-type [Medicago truncatula] Back     alignment and taxonomy information
>gi|255543044|ref|XP_002512585.1| ring finger, putative [Ricinus communis] gi|223548546|gb|EEF50037.1| ring finger, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356574062|ref|XP_003555171.1| PREDICTED: anaphase-promoting complex subunit 11-like [Glycine max] Back     alignment and taxonomy information
>gi|359487593|ref|XP_003633618.1| PREDICTED: anaphase-promoting complex subunit 11-like [Vitis vinifera] gi|296089855|emb|CBI39674.3| unnamed protein product [Vitis vinifera] gi|297745203|emb|CBI40283.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357501427|ref|XP_003621002.1| Anaphase promoting complex subunit [Medicago truncatula] gi|355496017|gb|AES77220.1| Anaphase promoting complex subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|357467991|ref|XP_003604280.1| Anaphase promoting complex subunit [Medicago truncatula] gi|355505335|gb|AES86477.1| Anaphase promoting complex subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|388511655|gb|AFK43889.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|334185111|ref|NP_187238.2| anaphase-promoting complex subunit 11 [Arabidopsis thaliana] gi|334185113|ref|NP_001189819.1| anaphase-promoting complex subunit 11 [Arabidopsis thaliana] gi|297791461|ref|XP_002863615.1| anaphase promoting complex subunit 11 [Arabidopsis lyrata subsp. lyrata] gi|297309450|gb|EFH39874.1| anaphase promoting complex subunit 11 [Arabidopsis lyrata subsp. lyrata] gi|332640788|gb|AEE74309.1| anaphase-promoting complex subunit 11 [Arabidopsis thaliana] gi|332640789|gb|AEE74310.1| anaphase-promoting complex subunit 11 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|302595936|sp|Q9M9L0.2|APC11_ARATH RecName: Full=Anaphase-promoting complex subunit 11; AltName: Full=Cyclosome subunit 11 gi|16197625|gb|AAL13436.1| anaphase promoting complex subunit 11 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query59
UNIPROTKB|Q3ZCF684 ANAPC11 "Anaphase-promoting co 0.949 0.666 0.75 6.6e-26
UNIPROTKB|E2R4W084 ANAPC11 "Uncharacterized prote 0.949 0.666 0.75 6.6e-26
MGI|MGI:191340684 Anapc11 "anaphase promoting co 0.949 0.666 0.75 6.6e-26
RGD|156188084 Anapc11 "anaphase promoting co 0.949 0.666 0.75 6.6e-26
UNIPROTKB|Q9NYG584 ANAPC11 "Anaphase-promoting co 0.949 0.666 0.732 2.2e-25
UNIPROTKB|Q5R8A284 ANAPC11 "Anaphase-promoting co 0.949 0.666 0.732 2.2e-25
ZFIN|ZDB-GENE-061013-38388 anapc11 "APC11 anaphase promot 0.932 0.625 0.727 1.6e-24
DICTYBASE|DDB_G028690987 anapc11 "anaphase promoting co 0.983 0.666 0.711 6.8e-24
UNIPROTKB|I3L93384 ANAPC11 "Uncharacterized prote 0.881 0.619 0.730 6.1e-23
FB|FBgn025090385 lmgA "lemming A" [Drosophila m 0.932 0.647 0.6 3.5e-20
UNIPROTKB|Q3ZCF6 ANAPC11 "Anaphase-promoting complex subunit 11" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 293 (108.2 bits), Expect = 6.6e-26, P = 6.6e-26
 Identities = 42/56 (75%), Positives = 51/56 (91%)

Query:     1 MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFK 56
             MAF+GCCPDCK+PGDDCPL+WG C+H FH+HCILKW+N+Q  Q HCPMCR+EW+FK
Sbjct:    28 MAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLNAQQVQQHCPMCRQEWKFK 83




GO:0005680 "anaphase-promoting complex" evidence=ISS
GO:0070979 "protein K11-linked ubiquitination" evidence=ISS
GO:0005737 "cytoplasm" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0051301 "cell division" evidence=IEA
GO:0007067 "mitosis" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|E2R4W0 ANAPC11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1913406 Anapc11 "anaphase promoting complex subunit 11" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1561880 Anapc11 "anaphase promoting complex subunit 11" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NYG5 ANAPC11 "Anaphase-promoting complex subunit 11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R8A2 ANAPC11 "Anaphase-promoting complex subunit 11" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061013-383 anapc11 "APC11 anaphase promoting complex subunit 11 homolog (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286909 anapc11 "anaphase promoting complex subunit 11" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|I3L933 ANAPC11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0250903 lmgA "lemming A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9NYG5APC11_HUMANNo assigned EC number0.73210.94910.6666yesno
Q5R8A2APC11_PONABNo assigned EC number0.73210.94910.6666yesno
Q9M9L0APC11_ARATHNo assigned EC number0.98210.94910.6666yesno
Q3ZCF6APC11_BOVINNo assigned EC number0.750.94910.6666yesno
Q54L48APC11_DICDINo assigned EC number0.71180.98300.6666yesno
Q9CPX9APC11_MOUSENo assigned EC number0.750.94910.6666yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00022509001
SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (214 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query59
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 2e-24
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 3e-17
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 2e-15
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 7e-08
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 5e-05
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 1e-04
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
 Score = 85.6 bits (212), Expect = 2e-24
 Identities = 33/56 (58%), Positives = 43/56 (76%)

Query: 1  MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFK 56
          ++FDG CP CK PGDDCPL+WG C H FH+HCILKW+ ++T +  CPMCR+ + F 
Sbjct: 29 VSFDGTCPQCKFPGDDCPLVWGKCKHNFHMHCILKWLATETSKGLCPMCRQTFVFA 84


Apc11 is one of the subunits of the anaphase-promoting complex or cyclosome. The APC subunits are cullin family proteins with ubiquitin ligase activity. Polyubiquitination marks proteins for degradation by the 26S proteasome and is carried out by a cascade of enzymes that includes ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s), and ubiquitin ligases (E3s). Apc11 acts as an E3 enzyme and is responsible for recruiting E2s to the APC and for mediating the subsequent transfer of ubiquitin to APC substrates in vivo. In Saccharomyces cerevisiae this RING-H2 finger protein defines the minimal ubiquitin ligase activity of the APC, and the integrity of the RING-H2 finger is essential for budding yeast cell viability. Length = 85

>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 59
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 99.84
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.73
KOG149384 consensus Anaphase-promoting complex (APC), subuni 99.73
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.68
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 99.62
PHA02929238 N1R/p28-like protein; Provisional 99.59
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.5
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.47
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.45
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.44
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.43
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.42
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.42
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.42
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.42
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.4
PHA02926242 zinc finger-like protein; Provisional 99.39
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 99.36
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.34
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.28
PF1463444 zf-RING_5: zinc-RING finger domain 99.26
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.22
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 99.21
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 99.2
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 99.05
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 99.03
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 99.0
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.92
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.9
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.86
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 98.86
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.83
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.79
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.74
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.73
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.71
COG52191525 Uncharacterized conserved protein, contains RING Z 98.69
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.62
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.61
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.59
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.54
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.43
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 98.32
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 98.32
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 98.31
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.17
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 98.14
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.12
KOG0297 391 consensus TNF receptor-associated factor [Signal t 98.06
KOG0825 1134 consensus PHD Zn-finger protein [General function 98.06
KOG4445 368 consensus Uncharacterized conserved protein, conta 98.03
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 98.02
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.0
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.99
KOG1941518 consensus Acetylcholine receptor-associated protei 97.88
PHA02862156 5L protein; Provisional 97.88
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 97.87
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 97.76
KOG2660 331 consensus Locus-specific chromosome binding protei 97.72
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.7
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 97.69
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 97.66
KOG1002 791 consensus Nucleotide excision repair protein RAD16 97.63
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.59
PHA02825162 LAP/PHD finger-like protein; Provisional 97.57
KOG4739 233 consensus Uncharacterized protein involved in syna 97.55
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.35
PHA03096284 p28-like protein; Provisional 97.32
KOG1940276 consensus Zn-finger protein [General function pred 97.26
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.24
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 97.2
COG5152259 Uncharacterized conserved protein, contains RING a 97.07
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 97.06
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.97
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 96.94
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.86
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 96.8
KOG03091081 consensus Conserved WD40 repeat-containing protein 96.79
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.78
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 96.77
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 96.72
PF04641260 Rtf2: Rtf2 RING-finger 96.68
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.57
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 96.48
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 96.46
PF10272358 Tmpp129: Putative transmembrane protein precursor; 96.35
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.33
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 96.27
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.24
COG5222 427 Uncharacterized conserved protein, contains RING Z 96.2
COG5175 480 MOT2 Transcriptional repressor [Transcription] 95.92
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 95.8
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 95.72
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 95.72
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 95.71
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 95.7
KOG3053 293 consensus Uncharacterized conserved protein [Funct 95.63
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 95.15
KOG4367 699 consensus Predicted Zn-finger protein [Function un 94.78
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 94.21
COG5109396 Uncharacterized conserved protein, contains RING Z 94.04
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 93.8
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 93.57
COG5236 493 Uncharacterized conserved protein, contains RING Z 93.56
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 93.44
KOG3899381 consensus Uncharacterized conserved protein [Funct 93.42
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 93.28
KOG0298 1394 consensus DEAD box-containing helicase-like transc 93.13
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 92.86
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 92.46
KOG3002 299 consensus Zn finger protein [General function pred 92.35
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 91.84
PF13901202 DUF4206: Domain of unknown function (DUF4206) 91.23
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 90.47
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 90.28
KOG4718235 consensus Non-SMC (structural maintenance of chrom 90.09
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 89.96
KOG1609 323 consensus Protein involved in mRNA turnover and st 89.75
PF0684468 DUF1244: Protein of unknown function (DUF1244); In 89.6
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 89.45
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 89.44
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 89.37
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 89.35
KOG0269839 consensus WD40 repeat-containing protein [Function 88.91
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 88.52
KOG1829580 consensus Uncharacterized conserved protein, conta 87.82
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 87.76
KOG3113 293 consensus Uncharacterized conserved protein [Funct 87.16
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 86.76
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 85.91
PLN02189 1040 cellulose synthase 85.52
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 85.35
PF0442354 Rad50_zn_hook: Rad50 zinc hook motif; InterPro: IP 85.11
PLN02436 1094 cellulose synthase A 83.62
PF1377190 zf-HC5HC2H: PHD-like zinc-binding domain 83.32
PF10497105 zf-4CXXC_R1: Zinc-finger domain of monoamine-oxida 82.2
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 81.96
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 81.73
COG5627275 MMS21 DNA repair protein MMS21 [DNA replication, r 80.62
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 80.29
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
Probab=99.84  E-value=2.5e-21  Score=99.97  Aligned_cols=57  Identities=67%  Similarity=1.749  Sum_probs=50.4

Q ss_pred             CCCCCcccccCcCCCCCCeEecCCCCcccHHHHHHHHHhCCCCCCCccccccccccC
Q 035446            1 MAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFKG   57 (59)
Q Consensus         1 ~~~~~~C~IC~~~~~~~~~~~~~C~H~fh~~Ci~~w~~~~~~~~~CP~Cr~~~~~~~   57 (59)
                      ++||+.||.|..++++.+++...|+|.||..||.+|+.+++++..||+||++|.+++
T Consensus        29 ~~fdg~Cp~Ck~Pgd~Cplv~g~C~H~FH~hCI~kWl~~~~~~~~CPmCR~~w~~k~   85 (85)
T PF12861_consen   29 MPFDGCCPDCKFPGDDCPLVWGKCSHNFHMHCILKWLSTQSSKGQCPMCRQPWKFKE   85 (85)
T ss_pred             cccccCCCCccCCCCCCceeeccCccHHHHHHHHHHHccccCCCCCCCcCCeeeeCC
Confidence            467888888888888999999999999999999999998655689999999998864



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4718 consensus Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1) [Chromatin structure and dynamics] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF06844 DUF1244: Protein of unknown function (DUF1244); InterPro: IPR009654 This family consists of several short bacterial proteins of around 100 residues in length Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04423 Rad50_zn_hook: Rad50 zinc hook motif; InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain Back     alignment and domain information
>PF10497 zf-4CXXC_R1: Zinc-finger domain of monoamine-oxidase A repressor R1; InterPro: IPR018866 R1 is a transcription factor repressor that inhibits monoamine oxidase A gene expression Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>COG5627 MMS21 DNA repair protein MMS21 [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query59
2lgv_A100 Rbx1 Length = 100 3e-07
4a0k_B117 Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A 12 Bp 3e-07
1u6g_B108 Crystal Structure Of The Cand1-Cul1-Roc1 Complex Le 3e-07
3dpl_R106 Structural Insights Into Nedd8 Activation Of Cullin 4e-07
4a0c_D98 Structure Of The Cand1-Cul4b-Rbx1 Complex Length = 4e-07
3dqv_R106 Structural Insights Into Nedd8 Activation Of Cullin 4e-07
1ldj_B90 Structure Of The Cul1-rbx1-skp1-f Boxskp2 Scf Ubiqu 5e-07
2ecl_A81 Solution Structure Of The Ring Domain Of The Human 4e-04
>pdb|2LGV|A Chain A, Rbx1 Length = 100 Back     alignment and structure

Iteration: 1

Score = 50.4 bits (119), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 19/44 (43%), Positives = 29/44 (65%), Gaps = 3/44 (6%) Query: 13 PGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFK 56 ++C + WG CNHAFH HCI +W+ ++ CP+ REW+F+ Sbjct: 56 TSEECTVAWGVCNHAFHFHCISRWLKTRQV---CPLDNREWEFQ 96
>pdb|4A0K|B Chain B, Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A 12 Bp Abasic Site Containing Dna-Duplex Length = 117 Back     alignment and structure
>pdb|1U6G|B Chain B, Crystal Structure Of The Cand1-Cul1-Roc1 Complex Length = 108 Back     alignment and structure
>pdb|3DPL|R Chain R, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation. Length = 106 Back     alignment and structure
>pdb|4A0C|D Chain D, Structure Of The Cand1-Cul4b-Rbx1 Complex Length = 98 Back     alignment and structure
>pdb|3DQV|R Chain R, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation Length = 106 Back     alignment and structure
>pdb|1LDJ|B Chain B, Structure Of The Cul1-rbx1-skp1-f Boxskp2 Scf Ubiquitin Ligase Complex Length = 90 Back     alignment and structure
>pdb|2ECL|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring-Box Protein 2 Length = 81 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query59
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 2e-13
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 9e-12
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 2e-11
3nw0_A238 Non-structural maintenance of chromosomes element 4e-07
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 1e-05
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 2e-05
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 3e-05
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 7e-05
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 1e-04
2ect_A78 Ring finger protein 126; metal binding protein, st 2e-04
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 2e-04
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-04
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 3e-04
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-04
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 4e-04
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 4e-04
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
 Score = 57.6 bits (139), Expect = 2e-13
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 1  MAFDGCCPDCKLPG--DDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFK 56
          +     C  C+     +DC ++WG CNH+FH  C+  WV        CP+C+++W  +
Sbjct: 23 VQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNN---RCPLCQQDWVVQ 77


>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query59
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.79
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.76
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.72
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.72
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.71
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.71
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.71
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.7
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.7
2ect_A78 Ring finger protein 126; metal binding protein, st 99.69
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.68
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.68
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.68
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.68
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.67
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.67
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.66
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.63
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.63
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.63
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.62
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.62
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.61
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.59
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.59
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.58
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.58
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.58
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.58
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.56
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.56
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.56
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.55
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.55
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.55
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.53
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.52
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.51
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.51
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.51
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.51
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.5
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.49
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.48
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.46
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.44
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.43
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.42
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.42
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.4
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.38
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.38
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.37
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.36
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 99.34
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.31
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.29
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.28
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.28
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.23
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.19
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.18
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.13
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 99.07
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.05
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 99.05
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.99
2ea5_A68 Cell growth regulator with ring finger domain prot 98.94
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.91
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.85
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.8
3nw0_A238 Non-structural maintenance of chromosomes element 98.68
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 97.34
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 96.5
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 96.49
1wil_A89 KIAA1045 protein; ring finger domain, structural g 95.97
2k16_A75 Transcription initiation factor TFIID subunit 3; p 95.21
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 95.13
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 94.39
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 94.16
1weu_A91 Inhibitor of growth family, member 4; structural g 93.91
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 93.81
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 93.77
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 93.46
2yt5_A66 Metal-response element-binding transcription facto 93.36
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 93.13
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 93.12
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 92.78
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 92.56
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 92.25
3o36_A 184 Transcription intermediary factor 1-alpha; TRIM24, 92.15
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 91.88
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 91.64
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 90.53
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 90.48
1we9_A64 PHD finger family protein; structural genomics, PH 90.29
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 90.13
3o70_A68 PHD finger protein 13; PHF13, structural genomics 90.05
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 89.73
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 89.67
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 89.34
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 89.08
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 89.05
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 89.03
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 88.84
1wem_A76 Death associated transcription factor 1; structura 88.67
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 88.64
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 88.16
2ro1_A 189 Transcription intermediary factor 1-beta; KAP, TIF 87.18
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 87.14
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 86.84
2o35_A105 Hypothetical protein DUF1244; helix bundle, struct 86.81
3fyb_A104 Protein of unknown function (DUF1244); hydrocar de 86.74
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 86.59
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 86.45
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 86.34
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 86.34
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 86.26
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 86.26
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 86.03
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 85.95
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 85.61
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 85.46
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 85.22
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 85.18
1z60_A59 TFIIH basal transcription factor complex P44 subun 84.6
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 84.18
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 83.27
2ri7_A 174 Nucleosome-remodeling factor subunit BPTF; zinc fi 82.77
3f6q_B72 LIM and senescent cell antigen-like-containing dom 82.26
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 82.09
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 81.5
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 81.2
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 80.89
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 80.82
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 80.53
3lqh_A 183 Histone-lysine N-methyltransferase MLL; PHD finger 80.43
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.79  E-value=1e-19  Score=92.44  Aligned_cols=51  Identities=35%  Similarity=1.090  Sum_probs=40.9

Q ss_pred             CCcccccCcCCC-------------CCCeEecCCCCcccHHHHHHHHHhCCCCCCCccccccccccC
Q 035446            4 DGCCPDCKLPGD-------------DCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFKG   57 (59)
Q Consensus         4 ~~~C~IC~~~~~-------------~~~~~~~~C~H~fh~~Ci~~w~~~~~~~~~CP~Cr~~~~~~~   57 (59)
                      ++.|+||++.+.             +.++++++|+|.||.+||.+|++.+   .+||+||+++.+++
T Consensus        15 ~~~C~IC~~~~~~~C~iC~~~~~~~~~~~~~~~C~H~FH~~Ci~~Wl~~~---~~CP~CR~~~~~~~   78 (81)
T 2ecl_A           15 CDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQN---NRCPLCQQDWVVQR   78 (81)
T ss_dssp             CSCBTTTTBCTTSCCTTHHHHTCTTTCCEEEETTSCEEEHHHHHHHTTTC---CBCTTTCCBCCEEE
T ss_pred             CCCCcccChhhhccCcccccccCCCceEEEeCCCCCccChHHHHHHHHhC---CCCCCcCCCcchhh
Confidence            567888876443             2255666799999999999999987   79999999988764



>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2o35_A Hypothetical protein DUF1244; helix bundle, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.12A {Sinorhizobium meliloti} SCOP: a.293.1.1 Back     alignment and structure
>3fyb_A Protein of unknown function (DUF1244); hydrocar degrading, structural genomics, PSI-2; HET: PEG; 1.80A {Alcanivorax borkumensis SK2} Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 59
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 3e-07
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 7e-05
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 0.001
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 0.002
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 0.004
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 0.004
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.9 bits (95), Expect = 3e-07
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 6  CCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFK 56
                   ++C + WG CNHAFH HCI +W+ +   +  CP+  REW+F+
Sbjct: 39 QANQASATSEECTVAWGVCNHAFHFHCISRWLKT---RQVCPLDNREWEFQ 86


>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query59
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.78
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.77
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.75
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.75
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.74
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.72
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.67
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.65
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.62
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.61
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.55
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.49
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.47
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.47
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.45
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.22
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.89
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 96.25
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 95.81
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 95.52
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 94.96
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 94.76
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 94.76
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 94.28
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 93.31
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 92.26
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 91.96
d1wema_76 Death associated transcription factor 1, Datf1 (DI 91.02
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 90.78
d2o35a179 Hypothetical protein SMc04008 {Rhizobium meliloti 89.19
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 88.09
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 82.29
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.78  E-value=7.8e-20  Score=86.37  Aligned_cols=49  Identities=27%  Similarity=0.628  Sum_probs=38.8

Q ss_pred             CCCcccccCcCCC--CCCeEecCCCCcccHHHHHHHHHhCCCCCCCcccccccc
Q 035446            3 FDGCCPDCKLPGD--DCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQ   54 (59)
Q Consensus         3 ~~~~C~IC~~~~~--~~~~~~~~C~H~fh~~Ci~~w~~~~~~~~~CP~Cr~~~~   54 (59)
                      -+..|+||++++.  +....++.|+|.||..||.+|++++   .+||+||+++.
T Consensus         4 d~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~---~~CP~CR~~i~   54 (55)
T d1iyma_           4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSH---STCPLCRLTVV   54 (55)
T ss_dssp             CSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTC---CSCSSSCCCSC
T ss_pred             CCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhC---CcCCCCCCEeE
Confidence            3467999997544  2334445799999999999999886   78999999864



>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d2o35a1 a.293.1.1 (A:2-80) Hypothetical protein SMc04008 {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure