Query         035456
Match_columns 58
No_of_seqs    106 out of 645
Neff          4.7 
Searched_HMMs 29240
Date          Mon Mar 25 04:25:34 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035456.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/035456hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1b75_A Protein (50S ribosomal   16.1      18 0.00061   20.6  -1.1    9   43-51     24-32  (94)
  2 2q0o_C Probable transcriptiona  11.8      94  0.0032   18.9   1.3   19   30-48     83-101 (107)
  3 1wfw_A Kalirin-9A; SH3 domain,  11.3      40  0.0014   19.4  -0.5    7   43-49     58-64  (74)
  4 2hjd_A Quorum-sensing antiacti  10.1 1.3E+02  0.0044   18.1   1.5   18   31-48     82-99  (102)
  5 1rfy_A TRAM protein;, transcri  10.0 1.3E+02  0.0044   18.1   1.5   18   31-48     82-99  (102)
  6 1oed_C Acetylcholine receptor    7.0 5.1E+02   0.018   17.0   3.6   27   11-42     18-44  (260)
  7 1oed_B Acetylcholine receptor    6.6 5.9E+02    0.02   16.6   3.8   28   10-42     17-44  (250)
  8 2ki9_A Cannabinoid receptor 2;   6.4 1.6E+02  0.0056   12.8   0.6   21   32-52      7-27  (33)
  9 4dgl_A Casein kinase II subuni   6.3      75  0.0026   21.2  -0.8   14   44-57     78-91  (215)
 10 1qf8_A Casein kinase II; casei   5.7      85  0.0029   20.3  -0.8   13   45-57     79-91  (182)

No 1  
>1b75_A Protein (50S ribosomal protein L25); RNA-binding protein, RNA binding protein; NMR {Escherichia coli} SCOP: b.53.1.1 PDB: 1d6k_A 1dfu_P 1giy_V 1ml5_v* 1p85_T 1p86_T 1vs6_V 1vs8_V 1vt2_V 2aw4_V 2awb_V 2gya_T 2gyc_T 2i2t_V 2i2v_V 2j28_V 2qam_V* 2qao_V* 2qba_V* 2qbc_V* ...
Probab=16.08  E-value=18  Score=20.62  Aligned_cols=9  Identities=44%  Similarity=0.877  Sum_probs=6.7

Q ss_pred             Hhhhhhhhh
Q 035456           43 GYIPGIIYA   51 (58)
Q Consensus        43 g~iPg~IhA   51 (58)
                      |.+||++|.
T Consensus        24 G~vPaVvYG   32 (94)
T 1b75_A           24 NKFPAIIYG   32 (94)
T ss_dssp             TBCCEEEEC
T ss_pred             CCceEEEEC
Confidence            678888874


No 2  
>2q0o_C Probable transcriptional repressor TRAM; helix-turn-helix, two-helix coiled coil; HET: LAE; 2.00A {Rhizobium SP}
Probab=11.81  E-value=94  Score=18.89  Aligned_cols=19  Identities=16%  Similarity=0.424  Sum_probs=15.7

Q ss_pred             chhHHHHHHHHHHHhhhhh
Q 035456           30 KVEFWICLLLTIFGYIPGI   48 (58)
Q Consensus        30 ~~~~~inllLtllg~iPg~   48 (58)
                      ..+.-+|-++-.|||+|-+
T Consensus        83 AQq~~lstLid~LGyvPkV  101 (107)
T 2q0o_C           83 AQQEELSDILDALGFVPDV  101 (107)
T ss_dssp             HHHHHHHHHHHHHCSCCCC
T ss_pred             HHHHHHHHHHHHhcCCCCC
Confidence            3567899999999999964


No 3  
>1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1
Probab=11.28  E-value=40  Score=19.37  Aligned_cols=7  Identities=57%  Similarity=1.436  Sum_probs=5.6

Q ss_pred             Hhhhhhh
Q 035456           43 GYIPGII   49 (58)
Q Consensus        43 g~iPg~I   49 (58)
                      ||+||.+
T Consensus        58 gWvPG~v   64 (74)
T 1wfw_A           58 GWVPGSI   64 (74)
T ss_dssp             EEEEGGG
T ss_pred             CcccccE
Confidence            6888876


No 4  
>2hjd_A Quorum-sensing antiactivator; helix coiled coil, signaling protein; 2.10A {Agrobacterium tumefaciens}
Probab=10.13  E-value=1.3e+02  Score=18.13  Aligned_cols=18  Identities=22%  Similarity=0.462  Sum_probs=14.9

Q ss_pred             hhHHHHHHHHHHHhhhhh
Q 035456           31 VEFWICLLLTIFGYIPGI   48 (58)
Q Consensus        31 ~~~~inllLtllg~iPg~   48 (58)
                      ...-+|-++-++||+|-+
T Consensus        82 Qq~~lstli~~LGyvP~v   99 (102)
T 2hjd_A           82 QMSAVNTLVGLLGFIPKV   99 (102)
T ss_dssp             HHHHHHHHHHHHTSCCCC
T ss_pred             HHHHHHHHHHHhcCCCCC
Confidence            456789999999999964


No 5  
>1rfy_A TRAM protein;, transcriptional repressor TRAM; inter- and intra-molcular two-helix coiled coil, homodimer; 1.60A {Agrobacterium tumefaciens} SCOP: a.2.13.1 PDB: 1us6_A 1upg_A
Probab=10.04  E-value=1.3e+02  Score=18.11  Aligned_cols=18  Identities=28%  Similarity=0.545  Sum_probs=14.4

Q ss_pred             hhHHHHHHHHHHHhhhhh
Q 035456           31 VEFWICLLLTIFGYIPGI   48 (58)
Q Consensus        31 ~~~~inllLtllg~iPg~   48 (58)
                      ...-+|-++-++||+|-+
T Consensus        82 Qq~~lstli~~LGyvP~v   99 (102)
T 1rfy_A           82 QMSALNTLISILGFIPKV   99 (102)
T ss_dssp             HHHHHHHHHHHHTSCCC-
T ss_pred             HHHHHHHHHHHhcCCCCC
Confidence            456789999999999964


No 6  
>1oed_C Acetylcholine receptor protein, delta chain; ION channel/receptor, ION channel, tubular crystal, transmembrane; 4.0A {Torpedo marmorata} SCOP: f.36.1.1 PDB: 1a11_A 1cek_A 1eq8_A
Probab=7.03  E-value=5.1e+02  Score=17.04  Aligned_cols=27  Identities=33%  Similarity=0.242  Sum_probs=14.6

Q ss_pred             HHHHHHhhchhHHHhHhccchhHHHHHHHHHH
Q 035456           11 DIILAIILPPLGVFLKFGCKVEFWICLLLTIF   42 (58)
Q Consensus        11 ~~ilai~lPPlaV~l~~G~~~~~~inllLtll   42 (58)
                      +.++.+.+||=     .|-...+-++.+|++.
T Consensus        18 ls~~~F~Lp~~-----~gekv~l~it~lLs~t   44 (260)
T 1oed_C           18 LASLAFYLPAE-----SGEKMSTAISVLLAQA   44 (260)
T ss_dssp             HHHHHHHHHHH-----CTTCHHHHHHHHHHHH
T ss_pred             HHHHHeeeCCC-----CCCeEeehHHHHHHHH
Confidence            44556667762     3444555566666443


No 7  
>1oed_B Acetylcholine receptor protein, beta chain; ION channel/receptor, ION channel, tubular crystal, transmembrane; 4.0A {Torpedo marmorata} SCOP: f.36.1.1 PDB: 2k58_B
Probab=6.56  E-value=5.9e+02  Score=16.63  Aligned_cols=28  Identities=39%  Similarity=0.479  Sum_probs=14.2

Q ss_pred             HHHHHHHhhchhHHHhHhccchhHHHHHHHHHH
Q 035456           10 IDIILAIILPPLGVFLKFGCKVEFWICLLLTIF   42 (58)
Q Consensus        10 ~~~ilai~lPPlaV~l~~G~~~~~~inllLtll   42 (58)
                      .+-++.+.+||=     .|-...+-++.+|++.
T Consensus        17 ~ls~~~F~Lp~d-----sgerv~l~it~lLs~t   44 (250)
T 1oed_B           17 ILAILVFYLPPD-----AGEKMSLSISALLAVT   44 (250)
T ss_dssp             HHHHHHHHHHHH-----CGGGHHHHHHHHHHHH
T ss_pred             HHHHHHheeCCC-----CCCeEEehhhHHHHHH
Confidence            344556677772     2434445555555433


No 8  
>2ki9_A Cannabinoid receptor 2; GPCR, G-protein coupled receptor, membrane protein; NMR {Synthetic}
Probab=6.35  E-value=1.6e+02  Score=12.85  Aligned_cols=21  Identities=10%  Similarity=0.265  Sum_probs=12.4

Q ss_pred             hHHHHHHHHHHHhhhhhhhhe
Q 035456           32 EFWICLLLTIFGYIPGIIYAV   52 (58)
Q Consensus        32 ~~~inllLtllg~iPg~IhA~   52 (58)
                      -..+-+...++.|.|-.+..+
T Consensus         7 ~l~~vv~~F~icW~P~~i~~~   27 (33)
T 2ki9_A            7 TLGLVLAVLLICWFPVLALMA   27 (33)
T ss_dssp             HHHHHHHHHTTTSSHHHHHHT
T ss_pred             hHHHHHHHHHHHHhHHHHHHH
Confidence            344455556777888655443


No 9  
>4dgl_A Casein kinase II subunit beta; protein kinase, transferase; 3.00A {Homo sapiens} PDB: 2r6m_A 1jwh_C 1ds5_E*
Probab=6.33  E-value=75  Score=21.23  Aligned_cols=14  Identities=36%  Similarity=0.577  Sum_probs=10.4

Q ss_pred             hhhhhhhheeeeec
Q 035456           44 YIPGIIYAVYAITK   57 (58)
Q Consensus        44 ~iPg~IhA~yii~~   57 (58)
                      -+=|+|||=|++.+
T Consensus        78 ~LYGLIHARYIlT~   91 (215)
T 4dgl_A           78 MLYGLIHARYILTN   91 (215)
T ss_dssp             HHHHHHHHHHTTSH
T ss_pred             HHhhhhhHhheecH
Confidence            35589999888753


No 10 
>1qf8_A Casein kinase II; casein kinase beta subunit (1-182), Ser/Thr protein kinase, Zn finger, transferase; HET: MSE; 1.74A {Homo sapiens} SCOP: g.41.4.1 PDB: 3eed_A 1rqf_A
Probab=5.74  E-value=85  Score=20.32  Aligned_cols=13  Identities=38%  Similarity=0.626  Sum_probs=9.7

Q ss_pred             hhhhhhheeeeec
Q 035456           45 IPGIIYAVYAITK   57 (58)
Q Consensus        45 iPg~IhA~yii~~   57 (58)
                      +=|+|||=|++.+
T Consensus        79 LYGLIHaRyIlT~   91 (182)
T 1qf8_A           79 LYGLIHARYILTN   91 (182)
T ss_dssp             HHHHHHHHHTTSH
T ss_pred             HhchhhhhhcccH
Confidence            5588999887653


Done!