BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035465
(60 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q6CHT7|COA3_YARLI Cytochrome c oxidase assembly protein 3, mitochondrial
OS=Yarrowia lipolytica (strain CLIB 122 / E 150)
GN=COA3 PE=3 SV=1
Length = 106
Score = 29.6 bits (65), Expect = 5.6, Method: Compositional matrix adjust.
Identities = 14/44 (31%), Positives = 24/44 (54%)
Query: 15 KNLVVAGGLTAFVFGVYYYTMRAVGGTDELQAAIDKFEEQKNKQ 58
+N++ GLT FV G+Y YTM ++ D I + ++ K+
Sbjct: 52 RNMLALAGLTGFVAGIYGYTMYSLRTDDFGDVPIPPLDPEEIKK 95
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.318 0.134 0.378
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21,727,843
Number of Sequences: 539616
Number of extensions: 634481
Number of successful extensions: 1452
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1451
Number of HSP's gapped (non-prelim): 1
length of query: 60
length of database: 191,569,459
effective HSP length: 33
effective length of query: 27
effective length of database: 173,762,131
effective search space: 4691577537
effective search space used: 4691577537
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)