Citrus Sinensis ID: 035470


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--
MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSW
cccccEEEEEEEcccccEEEEEEcccccccEEEEEEEEEccEEEEEEEccccCEEEEccccc
***GRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYS****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRGRVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTDSW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
MADS-box transcription factor 14 Probable transcription factor. May be involved in the control of flowering time.probableQ10CQ1
Agamous-like MADS-box protein AGL8 Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique. Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND.probableQ38876
Floral homeotic protein APETALA 1 Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins.probableD7KWY6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MNM, chain A
Confidence level:very confident
Coverage over the Query: 1-62
View the alignment between query and template
View the model in PyMOL