BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035491
(292 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4F67|A Chain A, Three Dimensional Structure Of The Double Mutant Of
Upf0176 Protein Lpg2838 From Legionella Pneumophila At
The Resolution 1.8a, Northeast Structural Genomics
Consortium (Nesg) Target Lgr82
Length = 265
Score = 29.3 bits (64), Expect = 2.4, Method: Compositional matrix adjust.
Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
Query: 49 EIWEKFMMSWNVLLLSSSED---EFITRLNALQQDFISYPQTIEYVTSTWLDK 98
E W +F+ NV+LL + D E T NA+ D ++ + +YV +DK
Sbjct: 127 EEWHQFIQDPNVILLDTRNDYEYELGTFKNAINPDIENFREFPDYVQRNLIDK 179
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.132 0.387
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,133,681
Number of Sequences: 62578
Number of extensions: 306163
Number of successful extensions: 743
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 743
Number of HSP's gapped (non-prelim): 2
length of query: 292
length of database: 14,973,337
effective HSP length: 98
effective length of query: 194
effective length of database: 8,840,693
effective search space: 1715094442
effective search space used: 1715094442
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)