BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035542
(300 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2HYX|A Chain A, Structure Of The C-Terminal Domain Of Dipz From
Mycobacterium Tuberculosis
pdb|2HYX|B Chain B, Structure Of The C-Terminal Domain Of Dipz From
Mycobacterium Tuberculosis
pdb|2HYX|C Chain C, Structure Of The C-Terminal Domain Of Dipz From
Mycobacterium Tuberculosis
pdb|2HYX|D Chain D, Structure Of The C-Terminal Domain Of Dipz From
Mycobacterium Tuberculosis
Length = 352
Score = 30.8 bits (68), Expect = 0.95, Method: Compositional matrix adjust.
Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 3/37 (8%)
Query: 83 NLHFREARVFLAVMKDLLTVKGMINAQNAILSGCSAG 119
NL+F+ + +++ L + G++NAQNA LS CS G
Sbjct: 14 NLYFQSGAM---EIREQLNLGGIVNAQNAQLSNCSDG 47
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.138 0.445
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,166,747
Number of Sequences: 62578
Number of extensions: 377256
Number of successful extensions: 927
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 926
Number of HSP's gapped (non-prelim): 1
length of query: 300
length of database: 14,973,337
effective HSP length: 98
effective length of query: 202
effective length of database: 8,840,693
effective search space: 1785819986
effective search space used: 1785819986
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)