Query         035573
Match_columns 95
No_of_seqs    42 out of 44
Neff          2.7 
Searched_HMMs 46136
Date          Fri Mar 29 04:10:10 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035573.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035573hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02349 glycerol-3-phosphate  100.0 2.3E-32   5E-37  226.4   3.1   77   11-87    116-192 (426)
  2 PF14829 GPAT_N:  Glycerol-3-ph  99.5   1E-14 2.2E-19   98.9   2.8   34   12-45     44-77  (77)
  3 cd05502 Bromo_tif1_like Bromod  71.3     2.2 4.7E-05   28.7   1.1   44   22-66      9-52  (109)
  4 smart00394 RIIa RIIalpha, Regu  66.1     3.4 7.5E-05   23.4   1.0   18   56-73     18-35  (38)
  5 cd05499 Bromo_BDF1_2_II Bromod  57.9       7 0.00015   25.8   1.5   19   46-64     34-52  (102)
  6 PF02156 Glyco_hydro_26:  Glyco  53.2      12 0.00027   29.9   2.5   47    7-54    113-162 (311)
  7 COG2987 HutU Urocanate hydrata  50.9     8.5 0.00019   34.3   1.3   30   56-85    338-367 (561)
  8 PF12069 DUF3549:  Protein of u  50.0     8.3 0.00018   32.1   1.1   35   36-72    113-159 (340)
  9 cd05529 Bromo_WDR9_I_like Brom  45.2      20 0.00044   25.0   2.3   46   18-63     21-74  (128)
 10 cd05501 Bromo_SP100C_like Brom  42.5      15 0.00032   25.4   1.3   43   21-65      6-48  (102)
 11 cd05508 Bromo_RACK7 Bromodomai  40.0      20 0.00044   24.2   1.6   23   43-65     28-50  (99)
 12 cd05517 Bromo_polybromo_II Bro  39.7      37 0.00081   22.8   2.9   26   36-61     25-50  (103)
 13 cd05495 Bromo_cbp_like Bromodo  39.0      46 0.00099   22.5   3.2   39   27-65      5-54  (108)
 14 PLN02999 photosystem II oxygen  35.8      30 0.00065   27.2   2.1   33    4-37    123-156 (190)
 15 cd05528 Bromo_AAA Bromodomain;  34.6      23  0.0005   24.3   1.2   22   42-63     28-49  (112)
 16 cd05498 Bromo_Brdt_II_like Bro  32.7      34 0.00073   22.4   1.7   18   47-64     35-52  (102)
 17 cd05524 Bromo_polybromo_I Brom  31.6      67  0.0015   21.9   3.1   27   37-63     28-54  (113)
 18 cd05518 Bromo_polybromo_IV Bro  31.3      37 0.00079   23.0   1.8   22   42-63     31-52  (103)
 19 TIGR02159 PA_CoA_Oxy4 phenylac  28.6      21 0.00045   26.0   0.2    7   55-61    137-143 (146)
 20 smart00297 BROMO bromo domain.  28.4      59  0.0013   20.6   2.3   23   43-65     33-55  (107)
 21 cd05515 Bromo_polybromo_V Brom  28.2      32  0.0007   23.0   1.1   28   37-64     26-53  (105)
 22 cd05511 Bromo_TFIID Bromodomai  28.0      28  0.0006   23.8   0.7   29   37-65     20-48  (112)
 23 PF05757 PsbQ:  Oxygen evolving  27.1      81  0.0018   24.5   3.2   32    4-36    135-167 (202)
 24 cd05505 Bromo_WSTF_like Bromod  25.2      25 0.00054   23.5   0.1   22   43-64     26-47  (97)
 25 PF08165 FerA:  FerA (NUC095) d  24.8      80  0.0017   20.3   2.4   18   24-45     14-31  (66)
 26 cd05496 Bromo_WDR9_II Bromodom  24.7      17 0.00037   25.4  -0.8   24   42-65     30-53  (119)
 27 cd05519 Bromo_SNF2 Bromodomain  23.5      57  0.0012   21.6   1.6   26   36-61     25-50  (103)
 28 cd05510 Bromo_SPT7_like Bromod  23.5      54  0.0012   22.6   1.5   27   38-64     29-55  (112)
 29 cd05507 Bromo_brd8_like Bromod  22.8      73  0.0016   21.3   2.0   27   38-64     24-50  (104)
 30 cd05503 Bromo_BAZ2A_B_like Bro  22.8      39 0.00084   22.2   0.7   27   39-65     22-48  (97)
 31 PF07914 DUF1679:  Protein of u  22.3 1.1E+02  0.0023   25.5   3.2   67    3-72    302-374 (414)
 32 PLN02729 PSII-Q subunit         21.3      77  0.0017   25.5   2.1   33    4-37    153-186 (220)
 33 cd05516 Bromo_SNF2L2 Bromodoma  21.1 1.1E+02  0.0024   20.5   2.7   27   38-64     28-54  (107)
 34 PF14757 NSP2-B_epitope:  Immun  20.2      57  0.0012   26.9   1.2   35    8-44    216-256 (272)

No 1  
>PLN02349 glycerol-3-phosphate acyltransferase
Probab=99.97  E-value=2.3e-32  Score=226.37  Aligned_cols=77  Identities=58%  Similarity=0.946  Sum_probs=73.0

Q ss_pred             hhhhhhcCCcchhHHHHHhHHHHHHHHHhccCCCcccCcccccccCCchhhHhhhhhhhhccccCcchheeeeeeec
Q 035573           11 MFQVFQSGNSRADEIVLSNMAVAFDRVLLDIEEPFTFSSYHKSMREPFDYYMFGQNYIRPLVDFRLANDFYAILIHQ   87 (95)
Q Consensus        11 ~~AV~~Sg~p~A~e~vl~nM~~~lDrvlldvedPF~F~pyHkaiRePfDYY~FGq~YIrpLVDf~nS~~~y~~~~~~   87 (95)
                      -+||++||+|+|+|++++||+.+||||++|+++||+||||||+||||||||+|||+||||||||+||+|.+.-++.+
T Consensus       116 ~~Av~~sg~~~a~e~~~~~m~~~~d~v~~~~~~Pf~F~~~Hkair~pfDyY~fg~~yirpLiDf~~S~v~~~~~~~~  192 (426)
T PLN02349        116 KNAVLSSGAPNADEIVVSNMASILDRVLLGVEDPFTFPPYHKALREPFDYYMFGQNYIRPLIDFRNSYLGNRSRFDK  192 (426)
T ss_pred             HHHHHhcCCCCchHHHHHHHHHHHHHHHHhccCCccCChHHHhhcCcccHHHHHHHHHHHHhhcccceecCHHHHHH
Confidence            48999999999999999999999999999999999999999999999999999999999999999999988655544


No 2  
>PF14829 GPAT_N:  Glycerol-3-phosphate acyltransferase N-terminal; PDB: 1IUQ_A 1K30_A.
Probab=99.50  E-value=1e-14  Score=98.95  Aligned_cols=34  Identities=74%  Similarity=1.064  Sum_probs=30.8

Q ss_pred             hhhhhcCCcchhHHHHHhHHHHHHHHHhccCCCc
Q 035573           12 FQVFQSGNSRADEIVLSNMAVAFDRVLLDIEEPF   45 (95)
Q Consensus        12 ~AV~~Sg~p~A~e~vl~nM~~~lDrvlldvedPF   45 (95)
                      |||+|||+|+|+|+||+||+++||||++|+|+||
T Consensus        44 ~AVl~Sg~p~A~eivlsnm~~~~Drvlldve~PF   77 (77)
T PF14829_consen   44 NAVLQSGDPNADEIVLSNMAVALDRVLLDVEDPF   77 (77)
T ss_dssp             HHHHHTT-TTHHHHHHHHHHHHHHHHHHHHHS--
T ss_pred             HHHHhCCCCCccHHHHHHHHHHHHHHHHcccCCC
Confidence            8999999999999999999999999999999998


No 3  
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily. Tif1 (transcription intermediary factor 1) is a member of the tripartite motif (TRIM) protein family, which is characterized by a particular domain architecture. It functions by recruiting coactivators and/or corepressors to modulate transcription. Vertebrate Tif1-gamma, also labeled E3 ubiquitin-protein ligase TRIM33, plays a role in the control of hematopoiesis. Its homologue in Xenopus laevis, Ectodermin, has been shown to function in germ-layer specification and control of cell growth during embryogenesis. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=71.32  E-value=2.2  Score=28.68  Aligned_cols=44  Identities=14%  Similarity=0.338  Sum_probs=27.7

Q ss_pred             hhHHHHHhHHHHHHHHHhccCCCcccCcccccccCCchhhHhhhh
Q 035573           22 ADEIVLSNMAVAFDRVLLDIEEPFTFSSYHKSMREPFDYYMFGQN   66 (95)
Q Consensus        22 A~e~vl~nM~~~lDrvlldvedPF~F~pyHkaiRePfDYY~FGq~   66 (95)
                      +.+++.+.|..=....+.+-.+| .+|-|++.|+.|.|+=+..++
T Consensus         9 c~~il~~l~~~~~s~~F~~pv~~-~~p~Y~~iI~~PmdL~tI~~k   52 (109)
T cd05502           9 CERLLLELYCHELSLPFHEPVSP-SVPNYYKIIKTPMDLSLIRKK   52 (109)
T ss_pred             HHHHHHHHHhCCCChhhcCCCCC-CCCCHHHHCCCCccHHHHHHH
Confidence            33444443332223556666677 789999999999997655443


No 4  
>smart00394 RIIa RIIalpha, Regulatory subunit portion of type II PKA R-subunit. RIIalpha, Regulatory subunit portion of type II PKA R-subunit. Contains dimerisation interface and binding site for A-kinase-anchoring proteins (AKAPs).
Probab=66.09  E-value=3.4  Score=23.38  Aligned_cols=18  Identities=28%  Similarity=0.593  Sum_probs=15.8

Q ss_pred             CCchhhHhhhhhhhhccc
Q 035573           56 EPFDYYMFGQNYIRPLVD   73 (95)
Q Consensus        56 ePfDYY~FGq~YIrpLVD   73 (95)
                      .|-|.++|+.+|+.+|-.
T Consensus        18 qP~d~~~f~~~yF~kL~~   35 (38)
T smart00394       18 QPSDLVQFAADYFEKLEE   35 (38)
T ss_pred             CCCcHHHHHHHHHHHHHH
Confidence            699999999999988754


No 5  
>cd05499 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfamily, restricted to fungi, repeat II. BDF1 and BDF2 are yeast transcription factors involved in the expression of a wide range of genes, including snRNAs; they are required for sporulation and DNA repair and protect histone H4 from deacetylation. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=57.88  E-value=7  Score=25.79  Aligned_cols=19  Identities=16%  Similarity=0.455  Sum_probs=15.8

Q ss_pred             ccCcccccccCCchhhHhh
Q 035573           46 TFSSYHKSMREPFDYYMFG   64 (95)
Q Consensus        46 ~F~pyHkaiRePfDYY~FG   64 (95)
                      .+|-|++.|+.|.|+=+..
T Consensus        34 ~~pdY~~~I~~P~dL~~I~   52 (102)
T cd05499          34 NIPNYFSIIKKPMDLGTIS   52 (102)
T ss_pred             CCCCHHHHhcCCCCHHHHH
Confidence            7888999999999976544


No 6  
>PF02156 Glyco_hydro_26:  Glycosyl hydrolase family 26;  InterPro: IPR022790 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 26 GH26 from CAZY encompasses mainly mannan endo-1,4-beta-mannosidases (3.2.1.78 from EC). Mannan endo-1,4-beta-mannosidase hydrolyses mannan and galactomannan, but displays little activity towards other plant cell wall polysaccharides []. The enzyme randomly hydrolyses 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans and galactoglucomannans.  This entry also incoporates the enzyme Endogluconase H 3.2.1.4 from EC catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans. ; GO: 0008810 cellulase activity, 0016985 mannan endo-1,4-beta-mannosidase activity, 0006080 substituted mannan metabolic process; PDB: 2QHA_A 3CBW_A 2WHK_A 2VI0_A 2BVD_A 2BV9_A 2CIT_A 2V3G_A 2CIP_A 2X2Y_B ....
Probab=53.25  E-value=12  Score=29.94  Aligned_cols=47  Identities=15%  Similarity=0.389  Sum_probs=29.3

Q ss_pred             chhhhhhhhhcCCcchhHHHHHhHHHHHHHHHhccCC---CcccCcccccc
Q 035573            7 LAYDMFQVFQSGNSRADEIVLSNMAVAFDRVLLDIEE---PFTFSSYHKSM   54 (95)
Q Consensus         7 ~~~~~~AV~~Sg~p~A~e~vl~nM~~~lDrvlldved---PF~F~pyHkai   54 (95)
                      ...|.++++.+|.....+..++.|..+ ...+.++++   |-.|-|+|+.=
T Consensus       113 t~~~~~~~l~~~~t~~~~~~~~~ld~i-A~~l~~l~~~~vPVl~Rp~HE~n  162 (311)
T PF02156_consen  113 TTFDISKILTGGPTAEYEAFKADLDRI-ADFLKQLKDAGVPVLFRPFHEMN  162 (311)
T ss_dssp             TCHHHHHHCCTTTSHCHHHHHHHHHHH-HHHHHHHHCTTS-EEEEESTSTT
T ss_pred             CHHHHHHHhCCCChHHHHHHHHHHHHH-HHHHHHhhcCCCeEEEeehhhcC
Confidence            346788888877334446666644432 233444554   99999999975


No 7  
>COG2987 HutU Urocanate hydratase [Amino acid transport and metabolism]
Probab=50.86  E-value=8.5  Score=34.30  Aligned_cols=30  Identities=30%  Similarity=0.390  Sum_probs=21.8

Q ss_pred             CCchhhHhhhhhhhhccccCcchheeeeee
Q 035573           56 EPFDYYMFGQNYIRPLVDFRLANDFYAILI   85 (95)
Q Consensus        56 ePfDYY~FGq~YIrpLVDf~nS~~~y~~~~   85 (95)
                      ++||+=-|--+|||||.+-..--.|++-|-
T Consensus       338 ~aF~fPgfVpayIrPLFc~G~GPFRW~aLS  367 (561)
T COG2987         338 NAFDFPGFVPAYIRPLFCEGIGPFRWVALS  367 (561)
T ss_pred             ccccCCcchHHhhhhhhhcCcCCeeEEEec
Confidence            334444478899999999888877877663


No 8  
>PF12069 DUF3549:  Protein of unknown function (DUF3549);  InterPro: IPR021936  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 340 amino acids in length. This protein has a conserved LDE sequence motif. 
Probab=49.96  E-value=8.3  Score=32.13  Aligned_cols=35  Identities=31%  Similarity=0.680  Sum_probs=26.9

Q ss_pred             HHHhccCCCcccCc-------cccccc-----CCchhhHhhhhhhhhcc
Q 035573           36 RVLLDIEEPFTFSS-------YHKSMR-----EPFDYYMFGQNYIRPLV   72 (95)
Q Consensus        36 rvlldvedPF~F~p-------yHkaiR-----ePfDYY~FGq~YIrpLV   72 (95)
                      .-+.|  |||+|-|       ||-.+|     .|=-||+..+.|+.-=.
T Consensus       113 ~~L~~--NPy~FkP~~~klA~fhA~v~~~L~~p~S~yye~a~~Ylsg~~  159 (340)
T PF12069_consen  113 QKLAD--NPYTFKPSQEKLAMFHAQVRAQLGQPASQYYEHAQAYLSGQL  159 (340)
T ss_pred             HHhcc--CCcccCCChHHHHHHHHHHHHHcCCCcchhHHHHHHHHcCCc
Confidence            44555  9999999       555555     78899999999997543


No 9  
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily. WDR9 is a human gene located in the Down Syndrome critical region-2 of chromosome 21. It encodes for a nuclear protein containing WD40 repeats and two bromodomains, which may function as a transcriptional regulator involved in chromatin remodeling and play a role in embryonic development. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=45.24  E-value=20  Score=25.04  Aligned_cols=46  Identities=11%  Similarity=0.075  Sum_probs=28.5

Q ss_pred             CCcchhHHHHHhHHHHHHHHH-------hccCCCc-ccCcccccccCCchhhHh
Q 035573           18 GNSRADEIVLSNMAVAFDRVL-------LDIEEPF-TFSSYHKSMREPFDYYMF   63 (95)
Q Consensus        18 g~p~A~e~vl~nM~~~lDrvl-------ldvedPF-~F~pyHkaiRePfDYY~F   63 (95)
                      +.+.+.+.|++.+..+++..-       ....+|- .+|-|.+.|+.|.|+=+.
T Consensus        21 ~~~~~~~~i~~~l~~l~~~~~~~~~~~F~~pv~~~~~~p~Y~~iI~~PmdL~tI   74 (128)
T cd05529          21 IRDEERERLISGLDKLLLSLQLEIAEYFEYPVDLRAWYPDYWNRVPVPMDLETI   74 (128)
T ss_pred             CCHHHHHHHHHHHHHHHhcccCcccccccCCCCccccCCcHHHHcCCCCCHHHH
Confidence            455666777775555553211       2222444 678899999999996443


No 10 
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily. The SP100C protein is a splice variant of SP100, a major component of PML-SP100 nuclear bodies (NBs), which are poorly understood. It is covalently modified by SUMO-1 and may play a role in processes at the chromatin level. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=42.47  E-value=15  Score=25.43  Aligned_cols=43  Identities=14%  Similarity=0.361  Sum_probs=28.2

Q ss_pred             chhHHHHHhHHHHHHHHHhccCCCcccCcccccccCCchhhHhhh
Q 035573           21 RADEIVLSNMAVAFDRVLLDIEEPFTFSSYHKSMREPFDYYMFGQ   65 (95)
Q Consensus        21 ~A~e~vl~nM~~~lDrvlldvedPF~F~pyHkaiRePfDYY~FGq   65 (95)
                      +|+++++..+.---...+  ..+|...|-|++.|..|.|+-+.-.
T Consensus         6 ~ce~il~~l~~~~~s~~f--~~~p~~~pdY~~iIk~PMDL~tI~~   48 (102)
T cd05501           6 KCEFLLLKVYCMSKSGFF--ISKPYYIRDYCQGIKEPMWLNKVKE   48 (102)
T ss_pred             HHHHHHHHHHhCcccccc--cCCCCCCCchHHHcCCCCCHHHHHH
Confidence            466777763332222222  3478899999999999999766543


No 11 
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RACK7 (also called human protein kinase C-binding protein) was identified as a potential tumor suppressor genes, it shares domain architecture with BS69/ZMYND11; both have been implicated in the regulation of cellular proliferation. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=39.99  E-value=20  Score=24.16  Aligned_cols=23  Identities=17%  Similarity=0.359  Sum_probs=16.8

Q ss_pred             CCcccCcccccccCCchhhHhhh
Q 035573           43 EPFTFSSYHKSMREPFDYYMFGQ   65 (95)
Q Consensus        43 dPF~F~pyHkaiRePfDYY~FGq   65 (95)
                      +|=.+|-|++.|..|.|+=+.-+
T Consensus        28 ~~~~~pdY~~iIk~PmDL~tI~~   50 (99)
T cd05508          28 DLEQFPDYAQYVFKPMDLSTLEK   50 (99)
T ss_pred             ChhhCCCHHHHcCCCCCHHHHHH
Confidence            44456779999999999765543


No 12 
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II. Polybromo is a nuclear protein of unknown function, which contains 6 bromodomains. The human ortholog BAF180 is part of a SWI/SNF chromatin-remodeling complex, and it may carry out the functions of Yeast Rsc-1 and Rsc-2. It was shown that polybromo bromodomains bind to histone H3 at specific acetyl-lysine positions. Bromodomains are found in many chromatin-associated proteins and in nuclear histone acetyltransferases. They interact specifically with acetylated lysine, but not all the bromodomains in polybromo may bind to acetyl-lysine.
Probab=39.74  E-value=37  Score=22.84  Aligned_cols=26  Identities=15%  Similarity=0.437  Sum_probs=20.5

Q ss_pred             HHHhccCCCcccCcccccccCCchhh
Q 035573           36 RVLLDIEEPFTFSSYHKSMREPFDYY   61 (95)
Q Consensus        36 rvlldvedPF~F~pyHkaiRePfDYY   61 (95)
                      .++..+-++=.+|-|.+.|+.|.|+=
T Consensus        25 ~~F~~lp~~~~~pdYy~vI~~PmdL~   50 (103)
T cd05517          25 ELFQKLPSKVLYPDYYAVIKEPIDLK   50 (103)
T ss_pred             HHHhcCCCCCCCCCHHHHcCCCcCHH
Confidence            34555667778999999999999953


No 13 
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cbp (CREB binding protein or CREBBP) is an acetyltransferase acting on histone, which gives a specific tag for transcriptional activation and also acetylates non-histone proteins. CREBBP binds specifically to phosphorylated CREB protein and augments the activity of phosphorylated CREB to activate transcription of cAMP-responsive genes. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=38.96  E-value=46  Score=22.54  Aligned_cols=39  Identities=10%  Similarity=0.366  Sum_probs=25.5

Q ss_pred             HHhHHHHHHHHHhc------cCCCc-----ccCcccccccCCchhhHhhh
Q 035573           27 LSNMAVAFDRVLLD------IEEPF-----TFSSYHKSMREPFDYYMFGQ   65 (95)
Q Consensus        27 l~nM~~~lDrvlld------vedPF-----~F~pyHkaiRePfDYY~FGq   65 (95)
                      .+.+..+++.+..+      +.+|-     ..|-|++.|+.|.|+=+...
T Consensus         5 ~~~~~~il~~l~~~~~~s~~F~~PV~~~~~~~pdY~~iIk~PmDL~tI~~   54 (108)
T cd05495           5 RQALMPTLEKLYKQDPESLPFRQPVDPKLLGIPDYFDIVKNPMDLSTIRR   54 (108)
T ss_pred             HHHHHHHHHHHHHcCcccchhcCCCCccccCCCcHHHHhCCCCCHHHHHH
Confidence            34455677777766      22222     37889999999999655443


No 14 
>PLN02999 photosystem II oxygen-evolving enhancer 3 protein (PsbQ)
Probab=35.77  E-value=30  Score=27.23  Aligned_cols=33  Identities=12%  Similarity=0.062  Sum_probs=24.2

Q ss_pred             cccchhhhhhhhhcCCcchhHHHHHhHH-HHHHHH
Q 035573            4 QNNLAYDMFQVFQSGNSRADEIVLSNMA-VAFDRV   37 (95)
Q Consensus         4 ~~~~~~~~~AV~~Sg~p~A~e~vl~nM~-~~lDrv   37 (95)
                      +.+|.||++.|++|- |+.+..=++..+ .++|.|
T Consensus       123 asyLryDL~tiIssk-P~~eK~~L~~LankLFdnv  156 (190)
T PLN02999        123 QAYLSQDLTNAMNIL-PESRRNDYVQAANELVENM  156 (190)
T ss_pred             HHHHHHHHHHHHhcC-CHhhhHHHHHHHHHHhhhH
Confidence            457899999988765 888877776553 566655


No 15 
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. The structure(2DKW) in this alignment is an uncharacterized protein predicted from analysis of cDNA clones from human fetal liver
Probab=34.57  E-value=23  Score=24.34  Aligned_cols=22  Identities=14%  Similarity=0.332  Sum_probs=16.2

Q ss_pred             CCCcccCcccccccCCchhhHh
Q 035573           42 EEPFTFSSYHKSMREPFDYYMF   63 (95)
Q Consensus        42 edPF~F~pyHkaiRePfDYY~F   63 (95)
                      .+|=.+|-|.+.|+.|.|+=+.
T Consensus        28 v~~~~~pdY~~vI~~PmdL~tI   49 (112)
T cd05528          28 VDEEEVPDYYEIIKQPMDLQTI   49 (112)
T ss_pred             CCccccCcHHHHHcCCCCHHHH
Confidence            3444567799999999996544


No 16 
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II. Human Brdt is a testis-specific member of the BET subfamily of bromodomain proteins; the first bromodomain in Brdt has been shown to be essential for male germ cell differentiation. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=32.66  E-value=34  Score=22.36  Aligned_cols=18  Identities=22%  Similarity=0.587  Sum_probs=13.6

Q ss_pred             cCcccccccCCchhhHhh
Q 035573           47 FSSYHKSMREPFDYYMFG   64 (95)
Q Consensus        47 F~pyHkaiRePfDYY~FG   64 (95)
                      +|-|.+.|+.|.|+=+.-
T Consensus        35 ~p~Y~~~I~~Pmdl~~I~   52 (102)
T cd05498          35 LHDYHDIIKHPMDLSTIK   52 (102)
T ss_pred             CCcHHHHccCCCcHHHHH
Confidence            677888999999965443


No 17 
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I. Polybromo is a nuclear protein of unknown function, which contains 6 bromodomains. The human ortholog BAF180 is part of a SWI/SNF chromatin-remodeling complex, and it may carry out the functions of Yeast Rsc-1 and Rsc-2. It was shown that polybromo bromodomains bind to histone H3 at specific acetyl-lysine positions. Bromodomains are found in many chromatin-associated proteins and in nuclear histone acetyltransferases. They interact specifically with acetylated lysine, but not all the bromodomains in polybromo may bind to acetyl-lysine.
Probab=31.64  E-value=67  Score=21.95  Aligned_cols=27  Identities=11%  Similarity=0.266  Sum_probs=19.3

Q ss_pred             HHhccCCCcccCcccccccCCchhhHh
Q 035573           37 VLLDIEEPFTFSSYHKSMREPFDYYMF   63 (95)
Q Consensus        37 vlldvedPF~F~pyHkaiRePfDYY~F   63 (95)
                      .+..+-+.=..|-|++.|+.|.|+=+.
T Consensus        28 ~F~~~p~~~~~PdYy~iI~~Pmdl~tI   54 (113)
T cd05524          28 SFIRVPKRRNEPEYYEVVSNPIDLLKI   54 (113)
T ss_pred             HHhcCCCcccCCCHHHHhCCccCHHHH
Confidence            344444555788999999999996433


No 18 
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV. Polybromo is a nuclear protein of unknown function, which contains 6 bromodomains. The human ortholog BAF180 is part of a SWI/SNF chromatin-remodeling complex, and it may carry out the functions of Yeast Rsc-1 and Rsc-2. It was shown that polybromo bromodomains bind to histone H3 at specific acetyl-lysine positions. Bromodomains are found in many chromatin-associated proteins and in nuclear histone acetyltransferases. They interact specifically with acetylated lysine, but not all the bromodomains in polybromo may bind to acetyl-lysine.
Probab=31.32  E-value=37  Score=22.96  Aligned_cols=22  Identities=23%  Similarity=0.369  Sum_probs=16.5

Q ss_pred             CCCcccCcccccccCCchhhHh
Q 035573           42 EEPFTFSSYHKSMREPFDYYMF   63 (95)
Q Consensus        42 edPF~F~pyHkaiRePfDYY~F   63 (95)
                      -++=.+|-|.+.|..|.|+=+.
T Consensus        31 p~~~~~pdYy~iIk~Pmdl~tI   52 (103)
T cd05518          31 PSKKDYPDYYKIILEPIDLKTI   52 (103)
T ss_pred             CCcccCccHHHHcCCCcCHHHH
Confidence            3444588899999999996543


No 19 
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=28.56  E-value=21  Score=25.98  Aligned_cols=7  Identities=57%  Similarity=1.734  Sum_probs=4.4

Q ss_pred             cCCchhh
Q 035573           55 REPFDYY   61 (95)
Q Consensus        55 RePfDYY   61 (95)
                      ||||||+
T Consensus       137 ~epf~~f  143 (146)
T TIGR02159       137 KEPFEYF  143 (146)
T ss_pred             CCcHhhc
Confidence            4666665


No 20 
>smart00297 BROMO bromo domain.
Probab=28.35  E-value=59  Score=20.60  Aligned_cols=23  Identities=13%  Similarity=0.299  Sum_probs=16.1

Q ss_pred             CCcccCcccccccCCchhhHhhh
Q 035573           43 EPFTFSSYHKSMREPFDYYMFGQ   65 (95)
Q Consensus        43 dPF~F~pyHkaiRePfDYY~FGq   65 (95)
                      ++-..|-|++.|..|.|+=..-+
T Consensus        33 ~~~~~p~Y~~~i~~P~dl~~I~~   55 (107)
T smart00297       33 DRKEAPDYYDIIKKPMDLSTIKK   55 (107)
T ss_pred             ChhhccCHHHHhcCCCCHHHHHH
Confidence            33346668999999999765544


No 21 
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V. Polybromo is a nuclear protein of unknown function, which contains 6 bromodomains. The human ortholog BAF180 is part of a SWI/SNF chromatin-remodeling complex, and it may carry out the functions of Yeast Rsc-1 and Rsc-2. It was shown that polybromo bromodomains bind to histone H3 at specific acetyl-lysine positions. Bromodomains are found in many chromatin-associated proteins and in nuclear histone acetyltransferases. They interact specifically with acetylated lysine, but not all the bromodomains in polybromo may bind to acetyl-lysine.
Probab=28.19  E-value=32  Score=23.03  Aligned_cols=28  Identities=11%  Similarity=0.395  Sum_probs=21.1

Q ss_pred             HHhccCCCcccCcccccccCCchhhHhh
Q 035573           37 VLLDIEEPFTFSSYHKSMREPFDYYMFG   64 (95)
Q Consensus        37 vlldvedPF~F~pyHkaiRePfDYY~FG   64 (95)
                      .+...-++-.+|-|++.|+.|.|+=+.-
T Consensus        26 ~F~~~p~~~~~pdYy~iIk~PmdL~tI~   53 (105)
T cd05515          26 IFMRLPSKSEYPDYYDVIKKPIDMEKIR   53 (105)
T ss_pred             HhccCCCcccCCcHHHHcCCCcCHHHHH
Confidence            4445556678899999999999965443


No 22 
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily. Human TAFII250 (or TAF250) is the largest subunit of TFIID, a large multi-domain complex, which initiates the assembly of the transcription machinery. TAFII250 contains two bromodomains that specifically bind to acetylated histone H4. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=28.00  E-value=28  Score=23.76  Aligned_cols=29  Identities=14%  Similarity=0.204  Sum_probs=21.2

Q ss_pred             HHhccCCCcccCcccccccCCchhhHhhh
Q 035573           37 VLLDIEEPFTFSSYHKSMREPFDYYMFGQ   65 (95)
Q Consensus        37 vlldvedPF~F~pyHkaiRePfDYY~FGq   65 (95)
                      .+....+|-.+|-|++.|+.|.|+=+..+
T Consensus        20 ~F~~pv~~~~~p~Y~~~I~~PmdL~tI~~   48 (112)
T cd05511          20 PFHTPVNKKKVPDYYKIIKRPMDLQTIRK   48 (112)
T ss_pred             hhcCCCChhhcccHHHHhcCCCCHHHHHH
Confidence            44555566677789999999999765543


No 23 
>PF05757 PsbQ:  Oxygen evolving enhancer protein 3 (PsbQ);  InterPro: IPR008797 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  In PSII, the oxygen-evolving complex (OEC) is responsible for catalysing the splitting of water to O(2) and 4H+. The OEC is composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ), PsbU and PsbV having been lost during the evolution of green plants []. This family represents the PSII OEC protein PsbQ. Both PsbQ and PsbP (IPR002683 from INTERPRO) are regulators that are necessary for the biogenesis of optically active PSII. The crystal structure of PsbQ from spinach revealed a 4-helical bundle polypeptide. The distribution of positive and negative charges on the protein surface might explain the ability of PsbQ to increase the binding of chloride and calcium ions and make them available to PSII [].; GO: 0005509 calcium ion binding, 0015979 photosynthesis, 0009523 photosystem II, 0009654 oxygen evolving complex, 0019898 extrinsic to membrane; PDB: 1VYK_A 1NZE_A 3LS1_A 3LS0_A.
Probab=27.14  E-value=81  Score=24.47  Aligned_cols=32  Identities=25%  Similarity=0.491  Sum_probs=20.0

Q ss_pred             cccchhhhhhhhhcCCcchhHHHHHhHH-HHHHH
Q 035573            4 QNNLAYDMFQVFQSGNSRADEIVLSNMA-VAFDR   36 (95)
Q Consensus         4 ~~~~~~~~~AV~~Sg~p~A~e~vl~nM~-~~lDr   36 (95)
                      ..+|-|||+.|+++ .|+.+..=++..+ .+||.
T Consensus       135 a~~Lr~DL~~liss-~p~~~kk~l~~La~~lf~~  167 (202)
T PF05757_consen  135 AGYLRYDLNTLISS-KPKDEKKALTDLANKLFDN  167 (202)
T ss_dssp             CCCHHHHHHHHHCC-S-HHHHHHHHHHHHHHHHH
T ss_pred             HhHHHHHHHHHHHh-CCHHHHHHHHHHHHHHHHH
Confidence            35788999999988 5776654444333 34443


No 24 
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like). The Williams-Beuren syndrome deletion transcript 9 is a putative transcriptional regulator. WSTF was found to play a role in vitamin D-mediated transcription as part of two chromatin remodeling complexes, WINAC and WICH. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=25.17  E-value=25  Score=23.53  Aligned_cols=22  Identities=18%  Similarity=0.304  Sum_probs=16.4

Q ss_pred             CCcccCcccccccCCchhhHhh
Q 035573           43 EPFTFSSYHKSMREPFDYYMFG   64 (95)
Q Consensus        43 dPF~F~pyHkaiRePfDYY~FG   64 (95)
                      +|=.+|-|++-|+.|.|+=+.-
T Consensus        26 ~~~~~pdY~~iIk~PmDL~tI~   47 (97)
T cd05505          26 TADEAEDYKKVITNPMDLQTMQ   47 (97)
T ss_pred             ChhhcccHHHHcCCcCCHHHHH
Confidence            3334666999999999987654


No 25 
>PF08165 FerA:  FerA (NUC095) domain;  InterPro: IPR012560  The ferlin gene family are characterised by multiple tandem C2 domains and a C-terminal transmembrane domain. They are found in a wide range of species and their function remains unknown, however, mutations in its two most well-characterised members, dysferlin and otoferlin, have been implicated in human disease []. This is central domain A in proteins of the Ferlin family [].; GO: 0016021 integral to membrane
Probab=24.81  E-value=80  Score=20.25  Aligned_cols=18  Identities=28%  Similarity=0.580  Sum_probs=14.2

Q ss_pred             HHHHHhHHHHHHHHHhccCCCc
Q 035573           24 EIVLSNMAVAFDRVLLDIEEPF   45 (95)
Q Consensus        24 e~vl~nM~~~lDrvlldvedPF   45 (95)
                      +.+++    .+|.+++|...|-
T Consensus        14 ~~~~~----lLdqlIeD~~~pL   31 (66)
T PF08165_consen   14 ELWLK----LLDQLIEDCSKPL   31 (66)
T ss_pred             HHHHH----HHHHHHHHhcCCC
Confidence            55555    9999999988853


No 26 
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily. WDR9 is a human gene located in the Down Syndrome critical region-2 of chromosome 21. It encodes for a nuclear protein containing WD40 repeats and two bromodomains, which may function as a transcriptional regulator involved in chromatin remodeling and play a role in embryonic development. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=24.65  E-value=17  Score=25.45  Aligned_cols=24  Identities=13%  Similarity=0.360  Sum_probs=17.9

Q ss_pred             CCCcccCcccccccCCchhhHhhh
Q 035573           42 EEPFTFSSYHKSMREPFDYYMFGQ   65 (95)
Q Consensus        42 edPF~F~pyHkaiRePfDYY~FGq   65 (95)
                      .+|-.+|-|++-|..|.|+=+.-+
T Consensus        30 Vd~~~~pdY~~iIk~PmDL~tIk~   53 (119)
T cd05496          30 VDLLKYPDYRDIIDTPMDLGTVKE   53 (119)
T ss_pred             CChhhcCcHHHHhCCcccHHHHHH
Confidence            344457789999999999865543


No 27 
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi. SNF2 is a yeast protein involved in transcriptional activation, it is the catalytic component of the SWI/SNF ATP-dependent chromatin remodeling complex. The protein is essential for the regulation of gene expression (both positive and negative) of a large number of genes. The SWI/SNF complex changes chromatin structure by altering DNA-histone contacts within the nucleosome, which results in a re-positioning of the nucleosome and facilitates or represses the binding of gene-specific transcription factors. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=23.50  E-value=57  Score=21.57  Aligned_cols=26  Identities=12%  Similarity=0.290  Sum_probs=19.7

Q ss_pred             HHHhccCCCcccCcccccccCCchhh
Q 035573           36 RVLLDIEEPFTFSSYHKSMREPFDYY   61 (95)
Q Consensus        36 rvlldvedPF~F~pyHkaiRePfDYY   61 (95)
                      ..+....+.-.+|-|++.|..|.|+=
T Consensus        25 ~~F~~~p~~~~~pdYy~iIk~Pmdl~   50 (103)
T cd05519          25 ELFLEKPSKKLYPDYYVIIKRPIALD   50 (103)
T ss_pred             HHhcCCCCCCCCcCHHHHcCCCcCHH
Confidence            34555566667888999999999954


No 28 
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. SPT7 is a yeast protein that functions as a component of the transcription regulatory histone acetylation (HAT) complexes SAGA, SALSA, and SLIK. SAGA is involved in the RNA polymerase II-dependent transcriptional regulation of about 10% of all yeast genes. The SPT7 bromodomain has been shown to weakly interact with acetylated histone H3, but not H4. The human representative of this subfamily is cat eye syndrome critical region protein 2 (CECR2). Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=23.45  E-value=54  Score=22.56  Aligned_cols=27  Identities=15%  Similarity=0.176  Sum_probs=17.9

Q ss_pred             HhccCCCcccCcccccccCCchhhHhh
Q 035573           38 LLDIEEPFTFSSYHKSMREPFDYYMFG   64 (95)
Q Consensus        38 lldvedPF~F~pyHkaiRePfDYY~FG   64 (95)
                      +....+|=..|-|++.|+.|.|+=+.-
T Consensus        29 F~~pv~~~~~pdY~~iIk~PmdL~tI~   55 (112)
T cd05510          29 FLTKVSKREAPDYYDIIKKPMDLGTML   55 (112)
T ss_pred             hhcCCChhhcCCHHHHhcCccCHHHHH
Confidence            333334445666899999999976543


No 29 
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup. In mammals, brd8 (bromodomain containing 8) interacts with the thyroid hormone receptor in a ligand-dependent fashion and enhances thyroid hormone-dependent activation from thyroid response elements. Brd8 is thought to be a nuclear receptor coactivator. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=22.84  E-value=73  Score=21.29  Aligned_cols=27  Identities=19%  Similarity=0.239  Sum_probs=18.5

Q ss_pred             HhccCCCcccCcccccccCCchhhHhh
Q 035573           38 LLDIEEPFTFSSYHKSMREPFDYYMFG   64 (95)
Q Consensus        38 lldvedPF~F~pyHkaiRePfDYY~FG   64 (95)
                      +..-.+|=..|-|++.|+.|.|+=+.-
T Consensus        24 F~~pV~~~~~p~Y~~iIk~PmDL~tI~   50 (104)
T cd05507          24 FLKPVTEDIAPGYHSVVYRPMDLSTIK   50 (104)
T ss_pred             hcCCCCccccCCHHHHhCCCcCHHHHH
Confidence            333344445777999999999975443


No 30 
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily. Bromo adjacent to zinc finger 2A (BAZ2A) and 2B (BAZ2B) were identified as a novel human bromodomain gene by cDNA library screening. BAZ2A is also known as Tip5 (Transcription termination factor I-interacting protein 5) and hWALp3. The proteins may play roles in transcriptional regulation. Human Tip5 is part of a complex termed NoRC (nucleolar remodeling complex), which induces nucleosome sliding and may play a role in the regulation of the rDNA locus. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=22.78  E-value=39  Score=22.23  Aligned_cols=27  Identities=19%  Similarity=0.420  Sum_probs=18.7

Q ss_pred             hccCCCcccCcccccccCCchhhHhhh
Q 035573           39 LDIEEPFTFSSYHKSMREPFDYYMFGQ   65 (95)
Q Consensus        39 ldvedPF~F~pyHkaiRePfDYY~FGq   65 (95)
                      .+..+|=.+|-|++.|+.|.|+=+.-+
T Consensus        22 ~~pv~~~~~p~Y~~iIk~PmdL~tI~~   48 (97)
T cd05503          22 LEPVNTKLVPGYRKIIKKPMDFSTIRE   48 (97)
T ss_pred             cCCCCccccCCHHHHhCCCCCHHHHHH
Confidence            333344456779999999999876543


No 31 
>PF07914 DUF1679:  Protein of unknown function (DUF1679);  InterPro: IPR012877 This region is found in a number of Caenorhabditis elegans and Caenorhabditis briggsae proteins, in one case (Q19034 from SWISSPROT) as a repeat. In many of the family members, this region is associated with the CHK region described by SMART as being found in zinc finger-C4 and HLH domain-containing kinases. In fact, one member of this family (Q9GUC1 from SWISSPROT) is annotated as being a member of the nuclear hormone receptor family, and contains regions typical of such proteins (IPR000536 from INTERPRO, IPR008946 from INTERPRO, and IPR001628 from INTERPRO). 
Probab=22.34  E-value=1.1e+02  Score=25.47  Aligned_cols=67  Identities=28%  Similarity=0.397  Sum_probs=48.9

Q ss_pred             ccccchhhhhhhhhcCCcchh-----HHHHHhHHHHHHHHH-hccCCCcccCcccccccCCchhhHhhhhhhhhcc
Q 035573            3 HQNNLAYDMFQVFQSGNSRAD-----EIVLSNMAVAFDRVL-LDIEEPFTFSSYHKSMREPFDYYMFGQNYIRPLV   72 (95)
Q Consensus         3 ~~~~~~~~~~AV~~Sg~p~A~-----e~vl~nM~~~lDrvl-ldvedPF~F~pyHkaiRePfDYY~FGq~YIrpLV   72 (95)
                      |-.|-+-|+--++.++.+..+     +.+|.-+-.-|-..+ .+.+.||+|+=.+.+=|   -||-++-.++-|++
T Consensus       302 h~G~~~eDl~Rll~~~lS~edRR~~~~~lL~~Yy~~f~~~l~~~~~~PfT~eqL~~sY~---l~fp~~al~~lp~~  374 (414)
T PF07914_consen  302 HRGSPAEDLARLLVSCLSGEDRREHTEELLEYYYDTFTEALEDGGKAPFTLEQLKDSYR---LYFPFGALFLLPGI  374 (414)
T ss_pred             hcCchHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHHHHHHhccCCCCccHHHHHHHHH---HHHHHHHHHHHHHH
Confidence            667888999999988887765     556776666666677 45699999987776655   26677777665554


No 32 
>PLN02729 PSII-Q subunit
Probab=21.29  E-value=77  Score=25.50  Aligned_cols=33  Identities=21%  Similarity=0.365  Sum_probs=22.7

Q ss_pred             cccchhhhhhhhhcCCcchhHHHHHhHH-HHHHHH
Q 035573            4 QNNLAYDMFQVFQSGNSRADEIVLSNMA-VAFDRV   37 (95)
Q Consensus         4 ~~~~~~~~~AV~~Sg~p~A~e~vl~nM~-~~lDrv   37 (95)
                      +.+|-||++.|++|- |+.+..=++..+ .+||.+
T Consensus       153 AsyL~yDL~tvIssk-P~~eKk~L~~LankLFdn~  186 (220)
T PLN02729        153 STFMYYDFDKLISAA-PVDDKQPLTDLANRLFDNF  186 (220)
T ss_pred             HHHHHHHHHHHhccC-ChhhhHHHHHHHHHHHhhH
Confidence            346889999988776 777766666443 555544


No 33 
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals. SNF2L2 (SNF2-alpha) or SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2 is a global transcriptional activator, which cooperates with nuclear hormone receptors to boost transcriptional activation. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Probab=21.10  E-value=1.1e+02  Score=20.52  Aligned_cols=27  Identities=15%  Similarity=0.415  Sum_probs=18.4

Q ss_pred             HhccCCCcccCcccccccCCchhhHhh
Q 035573           38 LLDIEEPFTFSSYHKSMREPFDYYMFG   64 (95)
Q Consensus        38 lldvedPF~F~pyHkaiRePfDYY~FG   64 (95)
                      +....++=..|-|++.|+.|.|+=+.-
T Consensus        28 F~~~p~~~~~pdYy~iI~~Pmdl~tI~   54 (107)
T cd05516          28 FIQLPSRKELPEYYELIRKPVDFKKIK   54 (107)
T ss_pred             hhcCCCcccCCCHHHHcCCCCCHHHHH
Confidence            333344446777999999999965443


No 34 
>PF14757 NSP2-B_epitope:  Immunogenic region of nsp2 protein of arterivirus polyprotein
Probab=20.15  E-value=57  Score=26.92  Aligned_cols=35  Identities=34%  Similarity=0.457  Sum_probs=28.0

Q ss_pred             hhhhhhhhhcCCcc------hhHHHHHhHHHHHHHHHhccCCC
Q 035573            8 AYDMFQVFQSGNSR------ADEIVLSNMAVAFDRVLLDIEEP   44 (95)
Q Consensus         8 ~~~~~AV~~Sg~p~------A~e~vl~nM~~~lDrvlldvedP   44 (95)
                      .|-..|++.||.|-      ..|.||+.|..++|---+|  ||
T Consensus       216 k~SaQAiIdsGGPcsghlq~~Ke~cl~imreACda~kl~--dP  256 (272)
T PF14757_consen  216 KYSAQAIIDSGGPCSGHLQEEKEACLSIMREACDATKLD--DP  256 (272)
T ss_pred             ccchhhhhccCCCchHHHHHHHHHHHHHHHHhcCccccC--Ch
Confidence            36678999999884      4689999999999877666  55


Done!