Query         035574
Match_columns 156
No_of_seqs    169 out of 1701
Neff          7.9 
Searched_HMMs 46136
Date          Fri Mar 29 04:10:59 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035574.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035574hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4658 Apoptotic ATPase [Sign  99.9 4.7E-27   1E-31  211.2  12.9  144    2-149   168-377 (889)
  2 PF00931 NB-ARC:  NB-ARC domain  99.9 7.9E-24 1.7E-28  167.9   6.9  136    2-138     6-206 (287)
  3 PLN03210 Resistant to P. syrin  99.8 8.2E-19 1.8E-23  162.4  12.6  142    3-146   195-407 (1153)
  4 cd01128 rho_factor Transcripti  98.4 8.2E-07 1.8E-11   70.2   6.5   52   15-67     16-69  (249)
  5 PRK09376 rho transcription ter  98.3 6.8E-07 1.5E-11   74.7   4.6   51   16-67    170-222 (416)
  6 PRK08118 topology modulation p  98.1 2.3E-06 4.9E-11   63.6   2.3   36   16-51      2-38  (167)
  7 PF05729 NACHT:  NACHT domain    98.0   2E-05 4.4E-10   56.8   5.8   41   16-56      1-45  (166)
  8 TIGR00767 rho transcription te  97.8 3.1E-05 6.8E-10   65.0   5.6   53   16-69    169-223 (415)
  9 PF13401 AAA_22:  AAA domain; P  97.7 4.4E-05 9.6E-10   53.3   3.6   57   14-72      3-64  (131)
 10 PRK07261 topology modulation p  97.7 0.00014   3E-09   54.1   6.1   54   17-70      2-56  (171)
 11 cd00009 AAA The AAA+ (ATPases   97.5 0.00038 8.2E-09   48.2   6.2   43   14-58     18-60  (151)
 12 PRK00411 cdc6 cell division co  97.5 0.00046   1E-08   57.2   7.5   57   15-71     55-111 (394)
 13 PF13207 AAA_17:  AAA domain; P  97.5 0.00011 2.3E-09   50.9   3.1   21   17-37      1-21  (121)
 14 PRK11331 5-methylcytosine-spec  97.5 0.00019 4.2E-09   61.1   5.1   49   15-63    194-242 (459)
 15 TIGR02928 orc1/cdc6 family rep  97.4 0.00059 1.3E-08   55.9   7.1   57   14-70     39-99  (365)
 16 PF13191 AAA_16:  AAA ATPase do  97.3 0.00055 1.2E-08   50.3   5.8   27   12-38     21-47  (185)
 17 PF13173 AAA_14:  AAA domain     97.3 0.00052 1.1E-08   48.4   5.4   83   15-100     2-104 (128)
 18 TIGR03015 pepcterm_ATPase puta  97.3 0.00091   2E-08   52.4   7.0   54   15-71     43-96  (269)
 19 PRK07667 uridine kinase; Provi  97.2 0.00069 1.5E-08   51.3   4.9   36    2-37      4-39  (193)
 20 PRK06696 uridine kinase; Valid  97.1 0.00065 1.4E-08   52.5   4.4   34    4-37     10-44  (223)
 21 PF13238 AAA_18:  AAA domain; P  97.1 0.00051 1.1E-08   47.4   2.8   21   18-38      1-21  (129)
 22 KOG2028 ATPase related to the   97.0  0.0024 5.2E-08   53.4   7.1   53   13-69    160-212 (554)
 23 PRK05541 adenylylsulfate kinas  97.0   0.001 2.2E-08   49.3   4.0   36   14-51      6-41  (176)
 24 PTZ00202 tuzin; Provisional     97.0  0.0047   1E-07   53.0   8.3   51   14-72    285-335 (550)
 25 TIGR02237 recomb_radB DNA repa  97.0  0.0029 6.4E-08   47.9   6.6   51   11-64      8-58  (209)
 26 PRK04841 transcriptional regul  96.9  0.0037   8E-08   56.9   8.0   63    1-70     19-82  (903)
 27 PF05496 RuvB_N:  Holliday junc  96.9   0.001 2.2E-08   52.0   3.7   32   12-45     47-78  (233)
 28 PRK08233 hypothetical protein;  96.9   0.001 2.3E-08   48.9   3.4   24   15-38      3-26  (182)
 29 PF00485 PRK:  Phosphoribulokin  96.9 0.00091   2E-08   50.5   3.1   21   17-37      1-21  (194)
 30 PTZ00301 uridine kinase; Provi  96.9  0.0015 3.1E-08   50.5   4.1   23   15-37      3-25  (210)
 31 PRK05480 uridine/cytidine kina  96.9  0.0012 2.6E-08   50.2   3.6   24   14-37      5-28  (209)
 32 TIGR00235 udk uridine kinase.   96.8  0.0014 3.1E-08   49.9   3.7   25   13-37      4-28  (207)
 33 smart00382 AAA ATPases associa  96.8  0.0021 4.7E-08   43.8   4.1   37   16-54      3-39  (148)
 34 PRK05564 DNA polymerase III su  96.7    0.02 4.4E-07   46.3  10.2   81   15-96     26-134 (313)
 35 PRK06762 hypothetical protein;  96.7  0.0015 3.3E-08   47.7   3.3   22   16-37      3-24  (166)
 36 PF13671 AAA_33:  AAA domain; P  96.7  0.0016 3.5E-08   46.1   3.2   21   17-37      1-21  (143)
 37 COG1618 Predicted nucleotide k  96.7   0.002 4.3E-08   48.0   3.4   22   16-37      6-27  (179)
 38 PRK03839 putative kinase; Prov  96.7  0.0016 3.4E-08   48.4   2.9   22   17-38      2-23  (180)
 39 cd01123 Rad51_DMC1_radA Rad51_  96.6   0.011 2.4E-07   45.4   7.7   53   11-63     15-71  (235)
 40 TIGR01360 aden_kin_iso1 adenyl  96.6  0.0023   5E-08   47.3   3.3   24   14-37      2-25  (188)
 41 TIGR03420 DnaA_homol_Hda DnaA   96.5  0.0035 7.7E-08   47.8   4.2   26   13-38     36-61  (226)
 42 cd01393 recA_like RecA is a  b  96.5   0.015 3.2E-07   44.5   7.7   51   11-63     15-71  (226)
 43 PRK04040 adenylate kinase; Pro  96.5  0.0031 6.8E-08   47.7   3.8   23   15-37      2-24  (188)
 44 PRK09361 radB DNA repair and r  96.5   0.012 2.6E-07   45.2   7.1   49   11-62     19-67  (225)
 45 PF00004 AAA:  ATPase family as  96.5  0.0022 4.8E-08   44.3   2.7   21   18-38      1-21  (132)
 46 PRK14738 gmk guanylate kinase;  96.5   0.003 6.6E-08   48.2   3.6   32    6-37      4-35  (206)
 47 cd02019 NK Nucleoside/nucleoti  96.4  0.0027 5.8E-08   40.1   2.5   22   17-38      1-22  (69)
 48 PRK00131 aroK shikimate kinase  96.4  0.0029 6.4E-08   46.0   3.1   23   15-37      4-26  (175)
 49 COG1428 Deoxynucleoside kinase  96.4  0.0026 5.7E-08   49.1   2.8   24   15-38      4-27  (216)
 50 PRK06547 hypothetical protein;  96.4  0.0037   8E-08   46.7   3.5   27   12-38     12-38  (172)
 51 PRK00625 shikimate kinase; Pro  96.4  0.0028 6.1E-08   47.4   2.8   20   18-37      3-22  (173)
 52 cd02023 UMPK Uridine monophosp  96.4  0.0025 5.4E-08   48.0   2.5   21   17-37      1-21  (198)
 53 PRK13947 shikimate kinase; Pro  96.3   0.003 6.5E-08   46.3   2.7   21   17-37      3-23  (171)
 54 PRK00889 adenylylsulfate kinas  96.3  0.0042 9.1E-08   45.9   3.5   23   15-37      4-26  (175)
 55 cd02020 CMPK Cytidine monophos  96.3  0.0029 6.3E-08   44.8   2.5   21   17-37      1-21  (147)
 56 TIGR02322 phosphon_PhnN phosph  96.3  0.0036 7.8E-08   46.3   3.1   23   16-38      2-24  (179)
 57 cd01394 radB RadB. The archaea  96.3    0.02 4.4E-07   43.6   7.2   46   11-58     15-60  (218)
 58 PF01637 Arch_ATPase:  Archaeal  96.3  0.0031 6.8E-08   47.6   2.7   38    1-38      4-43  (234)
 59 PRK09270 nucleoside triphospha  96.3  0.0071 1.5E-07   46.8   4.7   27   11-37     29-55  (229)
 60 COG0572 Udk Uridine kinase [Nu  96.2  0.0046   1E-07   48.0   3.4   25   13-37      6-30  (218)
 61 TIGR01359 UMP_CMP_kin_fam UMP-  96.2  0.0034 7.4E-08   46.4   2.5   21   17-37      1-21  (183)
 62 PRK06217 hypothetical protein;  96.2  0.0047   1E-07   46.1   3.2   35   17-52      3-39  (183)
 63 cd01120 RecA-like_NTPases RecA  96.2  0.0063 1.4E-07   43.2   3.7   39   18-58      2-40  (165)
 64 cd02025 PanK Pantothenate kina  96.2  0.0034 7.3E-08   48.6   2.4   21   17-37      1-21  (220)
 65 TIGR02236 recomb_radA DNA repa  96.2   0.029 6.3E-07   45.3   7.9   52   13-64     93-148 (310)
 66 PF08477 Miro:  Miro-like prote  96.2   0.005 1.1E-07   42.0   3.0   22   18-39      2-23  (119)
 67 cd02028 UMPK_like Uridine mono  96.2  0.0054 1.2E-07   45.9   3.4   22   17-38      1-22  (179)
 68 cd02024 NRK1 Nicotinamide ribo  96.2  0.0037   8E-08   47.4   2.5   22   17-38      1-22  (187)
 69 PF07728 AAA_5:  AAA domain (dy  96.2   0.015 3.3E-07   41.0   5.5   41   18-63      2-42  (139)
 70 TIGR03263 guanyl_kin guanylate  96.2  0.0049 1.1E-07   45.5   3.1   22   16-37      2-23  (180)
 71 PRK04301 radA DNA repair and r  96.2   0.026 5.6E-07   45.9   7.5   53   13-65    100-156 (317)
 72 cd01672 TMPK Thymidine monopho  96.1   0.017 3.7E-07   42.7   5.9   21   17-37      2-22  (200)
 73 PRK03846 adenylylsulfate kinas  96.1  0.0066 1.4E-07   45.9   3.6   25   13-37     22-46  (198)
 74 PRK13949 shikimate kinase; Pro  96.1  0.0053 1.2E-07   45.5   3.1   22   16-37      2-23  (169)
 75 cd00227 CPT Chloramphenicol (C  96.1  0.0051 1.1E-07   45.5   2.9   23   16-38      3-25  (175)
 76 PRK00080 ruvB Holliday junctio  96.1   0.012 2.7E-07   47.9   5.4   26   13-38     49-74  (328)
 77 COG0003 ArsA Predicted ATPase   96.1   0.011 2.4E-07   48.5   5.0   47   15-63      2-48  (322)
 78 COG2256 MGS1 ATPase related to  96.1  0.0051 1.1E-07   51.7   3.1   32   13-46     46-77  (436)
 79 PHA00729 NTP-binding motif con  96.1   0.011 2.3E-07   46.3   4.7   24   14-37     16-39  (226)
 80 PRK13975 thymidylate kinase; P  96.1  0.0059 1.3E-07   45.7   3.2   22   16-37      3-24  (196)
 81 PF00448 SRP54:  SRP54-type pro  96.1   0.021 4.6E-07   43.5   6.2   55   15-71      1-56  (196)
 82 cd04139 RalA_RalB RalA/RalB su  96.1  0.0067 1.5E-07   43.2   3.3   23   17-39      2-24  (164)
 83 COG0466 Lon ATP-dependent Lon   96.1   0.006 1.3E-07   54.6   3.5   42    2-45    333-378 (782)
 84 smart00763 AAA_PrkA PrkA AAA d  96.0  0.0092   2E-07   49.7   4.4   38    2-39     61-102 (361)
 85 PRK00300 gmk guanylate kinase;  96.0  0.0057 1.2E-07   46.1   3.0   24   15-38      5-28  (205)
 86 COG2909 MalT ATP-dependent tra  96.0   0.045 9.7E-07   49.9   8.9   67    1-71     24-91  (894)
 87 cd02021 GntK Gluconate kinase   96.0  0.0051 1.1E-07   44.1   2.5   21   18-38      2-22  (150)
 88 PF03205 MobB:  Molybdopterin g  96.0   0.013 2.8E-07   42.3   4.6   38   16-55      1-39  (140)
 89 PRK13342 recombination factor   96.0   0.024 5.3E-07   47.8   7.0   23   15-37     36-58  (413)
 90 PRK13230 nitrogenase reductase  96.0   0.006 1.3E-07   48.5   3.1   23   15-37      1-23  (279)
 91 PRK13236 nitrogenase reductase  96.0  0.0073 1.6E-07   48.7   3.6   26   12-37      3-28  (296)
 92 cd02040 NifH NifH gene encodes  96.0   0.006 1.3E-07   47.9   3.0   22   16-37      2-23  (270)
 93 PF00625 Guanylate_kin:  Guanyl  96.0   0.011 2.3E-07   44.1   4.2   36   15-52      2-37  (183)
 94 PF01583 APS_kinase:  Adenylyls  96.0  0.0094   2E-07   44.0   3.9   34   16-51      3-36  (156)
 95 cd00464 SK Shikimate kinase (S  96.0   0.006 1.3E-07   43.6   2.8   20   18-37      2-21  (154)
 96 PRK10751 molybdopterin-guanine  96.0   0.009   2E-07   44.8   3.8   24   14-37      5-28  (173)
 97 COG0467 RAD55 RecA-superfamily  96.0   0.014   3E-07   46.0   5.0   53   12-68     20-72  (260)
 98 PRK06893 DNA replication initi  96.0  0.0074 1.6E-07   46.8   3.3   37   16-54     40-76  (229)
 99 TIGR01287 nifH nitrogenase iro  95.9   0.006 1.3E-07   48.3   2.8   22   16-37      1-22  (275)
100 PF03308 ArgK:  ArgK protein;    95.9   0.012 2.7E-07   46.8   4.5   35    3-37     17-51  (266)
101 TIGR00150 HI0065_YjeE ATPase,   95.9   0.013 2.9E-07   42.0   4.2   36    4-39     11-46  (133)
102 TIGR02640 gas_vesic_GvpN gas v  95.9   0.013 2.9E-07   46.4   4.6   21   17-37     23-43  (262)
103 PLN02318 phosphoribulokinase/u  95.9   0.013 2.8E-07   51.9   4.8   33    5-37     55-87  (656)
104 PRK10078 ribose 1,5-bisphospho  95.9  0.0078 1.7E-07   45.0   3.1   23   16-38      3-25  (186)
105 PF04665 Pox_A32:  Poxvirus A32  95.9   0.012 2.7E-07   46.3   4.3   35   17-53     15-49  (241)
106 TIGR00554 panK_bact pantothena  95.9   0.012 2.7E-07   47.5   4.4   24   13-36     60-83  (290)
107 cd02117 NifH_like This family   95.9  0.0075 1.6E-07   46.0   2.9   22   16-37      1-22  (212)
108 TIGR00064 ftsY signal recognit  95.9   0.019 4.2E-07   45.9   5.4   25   13-37     70-94  (272)
109 PRK13232 nifH nitrogenase redu  95.9  0.0076 1.6E-07   47.8   3.1   22   16-37      2-23  (273)
110 cd00071 GMPK Guanosine monopho  95.8  0.0085 1.8E-07   42.9   3.0   20   18-37      2-21  (137)
111 PRK04182 cytidylate kinase; Pr  95.8  0.0088 1.9E-07   43.8   3.1   21   17-37      2-22  (180)
112 TIGR00073 hypB hydrogenase acc  95.8  0.0095 2.1E-07   45.4   3.3   26   12-37     19-44  (207)
113 TIGR00176 mobB molybdopterin-g  95.8   0.012 2.6E-07   43.2   3.7   21   17-37      1-21  (155)
114 PF00910 RNA_helicase:  RNA hel  95.8  0.0062 1.3E-07   41.7   2.0   20   18-37      1-20  (107)
115 PF07726 AAA_3:  ATPase family   95.8  0.0064 1.4E-07   43.5   2.1   27   18-46      2-28  (131)
116 PRK13946 shikimate kinase; Pro  95.8  0.0084 1.8E-07   44.9   2.9   23   15-37     10-32  (184)
117 cd01133 F1-ATPase_beta F1 ATP   95.8   0.014 3.1E-07   46.8   4.3   50   16-67     70-121 (274)
118 COG1100 GTPase SAR1 and relate  95.8  0.0084 1.8E-07   45.3   2.9   24   16-39      6-29  (219)
119 cd04155 Arl3 Arl3 subfamily.    95.8   0.016 3.5E-07   42.0   4.3   24   15-38     14-37  (173)
120 PRK08084 DNA replication initi  95.8   0.019 4.1E-07   44.7   4.9   38   15-54     45-82  (235)
121 PRK09435 membrane ATPase/prote  95.8   0.017 3.7E-07   47.6   4.8   26   12-37     53-78  (332)
122 PRK13948 shikimate kinase; Pro  95.7    0.01 2.3E-07   44.7   3.3   24   14-37      9-32  (182)
123 PRK14493 putative bifunctional  95.7   0.012 2.5E-07   47.3   3.7   23   15-37      1-23  (274)
124 PRK05439 pantothenate kinase;   95.7   0.019   4E-07   47.0   4.9   26   12-37     83-108 (311)
125 PRK12339 2-phosphoglycerate ki  95.7   0.011 2.4E-07   45.1   3.4   24   15-38      3-26  (197)
126 PRK14530 adenylate kinase; Pro  95.7  0.0092   2E-07   45.7   2.9   21   17-37      5-25  (215)
127 KOG2004 Mitochondrial ATP-depe  95.7   0.018 3.9E-07   51.8   4.9   42    2-45    421-466 (906)
128 COG1124 DppF ABC-type dipeptid  95.7   0.017 3.8E-07   45.5   4.4   23   15-37     33-55  (252)
129 TIGR00635 ruvB Holliday juncti  95.7   0.017 3.6E-07   46.3   4.4   26   13-38     28-53  (305)
130 cd04119 RJL RJL (RabJ-Like) su  95.7   0.012 2.7E-07   41.9   3.3   22   18-39      3-24  (168)
131 PF13521 AAA_28:  AAA domain; P  95.7   0.009 1.9E-07   43.6   2.6   20   18-37      2-21  (163)
132 cd02027 APSK Adenosine 5'-phos  95.7  0.0086 1.9E-07   43.4   2.5   21   17-37      1-21  (149)
133 PRK13235 nifH nitrogenase redu  95.7  0.0093   2E-07   47.3   2.9   22   16-37      2-23  (274)
134 TIGR02173 cyt_kin_arch cytidyl  95.7   0.011 2.4E-07   43.0   3.0   21   17-37      2-22  (171)
135 TIGR01313 therm_gnt_kin carboh  95.6   0.008 1.7E-07   43.7   2.3   20   18-37      1-20  (163)
136 COG3640 CooC CO dehydrogenase   95.6   0.022 4.8E-07   44.8   4.7   21   17-37      2-22  (255)
137 PRK05057 aroK shikimate kinase  95.6   0.012 2.6E-07   43.7   3.1   23   15-37      4-26  (172)
138 PRK08903 DnaA regulatory inact  95.6   0.018   4E-07   44.2   4.3   26   13-38     40-65  (227)
139 PF01926 MMR_HSR1:  50S ribosom  95.6   0.012 2.7E-07   40.2   3.0   21   18-38      2-22  (116)
140 PRK13231 nitrogenase reductase  95.6   0.013 2.7E-07   46.2   3.3   24   15-38      2-25  (264)
141 TIGR00041 DTMP_kinase thymidyl  95.6   0.043 9.3E-07   40.9   6.1   23   16-38      4-26  (195)
142 PF02374 ArsA_ATPase:  Anion-tr  95.6   0.019 4.2E-07   46.6   4.4   23   15-37      1-23  (305)
143 cd01983 Fer4_NifH The Fer4_Nif  95.6   0.011 2.4E-07   38.2   2.5   21   17-37      1-21  (99)
144 cd04163 Era Era subfamily.  Er  95.5   0.016 3.4E-07   40.9   3.5   24   15-38      3-26  (168)
145 PRK13233 nifH nitrogenase redu  95.5   0.012 2.7E-07   46.5   3.1   22   16-37      3-24  (275)
146 PF05621 TniB:  Bacterial TniB   95.5   0.093   2E-06   42.7   8.2   58   13-71     59-121 (302)
147 PRK06761 hypothetical protein;  95.5   0.031 6.7E-07   45.1   5.4   23   16-38      4-26  (282)
148 smart00173 RAS Ras subfamily o  95.5   0.015 3.2E-07   41.7   3.3   22   17-38      2-23  (164)
149 cd04159 Arl10_like Arl10-like   95.5   0.016 3.4E-07   40.7   3.3   21   18-38      2-22  (159)
150 TIGR00750 lao LAO/AO transport  95.5   0.019 4.2E-07   46.4   4.2   26   12-37     31-56  (300)
151 COG1703 ArgK Putative periplas  95.5   0.022 4.8E-07   46.3   4.4   61    3-63     39-99  (323)
152 COG1936 Predicted nucleotide k  95.5   0.011 2.5E-07   44.3   2.6   20   17-36      2-21  (180)
153 cd01858 NGP_1 NGP-1.  Autoanti  95.5   0.023   5E-07   41.2   4.2   25   15-39    102-126 (157)
154 TIGR03574 selen_PSTK L-seryl-t  95.5   0.012 2.5E-07   46.1   2.8   20   18-37      2-21  (249)
155 COG1474 CDC6 Cdc6-related prot  95.5   0.057 1.2E-06   45.1   7.0   52   18-71     45-98  (366)
156 PF08423 Rad51:  Rad51;  InterP  95.5   0.046 9.9E-07   43.3   6.1   57   13-70     36-96  (256)
157 TIGR00231 small_GTP small GTP-  95.5   0.015 3.2E-07   40.4   3.0   23   17-39      3-25  (161)
158 PRK13695 putative NTPase; Prov  95.5   0.017 3.8E-07   42.6   3.5   21   18-38      3-23  (174)
159 cd03116 MobB Molybdenum is an   95.5   0.016 3.4E-07   42.8   3.2   22   16-37      2-23  (159)
160 cd04138 H_N_K_Ras_like H-Ras/N  95.5   0.016 3.5E-07   41.1   3.3   21   18-38      4-24  (162)
161 COG2019 AdkA Archaeal adenylat  95.4   0.016 3.5E-07   43.4   3.3   23   15-37      4-26  (189)
162 PF00005 ABC_tran:  ABC transpo  95.4   0.015 3.3E-07   40.8   3.0   34   15-51     11-44  (137)
163 TIGR02238 recomb_DMC1 meiotic   95.4   0.049 1.1E-06   44.5   6.3   57   13-70     94-154 (313)
164 cd00154 Rab Rab family.  Rab G  95.4   0.016 3.4E-07   40.6   3.0   22   18-39      3-24  (159)
165 COG0563 Adk Adenylate kinase a  95.4   0.014 2.9E-07   43.9   2.7   22   17-38      2-23  (178)
166 cd00876 Ras Ras family.  The R  95.4   0.018 3.9E-07   40.7   3.3   21   18-38      2-22  (160)
167 PF07693 KAP_NTPase:  KAP famil  95.4   0.083 1.8E-06   42.4   7.5   66    4-71      8-81  (325)
168 PRK14490 putative bifunctional  95.4   0.027 5.9E-07   46.8   4.7   24   14-37      4-27  (369)
169 PRK03731 aroL shikimate kinase  95.3   0.014   3E-07   42.8   2.6   22   16-37      3-24  (171)
170 cd01862 Rab7 Rab7 subfamily.    95.3   0.016 3.5E-07   41.7   3.0   21   18-38      3-23  (172)
171 TIGR03877 thermo_KaiC_1 KaiC d  95.3   0.091   2E-06   40.9   7.3   53   11-67     17-69  (237)
172 PLN03187 meiotic recombination  95.3   0.061 1.3E-06   44.6   6.6   57   13-70    124-184 (344)
173 PRK05973 replicative DNA helic  95.3   0.076 1.7E-06   41.8   6.8   53   11-67     60-112 (237)
174 cd01428 ADK Adenylate kinase (  95.3   0.015 3.3E-07   43.2   2.8   20   18-37      2-21  (194)
175 PRK00440 rfc replication facto  95.3    0.18 3.8E-06   40.3   9.1   24   15-38     38-61  (319)
176 COG1763 MobB Molybdopterin-gua  95.3   0.015 3.3E-07   43.1   2.6   23   15-37      2-24  (161)
177 PRK08356 hypothetical protein;  95.3   0.022 4.7E-07   43.0   3.6   21   15-35      5-25  (195)
178 KOG0741 AAA+-type ATPase [Post  95.3    0.16 3.4E-06   44.7   9.1   36   13-52    536-571 (744)
179 cd04113 Rab4 Rab4 subfamily.    95.3   0.018 3.9E-07   41.2   3.0   22   18-39      3-24  (161)
180 COG1419 FlhF Flagellar GTP-bin  95.3   0.025 5.4E-07   47.7   4.2   22   14-35    202-224 (407)
181 PRK09825 idnK D-gluconate kina  95.3   0.017 3.8E-07   43.1   3.0   22   16-37      4-25  (176)
182 PRK00698 tmk thymidylate kinas  95.3   0.019   4E-07   43.1   3.2   22   16-37      4-25  (205)
183 TIGR01281 DPOR_bchL light-inde  95.2   0.017 3.7E-07   45.5   3.0   21   17-37      2-22  (268)
184 smart00175 RAB Rab subfamily o  95.2   0.019   4E-07   41.0   3.0   22   18-39      3-24  (164)
185 COG1102 Cmk Cytidylate kinase   95.2   0.014 3.1E-07   43.5   2.3   21   17-37      2-22  (179)
186 TIGR02881 spore_V_K stage V sp  95.2    0.02 4.3E-07   45.2   3.3   24   14-37     41-64  (261)
187 PRK14737 gmk guanylate kinase;  95.2   0.023   5E-07   42.8   3.6   24   14-37      3-26  (186)
188 cd04177 RSR1 RSR1 subgroup.  R  95.2   0.021 4.6E-07   41.4   3.3   22   18-39      4-25  (168)
189 TIGR03499 FlhF flagellar biosy  95.2   0.021 4.6E-07   45.8   3.5   24   14-37    193-216 (282)
190 PRK13768 GTPase; Provisional    95.2    0.02 4.4E-07   45.2   3.3   23   15-37      2-24  (253)
191 PF03266 NTPase_1:  NTPase;  In  95.2   0.017 3.7E-07   42.9   2.7   21   18-38      2-22  (168)
192 PRK13185 chlL protochlorophyll  95.2    0.02 4.3E-07   45.1   3.3   22   16-37      3-24  (270)
193 cd00983 recA RecA is a  bacter  95.2   0.046   1E-06   44.9   5.5   46   12-59     52-97  (325)
194 cd00878 Arf_Arl Arf (ADP-ribos  95.2   0.019 4.2E-07   40.9   2.9   22   18-39      2-23  (158)
195 COG0237 CoaE Dephospho-CoA kin  95.2    0.02 4.4E-07   43.9   3.2   23   15-37      2-24  (201)
196 PRK14527 adenylate kinase; Pro  95.2   0.021 4.5E-07   42.8   3.2   24   14-37      5-28  (191)
197 PF03029 ATP_bind_1:  Conserved  95.2   0.021 4.6E-07   44.8   3.3   19   20-38      1-19  (238)
198 PLN03186 DNA repair protein RA  95.2   0.066 1.4E-06   44.3   6.3   57   13-70    121-181 (342)
199 COG2255 RuvB Holliday junction  95.1   0.017 3.8E-07   46.7   2.8   32   12-45     49-80  (332)
200 COG0468 RecA RecA/RadA recombi  95.1   0.093   2E-06   42.3   7.0   50   12-63     57-106 (279)
201 PRK07003 DNA polymerase III su  95.1    0.15 3.3E-06   46.5   9.0   23   15-37     38-60  (830)
202 cd01673 dNK Deoxyribonucleosid  95.1   0.016 3.4E-07   43.3   2.5   22   17-38      1-22  (193)
203 cd04136 Rap_like Rap-like subf  95.1   0.023 5.1E-07   40.5   3.3   22   17-38      3-24  (163)
204 PRK10463 hydrogenase nickel in  95.1   0.045 9.8E-07   44.3   5.2   26   12-37    101-126 (290)
205 PRK08099 bifunctional DNA-bind  95.1   0.018 3.9E-07   48.6   3.0   25   13-37    217-241 (399)
206 TIGR02528 EutP ethanolamine ut  95.1    0.02 4.4E-07   40.2   2.9   23   17-39      2-24  (142)
207 smart00072 GuKc Guanylate kina  95.1   0.029 6.2E-07   41.9   3.8   24   15-38      2-25  (184)
208 PLN02200 adenylate kinase fami  95.1   0.024 5.1E-07   44.4   3.5   24   14-37     42-65  (234)
209 cd02032 Bchl_like This family   95.1    0.02 4.3E-07   45.1   3.1   21   17-37      2-22  (267)
210 PRK08727 hypothetical protein;  95.1   0.024 5.2E-07   44.1   3.5   39   15-55     41-79  (233)
211 PRK06620 hypothetical protein;  95.1    0.02 4.3E-07   44.2   3.0   23   16-38     45-67  (214)
212 cd00879 Sar1 Sar1 subfamily.    95.1   0.043 9.4E-07   40.5   4.7   24   15-38     19-42  (190)
213 PRK09087 hypothetical protein;  95.1   0.038 8.3E-07   42.9   4.5   24   15-38     44-67  (226)
214 PRK14532 adenylate kinase; Pro  95.1   0.019 4.2E-07   42.7   2.8   20   18-37      3-22  (188)
215 TIGR01242 26Sp45 26S proteasom  95.1   0.022 4.8E-07   47.1   3.3   23   15-37    156-178 (364)
216 cd01878 HflX HflX subfamily.    95.1   0.031 6.8E-07   41.9   3.9   27   13-39     39-65  (204)
217 cd01130 VirB11-like_ATPase Typ  95.1   0.024 5.3E-07   42.4   3.3   23   15-37     25-47  (186)
218 PRK01184 hypothetical protein;  95.1   0.019 4.1E-07   42.6   2.7   19   16-34      2-20  (184)
219 PRK12402 replication factor C   95.1   0.033 7.1E-07   45.0   4.3   22   16-37     37-58  (337)
220 PRK00771 signal recognition pa  95.1   0.084 1.8E-06   45.1   6.9   24   14-37     94-117 (437)
221 COG0703 AroK Shikimate kinase   95.0   0.021 4.5E-07   42.8   2.8   21   17-37      4-24  (172)
222 PHA02530 pseT polynucleotide k  95.0   0.023 4.9E-07   45.4   3.2   22   16-37      3-24  (300)
223 PRK13341 recombination factor   95.0   0.033 7.2E-07   50.4   4.6   30   14-45     51-80  (725)
224 PLN02348 phosphoribulokinase    95.0   0.034 7.4E-07   46.8   4.3   26   12-37     46-71  (395)
225 cd04124 RabL2 RabL2 subfamily.  95.0   0.023   5E-07   41.0   3.0   21   18-38      3-23  (161)
226 TIGR02016 BchX chlorophyllide   95.0   0.021 4.5E-07   46.2   2.9   22   16-37      1-22  (296)
227 COG1126 GlnQ ABC-type polar am  95.0   0.022 4.9E-07   44.4   3.0   25   14-38     27-51  (240)
228 cd02022 DPCK Dephospho-coenzym  95.0   0.019   4E-07   42.8   2.5   21   17-37      1-21  (179)
229 cd03255 ABC_MJ0796_Lo1CDE_FtsE  95.0   0.023   5E-07   43.3   3.1   24   15-38     30-53  (218)
230 cd03225 ABC_cobalt_CbiO_domain  95.0   0.024 5.1E-07   43.0   3.1   25   14-38     26-50  (211)
231 cd01876 YihA_EngB The YihA (En  95.0   0.022 4.8E-07   40.3   2.7   19   18-36      2-20  (170)
232 PRK13234 nifH nitrogenase redu  95.0   0.026 5.6E-07   45.5   3.4   24   14-37      3-26  (295)
233 TIGR02239 recomb_RAD51 DNA rep  95.0    0.08 1.7E-06   43.3   6.3   51   12-62     93-147 (316)
234 PRK07952 DNA replication prote  95.0   0.041 8.9E-07   43.4   4.4   37   15-53     99-135 (244)
235 PF00308 Bac_DnaA:  Bacterial d  94.9    0.09   2E-06   40.6   6.3   25   13-37     32-56  (219)
236 cd04123 Rab21 Rab21 subfamily.  94.9   0.025 5.5E-07   40.0   3.0   21   18-38      3-23  (162)
237 PRK08116 hypothetical protein;  94.9   0.038 8.3E-07   44.1   4.3   36   16-53    115-150 (268)
238 cd01898 Obg Obg subfamily.  Th  94.9   0.023 5.1E-07   40.9   2.8   21   18-38      3-23  (170)
239 PRK12377 putative replication   94.9   0.028 6.1E-07   44.5   3.4   38   15-54    101-138 (248)
240 cd00820 PEPCK_HprK Phosphoenol  94.9   0.028 6.1E-07   38.9   3.1   22   15-36     15-36  (107)
241 PRK06067 flagellar accessory p  94.9    0.11 2.4E-06   40.1   6.8   51   11-65     21-71  (234)
242 PRK08533 flagellar accessory p  94.9   0.086 1.9E-06   41.0   6.1   50   13-66     22-71  (230)
243 cd03115 SRP The signal recogni  94.9   0.027 5.8E-07   41.4   3.1   21   17-37      2-22  (173)
244 cd01864 Rab19 Rab19 subfamily.  94.9   0.039 8.5E-07   39.7   4.0   24   15-38      3-26  (165)
245 TIGR00960 3a0501s02 Type II (G  94.9   0.026 5.5E-07   43.0   3.1   23   15-37     29-51  (216)
246 PF13086 AAA_11:  AAA domain; P  94.9   0.032   7E-07   41.9   3.6   52   17-68     19-75  (236)
247 cd03114 ArgK-like The function  94.9   0.022 4.9E-07   41.3   2.6   21   17-37      1-21  (148)
248 TIGR00455 apsK adenylylsulfate  94.9   0.032 6.9E-07   41.5   3.5   24   14-37     17-40  (184)
249 cd00984 DnaB_C DnaB helicase C  94.9    0.14 2.9E-06   39.5   7.1   56   11-69      9-64  (242)
250 PRK04195 replication factor C   94.9   0.031 6.8E-07   48.0   3.9   36    3-38     25-62  (482)
251 cd03297 ABC_ModC_molybdenum_tr  94.9    0.03 6.4E-07   42.6   3.3   25   13-38     22-46  (214)
252 COG0194 Gmk Guanylate kinase [  94.9   0.038 8.3E-07   41.9   3.8   25   15-39      4-28  (191)
253 cd04137 RheB Rheb (Ras Homolog  94.9    0.03 6.5E-07   40.9   3.2   23   16-38      2-24  (180)
254 cd04171 SelB SelB subfamily.    94.9   0.028 6.1E-07   40.0   3.0   21   17-37      2-22  (164)
255 TIGR00678 holB DNA polymerase   94.8    0.42 9.1E-06   35.5   9.5   23   15-37     14-36  (188)
256 TIGR02012 tigrfam_recA protein  94.8   0.078 1.7E-06   43.5   5.8   44   12-57     52-95  (321)
257 cd00157 Rho Rho (Ras homology)  94.8   0.028 6.1E-07   40.4   3.0   22   18-39      3-24  (171)
258 cd01131 PilT Pilus retraction   94.8   0.043 9.2E-07   41.6   4.1   22   16-37      2-23  (198)
259 PRK10416 signal recognition pa  94.8   0.032 6.9E-07   45.7   3.6   24   14-37    113-136 (318)
260 cd01124 KaiC KaiC is a circadi  94.8   0.038 8.2E-07   40.7   3.7   44   18-65      2-45  (187)
261 PF00071 Ras:  Ras family;  Int  94.8   0.034 7.3E-07   39.7   3.4   22   18-39      2-23  (162)
262 TIGR00362 DnaA chromosomal rep  94.8   0.086 1.9E-06   44.2   6.2   36   15-52    136-173 (405)
263 cd01860 Rab5_related Rab5-rela  94.8   0.029 6.3E-07   40.1   3.0   23   17-39      3-25  (163)
264 smart00178 SAR Sar1p-like memb  94.8   0.053 1.2E-06   40.2   4.5   24   15-38     17-40  (184)
265 cd04160 Arfrp1 Arfrp1 subfamil  94.8   0.027 5.8E-07   40.5   2.8   20   18-37      2-21  (167)
266 TIGR01166 cbiO cobalt transpor  94.7    0.03 6.5E-07   41.8   3.1   23   15-37     18-40  (190)
267 cd04140 ARHI_like ARHI subfami  94.7    0.03 6.6E-07   40.4   3.0   22   17-38      3-24  (165)
268 cd03229 ABC_Class3 This class   94.7   0.031 6.8E-07   41.4   3.1   23   15-37     26-48  (178)
269 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  94.7   0.031 6.7E-07   40.2   3.0   22   17-38      4-25  (166)
270 cd01897 NOG NOG1 is a nucleola  94.7    0.03 6.6E-07   40.2   3.0   22   17-38      2-23  (168)
271 cd03261 ABC_Org_Solvent_Resist  94.7    0.03 6.5E-07   43.2   3.1   24   15-38     26-49  (235)
272 PLN02796 D-glycerate 3-kinase   94.7   0.034 7.3E-07   46.1   3.5   24   14-37     99-122 (347)
273 cd03263 ABC_subfamily_A The AB  94.7    0.03 6.5E-07   42.7   3.0   24   15-38     28-51  (220)
274 cd03269 ABC_putative_ATPase Th  94.7   0.031 6.7E-07   42.3   3.1   24   15-38     26-49  (210)
275 cd03259 ABC_Carb_Solutes_like   94.7   0.032 6.9E-07   42.4   3.1   23   15-37     26-48  (213)
276 cd03293 ABC_NrtD_SsuB_transpor  94.7   0.031 6.7E-07   42.7   3.0   24   15-38     30-53  (220)
277 KOG2543 Origin recognition com  94.7    0.11 2.4E-06   43.7   6.4   51   16-71     31-81  (438)
278 PRK14531 adenylate kinase; Pro  94.7   0.032 6.9E-07   41.6   3.0   21   17-37      4-24  (183)
279 cd03260 ABC_PstB_phosphate_tra  94.7   0.033 7.1E-07   42.7   3.1   23   15-37     26-48  (227)
280 TIGR03878 thermo_KaiC_2 KaiC d  94.6   0.033 7.2E-07   44.1   3.2   41   13-55     34-74  (259)
281 TIGR03881 KaiC_arch_4 KaiC dom  94.6     0.2 4.3E-06   38.4   7.5   51   11-65     16-66  (229)
282 TIGR02673 FtsE cell division A  94.6   0.033 7.1E-07   42.3   3.1   23   15-37     28-50  (214)
283 PRK11889 flhF flagellar biosyn  94.6   0.034 7.3E-07   47.2   3.3   24   14-37    240-263 (436)
284 PLN03025 replication factor C   94.6   0.047   1E-06   44.4   4.1   21   17-37     36-56  (319)
285 PTZ00088 adenylate kinase 1; P  94.6   0.029 6.2E-07   43.8   2.8   20   18-37      9-28  (229)
286 PRK05642 DNA replication initi  94.6   0.042 9.1E-07   42.8   3.7   38   15-54     45-82  (234)
287 TIGR02315 ABC_phnC phosphonate  94.6   0.033 7.1E-07   43.1   3.1   23   15-37     28-50  (243)
288 cd03256 ABC_PhnC_transporter A  94.6   0.033 7.2E-07   43.0   3.1   23   15-37     27-49  (241)
289 cd00880 Era_like Era (E. coli   94.6    0.02 4.3E-07   39.7   1.7   19   20-38      1-19  (163)
290 cd04146 RERG_RasL11_like RERG/  94.6   0.038 8.2E-07   39.8   3.2   20   18-37      2-21  (165)
291 cd01122 GP4d_helicase GP4d_hel  94.6    0.12 2.6E-06   40.6   6.3   52   15-70     30-82  (271)
292 PF06564 YhjQ:  YhjQ protein;    94.6   0.033 7.2E-07   44.0   3.1   23   15-37      1-24  (243)
293 TIGR02903 spore_lon_C ATP-depe  94.6   0.047   1E-06   48.5   4.3   26   15-40    175-200 (615)
294 cd03235 ABC_Metallic_Cations A  94.6   0.032   7E-07   42.3   2.9   24   15-38     25-48  (213)
295 cd04101 RabL4 RabL4 (Rab-like4  94.6   0.035 7.7E-07   39.7   3.0   20   18-37      3-22  (164)
296 cd04135 Tc10 TC10 subfamily.    94.6   0.044 9.5E-07   39.7   3.5   21   18-38      3-23  (174)
297 PLN02924 thymidylate kinase     94.6    0.12 2.6E-06   40.0   6.2   25   14-38     15-39  (220)
298 cd04154 Arl2 Arl2 subfamily.    94.6   0.055 1.2E-06   39.4   4.0   23   16-38     15-37  (173)
299 PRK12608 transcription termina  94.6   0.086 1.9E-06   44.2   5.6   54   16-71    134-190 (380)
300 COG1222 RPT1 ATP-dependent 26S  94.6    0.22 4.8E-06   41.6   7.8   24   15-38    185-208 (406)
301 COG4608 AppF ABC-type oligopep  94.6   0.056 1.2E-06   43.2   4.3   24   14-37     38-61  (268)
302 PRK13541 cytochrome c biogenes  94.5   0.036 7.8E-07   41.6   3.1   24   15-38     26-49  (195)
303 PRK10584 putative ABC transpor  94.5   0.035 7.7E-07   42.6   3.1   24   15-38     36-59  (228)
304 cd02026 PRK Phosphoribulokinas  94.5   0.027 5.9E-07   45.1   2.5   21   17-37      1-21  (273)
305 KOG1532 GTPase XAB1, interacts  94.5   0.036 7.9E-07   44.8   3.2   25   14-38     18-42  (366)
306 PF00406 ADK:  Adenylate kinase  94.5   0.028 6.1E-07   40.4   2.4   18   20-37      1-18  (151)
307 cd01855 YqeH YqeH.  YqeH is an  94.5   0.042 9.2E-07   41.0   3.4   36    3-38    115-150 (190)
308 TIGR03864 PQQ_ABC_ATP ABC tran  94.5   0.036 7.8E-07   42.8   3.1   24   15-38     27-50  (236)
309 PRK00454 engB GTP-binding prot  94.5   0.042   9E-07   40.7   3.3   26   13-38     22-47  (196)
310 cd03292 ABC_FtsE_transporter F  94.5   0.037 8.1E-07   41.9   3.1   24   15-38     27-50  (214)
311 PRK14949 DNA polymerase III su  94.5    0.25 5.5E-06   45.8   8.8   23   15-37     38-60  (944)
312 cd04162 Arl9_Arfrp2_like Arl9/  94.5   0.035 7.6E-07   40.4   2.8   21   18-38      2-22  (164)
313 PF03193 DUF258:  Protein of un  94.5   0.034 7.4E-07   41.2   2.8   24   16-39     36-59  (161)
314 cd03265 ABC_DrrA DrrA is the A  94.5   0.037 8.1E-07   42.2   3.1   24   15-38     26-49  (220)
315 cd03296 ABC_CysA_sulfate_impor  94.5   0.037 7.9E-07   42.9   3.1   24   15-38     28-51  (239)
316 PRK14974 cell division protein  94.5    0.04 8.7E-07   45.5   3.4   24   14-37    139-162 (336)
317 PRK09354 recA recombinase A; P  94.5    0.11 2.5E-06   43.1   6.0   46   12-59     57-102 (349)
318 PRK15455 PrkA family serine pr  94.5   0.049 1.1E-06   48.2   4.0   26   12-37    100-125 (644)
319 cd03224 ABC_TM1139_LivF_branch  94.5    0.04 8.6E-07   42.0   3.2   23   15-37     26-48  (222)
320 TIGR02211 LolD_lipo_ex lipopro  94.5   0.037 8.1E-07   42.2   3.0   24   15-38     31-54  (221)
321 cd04161 Arl2l1_Arl13_like Arl2  94.5   0.036 7.9E-07   40.4   2.9   21   18-38      2-22  (167)
322 cd03226 ABC_cobalt_CbiO_domain  94.5   0.038 8.3E-07   41.7   3.1   24   15-38     26-49  (205)
323 cd04108 Rab36_Rab34 Rab34/Rab3  94.4   0.049 1.1E-06   39.9   3.6   21   18-38      3-23  (170)
324 TIGR01351 adk adenylate kinase  94.4   0.034 7.3E-07   42.4   2.8   20   18-37      2-21  (210)
325 cd03264 ABC_drug_resistance_li  94.4   0.034 7.5E-07   42.1   2.8   21   17-37     27-47  (211)
326 TIGR03608 L_ocin_972_ABC putat  94.4   0.039 8.4E-07   41.6   3.1   23   15-37     24-46  (206)
327 cd03222 ABC_RNaseL_inhibitor T  94.4    0.04 8.6E-07   41.3   3.1   23   15-37     25-47  (177)
328 PRK12724 flagellar biosynthesi  94.4   0.073 1.6E-06   45.3   4.9   23   15-37    223-245 (432)
329 PRK00279 adk adenylate kinase;  94.4   0.034 7.5E-07   42.5   2.8   20   18-37      3-22  (215)
330 PF08433 KTI12:  Chromatin asso  94.4   0.036 7.7E-07   44.4   2.9   22   16-37      2-23  (270)
331 PRK14088 dnaA chromosomal repl  94.4    0.12 2.5E-06   44.2   6.2   36   15-52    130-167 (440)
332 cd04175 Rap1 Rap1 subgroup.  T  94.4   0.045 9.8E-07   39.3   3.2   22   17-38      3-24  (164)
333 cd01868 Rab11_like Rab11-like.  94.4   0.052 1.1E-06   38.9   3.6   24   16-39      4-27  (165)
334 TIGR00101 ureG urease accessor  94.4   0.054 1.2E-06   41.3   3.7   21   17-37      3-23  (199)
335 PRK13538 cytochrome c biogenes  94.4    0.04 8.6E-07   41.7   3.0   24   15-38     27-50  (204)
336 PRK13973 thymidylate kinase; P  94.4    0.15 3.2E-06   39.1   6.2   22   16-37      4-25  (213)
337 PRK08154 anaerobic benzoate ca  94.4   0.061 1.3E-06   43.7   4.3   25   13-37    131-155 (309)
338 cd04114 Rab30 Rab30 subfamily.  94.4   0.049 1.1E-06   39.2   3.4   24   14-37      6-29  (169)
339 PF00158 Sigma54_activat:  Sigm  94.4    0.19 4.1E-06   37.3   6.6   23   16-38     23-45  (168)
340 PRK11629 lolD lipoprotein tran  94.4    0.04 8.8E-07   42.5   3.1   24   15-38     35-58  (233)
341 cd02034 CooC The accessory pro  94.4    0.04 8.6E-07   38.5   2.8   20   18-37      2-21  (116)
342 COG0378 HypB Ni2+-binding GTPa  94.4   0.086 1.9E-06   40.4   4.7   31   15-47     13-43  (202)
343 cd03301 ABC_MalK_N The N-termi  94.4   0.042 9.1E-07   41.7   3.1   24   15-38     26-49  (213)
344 cd03258 ABC_MetN_methionine_tr  94.4   0.041 8.9E-07   42.3   3.1   24   15-38     31-54  (233)
345 cd04150 Arf1_5_like Arf1-Arf5-  94.4   0.038 8.1E-07   40.0   2.7   20   18-37      3-22  (159)
346 cd04156 ARLTS1 ARLTS1 subfamil  94.4   0.042 9.1E-07   39.2   2.9   22   18-39      2-23  (160)
347 TIGR00764 lon_rel lon-related   94.4   0.099 2.1E-06   46.5   5.8   52   17-71     39-91  (608)
348 PRK06851 hypothetical protein;  94.4   0.061 1.3E-06   45.0   4.2   45   14-60     29-74  (367)
349 PRK14958 DNA polymerase III su  94.3    0.37 8.1E-06   42.0   9.2   23   15-37     38-60  (509)
350 PRK02496 adk adenylate kinase;  94.3   0.045 9.8E-07   40.6   3.2   21   17-37      3-23  (184)
351 PRK14494 putative molybdopteri  94.3   0.043 9.4E-07   42.9   3.2   23   15-37      1-23  (229)
352 PRK05703 flhF flagellar biosyn  94.3   0.051 1.1E-06   46.2   3.8   23   15-37    221-243 (424)
353 cd01865 Rab3 Rab3 subfamily.    94.3   0.044 9.5E-07   39.6   3.0   23   17-39      3-25  (165)
354 cd03257 ABC_NikE_OppD_transpor  94.3   0.042   9E-07   42.0   3.0   24   15-38     31-54  (228)
355 PHA02544 44 clamp loader, smal  94.3   0.062 1.4E-06   43.2   4.2   23   15-37     43-65  (316)
356 PRK14528 adenylate kinase; Pro  94.3   0.043 9.4E-07   41.2   3.0   22   16-37      2-23  (186)
357 cd01866 Rab2 Rab2 subfamily.    94.3   0.042 9.1E-07   39.8   2.9   23   16-38      5-27  (168)
358 COG1120 FepC ABC-type cobalami  94.3   0.041   9E-07   43.8   3.0   24   14-37     27-50  (258)
359 cd04145 M_R_Ras_like M-Ras/R-R  94.3    0.05 1.1E-06   38.8   3.3   22   17-38      4-25  (164)
360 COG0125 Tmk Thymidylate kinase  94.3    0.12 2.6E-06   39.9   5.5   36   15-52      3-38  (208)
361 TIGR01184 ntrCD nitrate transp  94.3   0.044 9.5E-07   42.3   3.1   24   15-38     11-34  (230)
362 PRK05537 bifunctional sulfate   94.3   0.066 1.4E-06   47.2   4.5   25   13-37    390-414 (568)
363 PRK15177 Vi polysaccharide exp  94.3   0.042 9.1E-07   42.1   3.0   24   15-38     13-36  (213)
364 cd04118 Rab24 Rab24 subfamily.  94.3   0.044 9.5E-07   40.6   3.0   21   18-38      3-23  (193)
365 cd03237 ABC_RNaseL_inhibitor_d  94.3   0.043 9.4E-07   43.1   3.1   24   15-38     25-48  (246)
366 cd04115 Rab33B_Rab33A Rab33B/R  94.3   0.045 9.7E-07   39.8   3.0   23   16-38      3-25  (170)
367 cd04158 ARD1 ARD1 subfamily.    94.3   0.043 9.3E-07   39.9   2.9   21   18-38      2-22  (169)
368 PTZ00369 Ras-like protein; Pro  94.3   0.051 1.1E-06   40.4   3.3   22   17-38      7-28  (189)
369 PRK05416 glmZ(sRNA)-inactivati  94.3   0.048   1E-06   44.1   3.4   23   14-36      5-27  (288)
370 PRK14963 DNA polymerase III su  94.3   0.052 1.1E-06   47.2   3.8   24   15-38     36-59  (504)
371 cd03219 ABC_Mj1267_LivG_branch  94.3   0.042 9.1E-07   42.3   2.9   23   15-37     26-48  (236)
372 PLN02165 adenylate isopentenyl  94.3   0.046 9.9E-07   45.1   3.3   25   14-38     42-66  (334)
373 cd03238 ABC_UvrA The excision   94.2   0.043 9.2E-07   41.1   2.8   24   14-37     20-43  (176)
374 PHA02518 ParA-like protein; Pr  94.2   0.043 9.4E-07   41.2   2.9   21   17-37      2-23  (211)
375 PRK13531 regulatory ATPase Rav  94.2   0.048   1E-06   47.2   3.5   36    2-37     26-61  (498)
376 PRK04328 hypothetical protein;  94.2    0.23 4.9E-06   39.1   7.1   50   12-65     20-69  (249)
377 cd02030 NDUO42 NADH:Ubiquinone  94.2   0.036 7.8E-07   42.7   2.5   21   17-37      1-21  (219)
378 TIGR00991 3a0901s02IAP34 GTP-b  94.2   0.069 1.5E-06   43.7   4.2   37    3-39     23-62  (313)
379 PRK11248 tauB taurine transpor  94.2   0.045 9.7E-07   43.1   3.1   24   15-38     27-50  (255)
380 cd04107 Rab32_Rab38 Rab38/Rab3  94.2   0.043 9.3E-07   41.2   2.9   21   18-38      3-23  (201)
381 cd03218 ABC_YhbG The ABC trans  94.2   0.045 9.8E-07   42.0   3.1   24   15-38     26-49  (232)
382 cd01895 EngA2 EngA2 subfamily.  94.2   0.052 1.1E-06   38.6   3.2   23   16-38      3-25  (174)
383 TIGR02770 nickel_nikD nickel i  94.2   0.045 9.7E-07   42.2   3.0   24   15-38     12-35  (230)
384 PRK06851 hypothetical protein;  94.2   0.046   1E-06   45.7   3.3   45   15-60    214-258 (367)
385 PF10662 PduV-EutP:  Ethanolami  94.2   0.048   1E-06   39.7   3.0   24   16-39      2-25  (143)
386 PRK10247 putative ABC transpor  94.2   0.047   1E-06   42.0   3.1   24   15-38     33-56  (225)
387 PRK10867 signal recognition pa  94.2    0.11 2.4E-06   44.4   5.5   24   14-37     99-122 (433)
388 cd01861 Rab6 Rab6 subfamily.    94.2    0.05 1.1E-06   38.7   3.0   22   17-38      2-23  (161)
389 cd03268 ABC_BcrA_bacitracin_re  94.2   0.048   1E-06   41.2   3.1   23   15-37     26-48  (208)
390 cd04120 Rab12 Rab12 subfamily.  94.2   0.046   1E-06   41.7   3.0   21   18-38      3-23  (202)
391 cd01853 Toc34_like Toc34-like   94.2   0.088 1.9E-06   41.6   4.6   31    9-39     25-55  (249)
392 cd04122 Rab14 Rab14 subfamily.  94.2   0.057 1.2E-06   38.9   3.3   22   17-38      4-25  (166)
393 PRK11124 artP arginine transpo  94.2   0.047   1E-06   42.3   3.1   24   15-38     28-51  (242)
394 TIGR01978 sufC FeS assembly AT  94.2   0.047   1E-06   42.2   3.0   24   15-38     26-49  (243)
395 PRK10908 cell division protein  94.1   0.049 1.1E-06   41.7   3.1   25   14-38     27-51  (222)
396 PRK12338 hypothetical protein;  94.1   0.051 1.1E-06   44.6   3.3   24   15-38      4-27  (319)
397 cd04110 Rab35 Rab35 subfamily.  94.1   0.046 9.9E-07   41.1   2.9   24   15-38      6-29  (199)
398 PF00142 Fer4_NifH:  4Fe-4S iro  94.1   0.053 1.1E-06   43.4   3.3   22   16-37      1-22  (273)
399 PTZ00035 Rad51 protein; Provis  94.1    0.25 5.3E-06   40.8   7.4   50   13-62    116-169 (337)
400 cd04141 Rit_Rin_Ric Rit/Rin/Ri  94.1   0.049 1.1E-06   40.0   3.0   21   17-37      4-24  (172)
401 cd04116 Rab9 Rab9 subfamily.    94.1   0.063 1.4E-06   38.7   3.5   24   15-38      5-28  (170)
402 cd03295 ABC_OpuCA_Osmoprotecti  94.1   0.049 1.1E-06   42.3   3.1   24   15-38     27-50  (242)
403 PRK03992 proteasome-activating  94.1    0.04 8.7E-07   46.2   2.8   24   14-37    164-187 (389)
404 PF11868 DUF3388:  Protein of u  94.1   0.054 1.2E-06   40.3   3.1   43    4-55     41-87  (192)
405 PRK15467 ethanolamine utilizat  94.1   0.086 1.9E-06   38.3   4.2   24   16-39      2-25  (158)
406 CHL00181 cbbX CbbX; Provisiona  94.1   0.042 9.1E-07   44.3   2.8   21   17-37     61-81  (287)
407 PF13614 AAA_31:  AAA domain; P  94.1    0.13 2.9E-06   36.7   5.2   39   16-56      1-40  (157)
408 cd04127 Rab27A Rab27a subfamil  94.1   0.058 1.3E-06   39.3   3.3   22   17-38      6-27  (180)
409 cd04103 Centaurin_gamma Centau  94.1   0.051 1.1E-06   39.5   3.0   20   18-37      3-22  (158)
410 PRK14722 flhF flagellar biosyn  94.1   0.069 1.5E-06   44.7   4.1   23   15-37    137-159 (374)
411 TIGR01425 SRP54_euk signal rec  94.1   0.057 1.2E-06   46.0   3.6   24   14-37     99-122 (429)
412 PRK11300 livG leucine/isoleuci  94.1   0.051 1.1E-06   42.4   3.2   24   15-38     31-54  (255)
413 cd01870 RhoA_like RhoA-like su  94.1    0.06 1.3E-06   39.0   3.3   24   16-39      2-25  (175)
414 KOG3347 Predicted nucleotide k  94.1    0.04 8.7E-07   40.7   2.3   21   17-37      9-29  (176)
415 cd03262 ABC_HisP_GlnQ_permease  94.1   0.049 1.1E-06   41.2   3.0   23   15-37     26-48  (213)
416 PRK09183 transposase/IS protei  94.1   0.043 9.4E-07   43.5   2.7   22   16-37    103-124 (259)
417 cd00877 Ran Ran (Ras-related n  94.1   0.052 1.1E-06   39.5   3.0   21   17-37      2-22  (166)
418 cd02042 ParA ParA and ParB of   94.1   0.047   1E-06   36.6   2.5   21   17-37      1-22  (104)
419 TIGR02324 CP_lyasePhnL phospho  94.1   0.052 1.1E-06   41.5   3.1   24   15-38     34-57  (224)
420 cd04117 Rab15 Rab15 subfamily.  94.1   0.066 1.4E-06   38.6   3.5   21   18-38      3-23  (161)
421 cd00882 Ras_like_GTPase Ras-li  94.1   0.029 6.3E-07   38.2   1.5   20   20-39      1-20  (157)
422 CHL00072 chlL photochlorophyll  94.1   0.045 9.8E-07   44.1   2.9   20   18-37      3-22  (290)
423 PRK00149 dnaA chromosomal repl  94.1   0.071 1.5E-06   45.4   4.2   38   14-53    147-186 (450)
424 cd01867 Rab8_Rab10_Rab13_like   94.1   0.052 1.1E-06   39.3   3.0   23   16-38      4-26  (167)
425 cd04106 Rab23_lke Rab23-like s  94.1   0.051 1.1E-06   38.7   2.9   21   18-38      3-23  (162)
426 cd03252 ABCC_Hemolysin The ABC  94.1   0.052 1.1E-06   41.9   3.1   24   14-37     27-50  (237)
427 cd01887 IF2_eIF5B IF2/eIF5B (i  94.1   0.053 1.2E-06   38.8   3.0   22   17-38      2-23  (168)
428 PF00154 RecA:  recA bacterial   94.0     0.1 2.3E-06   42.8   5.0   47   13-61     51-97  (322)
429 PRK10536 hypothetical protein;  94.0    0.12 2.7E-06   41.2   5.2   32   16-47     75-106 (262)
430 PRK09493 glnQ glutamine ABC tr  94.0    0.05 1.1E-06   42.1   3.0   24   15-38     27-50  (240)
431 PRK00089 era GTPase Era; Revie  94.0   0.057 1.2E-06   43.1   3.4   25   14-38      4-28  (292)
432 cd04144 Ras2 Ras2 subfamily.    94.0   0.052 1.1E-06   40.4   3.0   21   18-38      2-22  (190)
433 PRK14242 phosphate transporter  94.0   0.053 1.1E-06   42.3   3.1   23   15-37     32-54  (253)
434 cd04128 Spg1 Spg1p.  Spg1p (se  94.0   0.066 1.4E-06   39.8   3.5   21   18-38      3-23  (182)
435 cd03232 ABC_PDR_domain2 The pl  94.0   0.054 1.2E-06   40.7   3.1   23   15-37     33-55  (192)
436 cd03266 ABC_NatA_sodium_export  94.0   0.053 1.2E-06   41.2   3.1   24   15-38     31-54  (218)
437 COG1116 TauB ABC-type nitrate/  94.0   0.053 1.2E-06   42.9   3.1   23   15-37     29-51  (248)
438 PRK07933 thymidylate kinase; V  94.0   0.051 1.1E-06   41.8   3.0   21   17-37      2-22  (213)
439 PRK06921 hypothetical protein;  94.0   0.072 1.6E-06   42.5   3.9   38   14-53    116-154 (266)
440 PRK07429 phosphoribulokinase;   94.0   0.062 1.3E-06   44.2   3.6   25   13-37      6-30  (327)
441 cd03278 ABC_SMC_barmotin Barmo  94.0    0.05 1.1E-06   41.3   2.9   21   17-37     24-44  (197)
442 TIGR00972 3a0107s01c2 phosphat  94.0   0.054 1.2E-06   42.2   3.1   24   14-37     26-49  (247)
443 PRK14245 phosphate ABC transpo  94.0   0.054 1.2E-06   42.2   3.1   22   15-36     29-50  (250)
444 PRK14247 phosphate ABC transpo  94.0   0.053 1.2E-06   42.2   3.1   23   15-37     29-51  (250)
445 cd04125 RabA_like RabA-like su  94.0   0.055 1.2E-06   40.0   3.0   21   18-38      3-23  (188)
446 PRK15453 phosphoribulokinase;   94.0   0.061 1.3E-06   43.5   3.4   24   14-37      4-27  (290)
447 PRK13539 cytochrome c biogenes  94.0   0.054 1.2E-06   41.1   3.0   25   14-38     27-51  (207)
448 PRK11264 putative amino-acid A  94.0   0.055 1.2E-06   42.1   3.1   24   15-38     29-52  (250)
449 smart00174 RHO Rho (Ras homolo  94.0   0.045 9.7E-07   39.6   2.4   21   18-38      1-21  (174)
450 cd04132 Rho4_like Rho4-like su  93.9   0.064 1.4E-06   39.4   3.3   23   17-39      2-24  (187)
451 TIGR01277 thiQ thiamine ABC tr  93.9   0.056 1.2E-06   41.1   3.0   24   15-38     24-47  (213)
452 PRK13540 cytochrome c biogenes  93.9   0.058 1.3E-06   40.6   3.1   25   14-38     26-50  (200)
453 TIGR01189 ccmA heme ABC export  93.9   0.059 1.3E-06   40.5   3.1   25   14-38     25-49  (198)
454 PRK14250 phosphate ABC transpo  93.9   0.057 1.2E-06   41.9   3.1   24   15-38     29-52  (241)
455 PF13245 AAA_19:  Part of AAA d  93.9    0.12 2.5E-06   33.4   4.0   23   15-37     10-33  (76)
456 COG1123 ATPase components of v  93.9    0.05 1.1E-06   47.5   3.0   23   15-37    317-339 (539)
457 PLN03046 D-glycerate 3-kinase;  93.9    0.22 4.9E-06   42.5   6.8   24   14-37    211-234 (460)
458 PRK13976 thymidylate kinase; P  93.9    0.14   3E-06   39.3   5.2   21   17-37      2-22  (209)
459 cd03230 ABC_DR_subfamily_A Thi  93.9    0.06 1.3E-06   39.7   3.1   24   15-38     26-49  (173)
460 PRK14274 phosphate ABC transpo  93.9   0.058 1.3E-06   42.3   3.1   23   15-37     38-60  (259)
461 TIGR00017 cmk cytidylate kinas  93.9    0.06 1.3E-06   41.6   3.1   22   16-37      3-24  (217)
462 PRK10619 histidine/lysine/argi  93.9   0.057 1.2E-06   42.3   3.1   25   14-38     30-54  (257)
463 cd03246 ABCC_Protease_Secretio  93.9   0.063 1.4E-06   39.6   3.1   23   15-37     28-50  (173)
464 cd03214 ABC_Iron-Siderophores_  93.9   0.059 1.3E-06   40.0   3.0   24   15-38     25-48  (180)
465 cd01891 TypA_BipA TypA (tyrosi  93.9   0.061 1.3E-06   40.1   3.1   23   15-37      2-24  (194)
466 PTZ00112 origin recognition co  93.9    0.22 4.8E-06   46.4   7.1   58   13-70    779-841 (1164)
467 cd03267 ABC_NatA_like Similar   93.9   0.059 1.3E-06   41.8   3.1   24   15-38     47-70  (236)
468 PRK12422 chromosomal replicati  93.9    0.12 2.6E-06   44.3   5.2   23   15-37    141-163 (445)
469 PRK11022 dppD dipeptide transp  93.9   0.056 1.2E-06   44.2   3.1   24   15-38     33-56  (326)
470 PRK14241 phosphate transporter  93.9   0.059 1.3E-06   42.3   3.1   23   15-37     30-52  (258)
471 PTZ00133 ADP-ribosylation fact  93.8   0.057 1.2E-06   40.1   2.9   23   16-38     18-40  (182)
472 cd04148 RGK RGK subfamily.  Th  93.8   0.069 1.5E-06   41.1   3.4   20   18-37      3-22  (221)
473 PRK14730 coaE dephospho-CoA ki  93.8   0.059 1.3E-06   40.9   3.0   22   16-37      2-23  (195)
474 TIGR03598 GTPase_YsxC ribosome  93.8    0.07 1.5E-06   39.3   3.3   27   13-39     16-42  (179)
475 TIGR03600 phage_DnaB phage rep  93.8    0.28   6E-06   41.4   7.3   56   13-71    192-247 (421)
476 PRK10575 iron-hydroxamate tran  93.8   0.055 1.2E-06   42.7   2.9   24   15-38     37-60  (265)
477 PRK11247 ssuB aliphatic sulfon  93.8    0.06 1.3E-06   42.5   3.1   24   15-38     38-61  (257)
478 cd03247 ABCC_cytochrome_bd The  93.8   0.059 1.3E-06   39.8   2.9   24   15-38     28-51  (178)
479 cd03249 ABC_MTABC3_MDL1_MDL2 M  93.8    0.06 1.3E-06   41.5   3.1   25   14-38     28-52  (238)
480 PRK09544 znuC high-affinity zi  93.8    0.06 1.3E-06   42.3   3.1   24   15-38     30-53  (251)
481 cd03215 ABC_Carb_Monos_II This  93.8   0.063 1.4E-06   39.9   3.0   24   15-38     26-49  (182)
482 cd03221 ABCF_EF-3 ABCF_EF-3  E  93.8   0.064 1.4E-06   38.5   3.0   24   15-38     26-49  (144)
483 KOG0781 Signal recognition par  93.8    0.15 3.2E-06   44.1   5.5   39   12-52    375-414 (587)
484 PF03215 Rad17:  Rad17 cell cyc  93.8    0.12 2.5E-06   45.2   5.0   47    2-52     29-78  (519)
485 PRK14239 phosphate transporter  93.8   0.061 1.3E-06   41.9   3.1   23   15-37     31-53  (252)
486 PF06309 Torsin:  Torsin;  Inte  93.8    0.14 3.1E-06   36.5   4.6   26   12-37     50-75  (127)
487 KOG0744 AAA+-type ATPase [Post  93.8   0.055 1.2E-06   44.7   2.8   38   16-53    178-217 (423)
488 cd01874 Cdc42 Cdc42 subfamily.  93.8   0.073 1.6E-06   39.2   3.3   22   17-38      3-24  (175)
489 PRK06526 transposase; Provisio  93.8   0.052 1.1E-06   43.0   2.7   23   15-37     98-120 (254)
490 PRK10744 pstB phosphate transp  93.8   0.062 1.3E-06   42.2   3.1   23   15-37     39-61  (260)
491 PRK14238 phosphate transporter  93.8   0.062 1.4E-06   42.6   3.1   23   15-37     50-72  (271)
492 cd03273 ABC_SMC2_euk Eukaryoti  93.8   0.063 1.4E-06   42.0   3.1   23   15-37     25-47  (251)
493 PRK10895 lipopolysaccharide AB  93.7   0.062 1.3E-06   41.6   3.0   24   15-38     29-52  (241)
494 cd03223 ABCD_peroxisomal_ALDP   93.7   0.063 1.4E-06   39.4   2.9   24   15-38     27-50  (166)
495 cd03234 ABCG_White The White s  93.7   0.069 1.5E-06   41.0   3.3   24   15-38     33-56  (226)
496 cd01892 Miro2 Miro2 subfamily.  93.7   0.089 1.9E-06   38.4   3.7   25   15-39      4-28  (169)
497 cd04151 Arl1 Arl1 subfamily.    93.7   0.059 1.3E-06   38.6   2.7   20   18-37      2-21  (158)
498 TIGR03410 urea_trans_UrtE urea  93.7   0.063 1.4E-06   41.2   3.0   24   14-37     25-48  (230)
499 PF07724 AAA_2:  AAA domain (Cd  93.7    0.14 3.1E-06   38.1   4.8   39   15-55      3-42  (171)
500 PHA02575 1 deoxynucleoside mon  93.7   0.062 1.3E-06   42.0   2.9   21   17-37      2-22  (227)

No 1  
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]
Probab=99.94  E-value=4.7e-27  Score=211.16  Aligned_cols=144  Identities=17%  Similarity=0.281  Sum_probs=116.8

Q ss_pred             HHHHHHHhcCCCCcEEEEEEcCCCccHHHHHHHHhcccc-ccccCceEEEEEcCCCCCHHHHHHHHHHHhCCCCc-----
Q 035574            2 EELLDLLIEGPTQLSVVAILDSIGLDKTAFTAEAYNSSY-MKHYFDYLAWIPAPYHYDPDQILDIVAVILLPFSM-----   75 (156)
Q Consensus         2 ~~l~~~L~~~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~-v~~~F~~~~wv~vs~~~~~~~l~~~il~~l~~~~~-----   75 (156)
                      +++.+.|.+++.  .+++|+||||+||||||++++|+.. ++++||..+||+||+.|+...++++|+..+...+.     
T Consensus       168 ~kl~~~L~~d~~--~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~  245 (889)
T KOG4658|consen  168 EKLWNRLMEDDV--GIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDK  245 (889)
T ss_pred             HHHHHHhccCCC--CEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchh
Confidence            456666666554  9999999999999999999999988 99999999999999999999999999998764111     


Q ss_pred             ----------------------------------cccCCCCCCCeEEEEEcCCHHHHhh-cCcCcccccccc--------
Q 035574           76 ----------------------------------FKILPDNQNGSRVLITLTQIKMVTS-FQLEDRENIRLD--------  112 (156)
Q Consensus        76 ----------------------------------~~~l~~~~~gsrIivTTR~~~Va~~-~~~~~~~~~~l~--------  112 (156)
                                                        ..+||...+||+|++|||++.||.. |+.+.  .+++.        
T Consensus       246 ~~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~--~~~v~~L~~~eaW  323 (889)
T KOG4658|consen  246 EEDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDY--PIEVECLTPEEAW  323 (889)
T ss_pred             hHHHHHHHHHHHhccCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCc--cccccccCccccH
Confidence                                              6789988889999999999999998 76532  12222        


Q ss_pred             -----------------ccCChhhHhhhcCChHHHHHHHhCCCCccchhhhhhc
Q 035574          113 -----------------LVPTGGPLRATYQGWPFLILYHGSISLEENIEEVFNI  149 (156)
Q Consensus       113 -----------------~~~~~~~i~~~~~g~pl~~~~~gs~~~~~~~~~~~~~  149 (156)
                                       ....|+.++++|.|+|||+.++|++...+.+...|+.
T Consensus       324 ~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~  377 (889)
T KOG4658|consen  324 DLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRR  377 (889)
T ss_pred             HHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHH
Confidence                             3446788999999999999999997554444445543


No 2  
>PF00931 NB-ARC:  NB-ARC domain;  InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []. This domain has been structurally characterised in the human protein apoptotic protease-activating factor 1 (Apaf-1) []. It contains the three-layered alpha-beta fold and subsequent short alpha-helical region characteristic of the AAA+ ATPase domain superfamily. While this domain is thought to bind and hyrolyse ATP, only ADP binding has been experimentally verified. It is proposed that binding and hydrolysis of ATP by this domain induces conformational changes the the overall protein, leading to formation of the apoptosome.; GO: 0043531 ADP binding; PDB: 3IZA_E 1Z6T_D 3SFZ_A 3SHF_A 1VT4_M 3IZ8_G 3LQR_A 2A5Y_C 3LQQ_A.
Probab=99.89  E-value=7.9e-24  Score=167.87  Aligned_cols=136  Identities=23%  Similarity=0.295  Sum_probs=102.9

Q ss_pred             HHHHHHHhcCCCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHHHHHHhCCC-----Cc-
Q 035574            2 EELLDLLIEGPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDIVAVILLPF-----SM-   75 (156)
Q Consensus         2 ~~l~~~L~~~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~il~~l~~~-----~~-   75 (156)
                      +++.++|.+...+.++|+|+||||+||||||.++|++..++.+|+.++|+.+++..+..++++.|+.++...     .. 
T Consensus         6 ~~l~~~L~~~~~~~~~v~I~G~~G~GKT~LA~~~~~~~~~~~~f~~v~wv~~~~~~~~~~~~~~i~~~l~~~~~~~~~~~   85 (287)
T PF00931_consen    6 EKLKDWLLDNSNEVRVVAIVGMGGIGKTTLARQVARDLRIKNRFDGVIWVSLSKNPSLEQLLEQILRQLGEPDSSISDPK   85 (287)
T ss_dssp             HHHHHHHHTTTTSSEEEEEEESTTSSHHHHHHHHHCHHHHCCCCTEEEEEEEES-SCCHHHHHHHHHHHTCC-STSSCCS
T ss_pred             HHHHHHhhCCCCCeEEEEEEcCCcCCcceeeeeccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            467777777668899999999999999999999999777999999999999999999999999999998643     11 


Q ss_pred             ----------------------------------cccCCCCCCCeEEEEEcCCHHHHhhcCcCcccccc-----------
Q 035574           76 ----------------------------------FKILPDNQNGSRVLITLTQIKMVTSFQLEDRENIR-----------  110 (156)
Q Consensus        76 ----------------------------------~~~l~~~~~gsrIivTTR~~~Va~~~~~~~~~~~~-----------  110 (156)
                                                        ...++....||+||||||+..++..++.. ...++           
T Consensus        86 ~~~~~~~~l~~~L~~~~~LlVlDdv~~~~~~~~l~~~~~~~~~~~kilvTTR~~~v~~~~~~~-~~~~~l~~L~~~ea~~  164 (287)
T PF00931_consen   86 DIEELQDQLRELLKDKRCLLVLDDVWDEEDLEELREPLPSFSSGSKILVTTRDRSVAGSLGGT-DKVIELEPLSEEEALE  164 (287)
T ss_dssp             SHHHHHHHHHHHHCCTSEEEEEEEE-SHHHH-------HCHHSS-EEEEEESCGGGGTTHHSC-EEEEECSS--HHHHHH
T ss_pred             ccccccccchhhhccccceeeeeeecccccccccccccccccccccccccccccccccccccc-cccccccccccccccc
Confidence                                              23345556799999999999998765421 00111           


Q ss_pred             --------------ccccCChhhHhhhcCChHHHHHHHhCCC
Q 035574          111 --------------LDLVPTGGPLRATYQGWPFLILYHGSIS  138 (156)
Q Consensus       111 --------------l~~~~~~~~i~~~~~g~pl~~~~~gs~~  138 (156)
                                    ......+..|+..|+|+|||+.++|++.
T Consensus       165 L~~~~~~~~~~~~~~~~~~~~~~i~~~c~glPLal~~~a~~l  206 (287)
T PF00931_consen  165 LFKKRAGRKESESPEDLEDLAKEIVEKCGGLPLALKLIASYL  206 (287)
T ss_dssp             HHHHHHTSHS----TTSCTHHHHHHHHTTT-HHHHHHHHHHH
T ss_pred             cccccccccccccccccccccccccccccccccccccccccc
Confidence                          1223446789999999999999998854


No 3  
>PLN03210 Resistant to P. syringae 6; Provisional
Probab=99.79  E-value=8.2e-19  Score=162.40  Aligned_cols=142  Identities=13%  Similarity=0.162  Sum_probs=92.8

Q ss_pred             HHHHHHhcCCCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEc---CCC-----------CC-HHHHHHHHH
Q 035574            3 ELLDLLIEGPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPA---PYH-----------YD-PDQILDIVA   67 (156)
Q Consensus         3 ~l~~~L~~~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~v---s~~-----------~~-~~~l~~~il   67 (156)
                      ++..+|.-+..+.++++||||||+||||||+++|+  ++..+|+..+|+..   ...           ++ ...+++.++
T Consensus       195 ~l~~lL~l~~~~~~vvgI~G~gGiGKTTLA~~l~~--~l~~~F~g~vfv~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~l  272 (1153)
T PLN03210        195 KMSSLLHLESEEVRMVGIWGSSGIGKTTIARALFS--RLSRQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFL  272 (1153)
T ss_pred             HHHHHHccccCceEEEEEEcCCCCchHHHHHHHHH--HHhhcCCeEEEeeccccccchhhcccccccccchhHHHHHHHH
Confidence            44455544566789999999999999999999999  78889999888742   111           11 123344444


Q ss_pred             HHhCCCC-----------------c-----------------cccCCCCCCCeEEEEEcCCHHHHhhcCcCcccc-----
Q 035574           68 VILLPFS-----------------M-----------------FKILPDNQNGSRVLITLTQIKMVTSFQLEDREN-----  108 (156)
Q Consensus        68 ~~l~~~~-----------------~-----------------~~~l~~~~~gsrIivTTR~~~Va~~~~~~~~~~-----  108 (156)
                      .++....                 .                 .......++||+||||||+.+++..++.++...     
T Consensus       273 ~~il~~~~~~~~~~~~~~~~L~~krvLLVLDdv~~~~~l~~L~~~~~~~~~GsrIIiTTrd~~vl~~~~~~~~~~v~~l~  352 (1153)
T PLN03210        273 SEILDKKDIKIYHLGAMEERLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPS  352 (1153)
T ss_pred             HHHhCCCCcccCCHHHHHHHHhCCeEEEEEeCCCCHHHHHHHHhhCccCCCCcEEEEEeCcHHHHHhcCCCeEEEecCCC
Confidence            4332110                 0                 111122357999999999999998776432110     


Q ss_pred             ------------cc-----ccccCChhhHhhhcCChHHHHHHHhCCCCccchhhh
Q 035574          109 ------------IR-----LDLVPTGGPLRATYQGWPFLILYHGSISLEENIEEV  146 (156)
Q Consensus       109 ------------~~-----l~~~~~~~~i~~~~~g~pl~~~~~gs~~~~~~~~~~  146 (156)
                                  ..     -++...++.|+++|+|+|||++++|+....++.++|
T Consensus       353 ~~ea~~LF~~~Af~~~~~~~~~~~l~~~iv~~c~GLPLAl~vlgs~L~~k~~~~W  407 (1153)
T PLN03210        353 NELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDW  407 (1153)
T ss_pred             HHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHhCCCcHHHHHHHHHHcCCCHHHH
Confidence                        00     112234677999999999999999997655554443


No 4  
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase. It is a homohexamer. Each monomer consists of an N-terminal domain of the OB fold, which is responsible for binding to cysteine rich nucleotides. This alignment is of the C-terminal ATP binding domain.
Probab=98.39  E-value=8.2e-07  Score=70.18  Aligned_cols=52  Identities=10%  Similarity=-0.105  Sum_probs=44.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCC--CCHHHHHHHHH
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYH--YDPDQILDIVA   67 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~--~~~~~l~~~il   67 (156)
                      -..+.|.|.+|+|||||++.+|++.... +|+..+|+++.++  ++..++++.+.
T Consensus        16 Gqr~~I~G~~G~GKTTLlr~I~n~l~~~-~fdv~~~v~vI~er~~ev~el~~~I~   69 (249)
T cd01128          16 GQRGLIVAPPKAGKTTLLQSIANAITKN-HPEVYLIVLLIDERPEEVTDMQRSVK   69 (249)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHhccccc-cCCeEEEEEEccCCCccHHHHHHHhc
Confidence            4568999999999999999999965444 8999999997776  89999999883


No 5  
>PRK09376 rho transcription termination factor Rho; Provisional
Probab=98.31  E-value=6.8e-07  Score=74.74  Aligned_cols=51  Identities=12%  Similarity=-0.072  Sum_probs=42.4

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCC--CHHHHHHHHH
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHY--DPDQILDIVA   67 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~--~~~~l~~~il   67 (156)
                      ....|+|.+|+|||||++.+|++.... +|+.++||++++..  ++.++++.+.
T Consensus       170 QR~lIvgppGvGKTTLaK~Ian~I~~n-hFDv~~~VvLIgER~~EVtdiqrsIl  222 (416)
T PRK09376        170 QRGLIVAPPKAGKTVLLQNIANSITTN-HPEVHLIVLLIDERPEEVTDMQRSVK  222 (416)
T ss_pred             ceEEEeCCCCCChhHHHHHHHHHHHhh-cCCeEEEEEEeCCchhHHHHHHHHhc
Confidence            345789999999999999999965444 89999999998887  7777777774


No 6  
>PRK08118 topology modulation protein; Reviewed
Probab=98.06  E-value=2.3e-06  Score=63.63  Aligned_cols=36  Identities=19%  Similarity=0.316  Sum_probs=29.1

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcccccc-ccCceEEEE
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSSYMK-HYFDYLAWI   51 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~~v~-~~F~~~~wv   51 (156)
                      ..|.|+|.+|+||||||+.+++...+. -+||..+|-
T Consensus         2 ~rI~I~G~~GsGKSTlak~L~~~l~~~~~~lD~l~~~   38 (167)
T PRK08118          2 KKIILIGSGGSGKSTLARQLGEKLNIPVHHLDALFWK   38 (167)
T ss_pred             cEEEEECCCCCCHHHHHHHHHHHhCCCceecchhhcc
Confidence            358899999999999999999965554 468877753


No 7  
>PF05729 NACHT:  NACHT domain
Probab=97.96  E-value=2e-05  Score=56.76  Aligned_cols=41  Identities=15%  Similarity=0.078  Sum_probs=29.6

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcccccccc----CceEEEEEcCCC
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSSYMKHY----FDYLAWIPAPYH   56 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~~v~~~----F~~~~wv~vs~~   56 (156)
                      |++-|.|.+|+||||+++.++++-.-...    +...+|++..+.
T Consensus         1 r~l~I~G~~G~GKStll~~~~~~~~~~~~~~~~~~~~~~~~~~~~   45 (166)
T PF05729_consen    1 RVLWISGEPGSGKSTLLRKLAQQLAEEEPPPSKFPYPFFFSLRDI   45 (166)
T ss_pred             CEEEEECCCCCChHHHHHHHHHHHHhcCcccccceEEEEEeehhh
Confidence            57899999999999999998874332222    456777766443


No 8  
>TIGR00767 rho transcription termination factor Rho. Members of this family differ in the specificity of RNA binding.
Probab=97.84  E-value=3.1e-05  Score=65.05  Aligned_cols=53  Identities=8%  Similarity=-0.147  Sum_probs=43.2

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCC--CCHHHHHHHHHHH
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYH--YDPDQILDIVAVI   69 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~--~~~~~l~~~il~~   69 (156)
                      ..+.|+|.+|.|||||++.+++.... ++|+..+|+.+.++  .++.++++.++..
T Consensus       169 q~~~IvG~~g~GKTtL~~~i~~~I~~-nhfdv~v~VlLIgER~~EVtDLqrsIlg~  223 (415)
T TIGR00767       169 QRGLIVAPPKAGKTVLLQKIAQAITR-NHPEVELIVLLIDERPEEVTDMQRSVKGE  223 (415)
T ss_pred             CEEEEECCCCCChhHHHHHHHHhhcc-cCCceEEEEEEcCCCCccHHHHHHHhhce
Confidence            45789999999999999999994332 36999999998865  7888998888443


No 9  
>PF13401 AAA_22:  AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B.
Probab=97.68  E-value=4.4e-05  Score=53.30  Aligned_cols=57  Identities=12%  Similarity=0.138  Sum_probs=41.6

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcccccccc-----CceEEEEEcCCCCCHHHHHHHHHHHhCC
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNSSYMKHY-----FDYLAWIPAPYHYDPDQILDIVAVILLP   72 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~-----F~~~~wv~vs~~~~~~~l~~~il~~l~~   72 (156)
                      +-+.+.|+|.+|+|||++++.+.++  ....     -...+|+.++...+...+...+++++..
T Consensus         3 ~~~~~~i~G~~G~GKT~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~l~~   64 (131)
T PF13401_consen    3 SQRILVISGPPGSGKTTLIKRLARQ--LNAEAEIKNHPDVIYVNCPSSRTPRDFAQEILEALGL   64 (131)
T ss_dssp             ----EEEEE-TTSSHHHHHHHHHHH--HHHHHHHCCCEEEEEEEHHHHSSHHHHHHHHHHHHT-
T ss_pred             CCcccEEEcCCCCCHHHHHHHHHHH--hHHhhhccCCCcEEEEEeCCCCCHHHHHHHHHHHhCc
Confidence            3567899999999999999999883  2221     2346799988877999999999999864


No 10 
>PRK07261 topology modulation protein; Provisional
Probab=97.65  E-value=0.00014  Score=54.13  Aligned_cols=54  Identities=19%  Similarity=0.220  Sum_probs=35.2

Q ss_pred             EEEEEcCCCccHHHHHHHHhcccccc-ccCceEEEEEcCCCCCHHHHHHHHHHHh
Q 035574           17 VVAILDSIGLDKTAFTAEAYNSSYMK-HYFDYLAWIPAPYHYDPDQILDIVAVIL   70 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~~~v~-~~F~~~~wv~vs~~~~~~~l~~~il~~l   70 (156)
                      .|.|+|++|+||||||+.+.....+. -+.|...|-......+..++...+...+
T Consensus         2 ri~i~G~~GsGKSTla~~l~~~~~~~~i~~D~~~~~~~~~~~~~~~~~~~~~~~~   56 (171)
T PRK07261          2 KIAIIGYSGSGKSTLARKLSQHYNCPVLHLDTLHFQPNWQERDDDDMIADISNFL   56 (171)
T ss_pred             EEEEEcCCCCCHHHHHHHHHHHhCCCeEecCCEEeccccccCCHHHHHHHHHHHH
Confidence            47899999999999999987643222 2456667754444445555555554444


No 11 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=97.49  E-value=0.00038  Score=48.23  Aligned_cols=43  Identities=12%  Similarity=0.022  Sum_probs=29.6

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCC
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYD   58 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~   58 (156)
                      ..+.+-|+|.+|+|||+|++.+++..  ...-...+++...+...
T Consensus        18 ~~~~v~i~G~~G~GKT~l~~~i~~~~--~~~~~~v~~~~~~~~~~   60 (151)
T cd00009          18 PPKNLLLYGPPGTGKTTLARAIANEL--FRPGAPFLYLNASDLLE   60 (151)
T ss_pred             CCCeEEEECCCCCCHHHHHHHHHHHh--hcCCCCeEEEehhhhhh
Confidence            45678899999999999999999843  22112355665544433


No 12 
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=97.47  E-value=0.00046  Score=57.21  Aligned_cols=57  Identities=16%  Similarity=0.055  Sum_probs=38.3

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHHHHHHhC
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDIVAVILL   71 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~il~~l~   71 (156)
                      ...+-|+|.+|+|||++++.++++.......-..+++......+...++..+++++.
T Consensus        55 ~~~~lI~G~~GtGKT~l~~~v~~~l~~~~~~~~~v~in~~~~~~~~~~~~~i~~~l~  111 (394)
T PRK00411         55 PLNVLIYGPPGTGKTTTVKKVFEELEEIAVKVVYVYINCQIDRTRYAIFSEIARQLF  111 (394)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHHHHHHhcCCcEEEEEECCcCCCHHHHHHHHHHHhc
Confidence            345679999999999999999984322221123566655555566666777766664


No 13 
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=97.47  E-value=0.00011  Score=50.85  Aligned_cols=21  Identities=24%  Similarity=0.298  Sum_probs=19.7

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|.|.|.+|+||||+|+.+.+
T Consensus         1 vI~I~G~~gsGKST~a~~La~   21 (121)
T PF13207_consen    1 VIIISGPPGSGKSTLAKELAE   21 (121)
T ss_dssp             EEEEEESTTSSHHHHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHHHHH
Confidence            689999999999999999987


No 14 
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional
Probab=97.46  E-value=0.00019  Score=61.15  Aligned_cols=49  Identities=8%  Similarity=0.008  Sum_probs=38.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHH
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQIL   63 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~   63 (156)
                      .+.+-++|++|+|||++|+.+++.......|+.+.||++++.++-.++.
T Consensus       194 ~~~iil~GppGtGKT~lA~~la~~l~~~~~~~~v~~VtFHpsySYeDFI  242 (459)
T PRK11331        194 KKNIILQGPPGVGKTFVARRLAYLLTGEKAPQRVNMVQFHQSYSYEDFI  242 (459)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHhcCCcccceeeEEeecccccHHHHh
Confidence            4567889999999999999998854444567788899998877655543


No 15 
>TIGR02928 orc1/cdc6 family replication initiation protein. Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other.
Probab=97.39  E-value=0.00059  Score=55.94  Aligned_cols=57  Identities=21%  Similarity=0.042  Sum_probs=38.7

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcccccc-ccC--c-eEEEEEcCCCCCHHHHHHHHHHHh
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNSSYMK-HYF--D-YLAWIPAPYHYDPDQILDIVAVIL   70 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~~~v~-~~F--~-~~~wv~vs~~~~~~~l~~~il~~l   70 (156)
                      ....+-|+|.+|+|||++++.++++..-. ...  + ..+|+......+...++..+++++
T Consensus        39 ~~~~i~I~G~~GtGKT~l~~~~~~~l~~~~~~~~~~~~~v~in~~~~~~~~~~~~~i~~~l   99 (365)
T TIGR02928        39 RPSNVFIYGKTGTGKTAVTKYVMKELEEAAEDRDVRVVTVYVNCQILDTLYQVLVELANQL   99 (365)
T ss_pred             CCCcEEEECCCCCCHHHHHHHHHHHHHHHhhccCCceEEEEEECCCCCCHHHHHHHHHHHH
Confidence            34568999999999999999999842111 111  1 256666666566667777777766


No 16 
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=97.34  E-value=0.00055  Score=50.29  Aligned_cols=27  Identities=11%  Similarity=0.097  Sum_probs=18.3

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ....+.+-|+|.+|+|||+|.+.++..
T Consensus        21 ~~~~~~~ll~G~~G~GKT~ll~~~~~~   47 (185)
T PF13191_consen   21 SGSPRNLLLTGESGSGKTSLLRALLDR   47 (185)
T ss_dssp             S-----EEE-B-TTSSHHHHHHHHHHH
T ss_pred             cCCCcEEEEECCCCCCHHHHHHHHHHH
Confidence            455789999999999999999999883


No 17 
>PF13173 AAA_14:  AAA domain
Probab=97.34  E-value=0.00052  Score=48.39  Aligned_cols=83  Identities=14%  Similarity=0.209  Sum_probs=48.6

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHH----HHHHHHHHhCCCCc---------------
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQ----ILDIVAVILLPFSM---------------   75 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~----l~~~il~~l~~~~~---------------   75 (156)
                      -+++.|.|..|+|||||+++++.+..   .-...+++...+......    +.+.+.+...+...               
T Consensus         2 ~~~~~l~G~R~vGKTtll~~~~~~~~---~~~~~~yi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~iDEiq~~~~~~~   78 (128)
T PF13173_consen    2 RKIIILTGPRGVGKTTLLKQLAKDLL---PPENILYINFDDPRDRRLADPDLLEYFLELIKPGKKYIFIDEIQYLPDWED   78 (128)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHHHhc---ccccceeeccCCHHHHHHhhhhhHHHHHHhhccCCcEEEEehhhhhccHHH
Confidence            36789999999999999999987432   224466666554433221    22333333211111               


Q ss_pred             -cccCCCCCCCeEEEEEcCCHHHHhh
Q 035574           76 -FKILPDNQNGSRVLITLTQIKMVTS  100 (156)
Q Consensus        76 -~~~l~~~~~gsrIivTTR~~~Va~~  100 (156)
                       ...+-+..+..+|++|+.+......
T Consensus        79 ~lk~l~d~~~~~~ii~tgS~~~~l~~  104 (128)
T PF13173_consen   79 ALKFLVDNGPNIKIILTGSSSSLLSK  104 (128)
T ss_pred             HHHHHHHhccCceEEEEccchHHHhh
Confidence             1122233345789999998877743


No 18 
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=97.31  E-value=0.00091  Score=52.45  Aligned_cols=54  Identities=17%  Similarity=0.148  Sum_probs=35.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHHHHHHhC
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDIVAVILL   71 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~il~~l~   71 (156)
                      ...+.|+|.+|+|||||++.+++.... ..+ ..+|+.. ...+..+++..+...++
T Consensus        43 ~~~~~l~G~~G~GKTtl~~~l~~~l~~-~~~-~~~~~~~-~~~~~~~~l~~i~~~lG   96 (269)
T TIGR03015        43 EGFILITGEVGAGKTTLIRNLLKRLDQ-ERV-VAAKLVN-TRVDAEDLLRMVAADFG   96 (269)
T ss_pred             CCEEEEEcCCCCCHHHHHHHHHHhcCC-CCe-EEeeeeC-CCCCHHHHHHHHHHHcC
Confidence            457899999999999999999984331 111 2334432 33456666666665553


No 19 
>PRK07667 uridine kinase; Provisional
Probab=97.18  E-value=0.00069  Score=51.26  Aligned_cols=36  Identities=19%  Similarity=0.230  Sum_probs=28.9

Q ss_pred             HHHHHHHhcCCCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574            2 EELLDLLIEGPTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus         2 ~~l~~~L~~~~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +.+++.+........+|+|.|.+|.||||+|+.+..
T Consensus         4 ~~~~~~~~~~~~~~~iIgI~G~~gsGKStla~~L~~   39 (193)
T PRK07667          4 NELINIMKKHKENRFILGIDGLSRSGKTTFVANLKE   39 (193)
T ss_pred             HHHHHHHHhcCCCCEEEEEECCCCCCHHHHHHHHHH
Confidence            345666655555668999999999999999999877


No 20 
>PRK06696 uridine kinase; Validated
Probab=97.13  E-value=0.00065  Score=52.45  Aligned_cols=34  Identities=26%  Similarity=0.213  Sum_probs=26.5

Q ss_pred             HHHHHhc-CCCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574            4 LLDLLIE-GPTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus         4 l~~~L~~-~~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      |.+.+.. ......+|+|.|.+|.||||||+.+.+
T Consensus        10 la~~~~~~~~~~~~iI~I~G~sgsGKSTlA~~L~~   44 (223)
T PRK06696         10 LAEHILTLNLTRPLRVAIDGITASGKTTFADELAE   44 (223)
T ss_pred             HHHHHHHhCCCCceEEEEECCCCCCHHHHHHHHHH
Confidence            3444433 345678999999999999999999987


No 21 
>PF13238 AAA_18:  AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C ....
Probab=97.05  E-value=0.00051  Score=47.42  Aligned_cols=21  Identities=24%  Similarity=0.227  Sum_probs=18.8

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.|.|..|+||||+|+.+...
T Consensus         1 I~i~G~~GsGKtTia~~L~~~   21 (129)
T PF13238_consen    1 IGISGIPGSGKTTIAKELAER   21 (129)
T ss_dssp             EEEEESTTSSHHHHHHHHHHH
T ss_pred             CEEECCCCCCHHHHHHHHHHH
Confidence            678999999999999998774


No 22 
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]
Probab=97.04  E-value=0.0024  Score=53.43  Aligned_cols=53  Identities=8%  Similarity=0.040  Sum_probs=35.1

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHHHHHH
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDIVAVI   69 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~il~~   69 (156)
                      ..+..+-+||.+|+||||||+.+.+..+-..    ..||..|-.-....=.++|+++
T Consensus       160 ~~ipSmIlWGppG~GKTtlArlia~tsk~~S----yrfvelSAt~a~t~dvR~ife~  212 (554)
T KOG2028|consen  160 NRIPSMILWGPPGTGKTTLARLIASTSKKHS----YRFVELSATNAKTNDVRDIFEQ  212 (554)
T ss_pred             CCCCceEEecCCCCchHHHHHHHHhhcCCCc----eEEEEEeccccchHHHHHHHHH
Confidence            3466788999999999999999998654444    4566665433333334444443


No 23 
>PRK05541 adenylylsulfate kinase; Provisional
Probab=96.97  E-value=0.001  Score=49.26  Aligned_cols=36  Identities=19%  Similarity=0.271  Sum_probs=28.2

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEE
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWI   51 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv   51 (156)
                      ...+|.++|+.|.||||+|+.++.  +....+....++
T Consensus         6 ~~~~I~i~G~~GsGKst~a~~l~~--~l~~~~~~~~~~   41 (176)
T PRK05541          6 NGYVIWITGLAGSGKTTIAKALYE--RLKLKYSNVIYL   41 (176)
T ss_pred             CCCEEEEEcCCCCCHHHHHHHHHH--HHHHcCCcEEEE
Confidence            346899999999999999999988  555555555555


No 24 
>PTZ00202 tuzin; Provisional
Probab=96.96  E-value=0.0047  Score=52.99  Aligned_cols=51  Identities=16%  Similarity=0.049  Sum_probs=39.2

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHHHHHHhCC
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDIVAVILLP   72 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~il~~l~~   72 (156)
                      ..+++.|.|++|.|||||++.+...  ..    ..+++..+.  ...++++.++.+|+.
T Consensus       285 ~privvLtG~~G~GKTTLlR~~~~~--l~----~~qL~vNpr--g~eElLr~LL~ALGV  335 (550)
T PTZ00202        285 HPRIVVFTGFRGCGKSSLCRSAVRK--EG----MPAVFVDVR--GTEDTLRSVVKALGV  335 (550)
T ss_pred             CceEEEEECCCCCCHHHHHHHHHhc--CC----ceEEEECCC--CHHHHHHHHHHHcCC
Confidence            3468899999999999999999873  22    224444444  679999999999984


No 25 
>TIGR02237 recomb_radB DNA repair and recombination protein RadB. This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239) and DMC1 (TIGR02238), and archaeal RadA (TIGR02236).
Probab=96.96  E-value=0.0029  Score=47.91  Aligned_cols=51  Identities=14%  Similarity=0.111  Sum_probs=37.5

Q ss_pred             CCCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHH
Q 035574           11 GPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILD   64 (156)
Q Consensus        11 ~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~   64 (156)
                      +-..-+++-|+|.+|.|||+++.++..  ....+-...+|++... ++...+.+
T Consensus         8 Gi~~g~i~~i~G~~GsGKT~l~~~~~~--~~~~~g~~v~yi~~e~-~~~~rl~~   58 (209)
T TIGR02237         8 GVERGTITQIYGPPGSGKTNICMILAV--NAARQGKKVVYIDTEG-LSPERFKQ   58 (209)
T ss_pred             CCCCCeEEEEECCCCCCHHHHHHHHHH--HHHhCCCeEEEEECCC-CCHHHHHH
Confidence            345568999999999999999999876  3333345688988765 66665544


No 26 
>PRK04841 transcriptional regulator MalT; Provisional
Probab=96.92  E-value=0.0037  Score=56.89  Aligned_cols=63  Identities=19%  Similarity=0.289  Sum_probs=44.4

Q ss_pred             CHHHHHHHhcCCCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCC-CCHHHHHHHHHHHh
Q 035574            1 MEELLDLLIEGPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYH-YDPDQILDIVAVIL   70 (156)
Q Consensus         1 r~~l~~~L~~~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~-~~~~~l~~~il~~l   70 (156)
                      |..|.+.|.. ....+++.|.|.+|.||||++.+...+      ++..+|+++... .+...+...++..+
T Consensus        19 R~rl~~~l~~-~~~~~~~~v~apaG~GKTtl~~~~~~~------~~~~~w~~l~~~d~~~~~f~~~l~~~l   82 (903)
T PRK04841         19 RERLLAKLSG-ANNYRLVLVTSPAGYGKTTLISQWAAG------KNNLGWYSLDESDNQPERFASYLIAAL   82 (903)
T ss_pred             chHHHHHHhc-ccCCCeEEEECCCCCCHHHHHHHHHHh------CCCeEEEecCcccCCHHHHHHHHHHHH
Confidence            5677777754 346789999999999999999998752      236899998643 45444444444443


No 27 
>PF05496 RuvB_N:  Holliday junction DNA helicase ruvB N-terminus;  InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein []. This group of sequences contain this signature which is located in the N-terminal region of the proteins.; GO: 0009378 four-way junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1IQP_B 3PFI_B 1IXR_C 1HQC_B 1IXS_B.
Probab=96.92  E-value=0.001  Score=52.03  Aligned_cols=32  Identities=22%  Similarity=0.206  Sum_probs=23.3

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhccccccccC
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYF   45 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F   45 (156)
                      ...+.-+-.||.+|+||||||..+.+  ....+|
T Consensus        47 ~~~l~h~lf~GPPG~GKTTLA~IIA~--e~~~~~   78 (233)
T PF05496_consen   47 GEALDHMLFYGPPGLGKTTLARIIAN--ELGVNF   78 (233)
T ss_dssp             TS---EEEEESSTTSSHHHHHHHHHH--HCT--E
T ss_pred             CCCcceEEEECCCccchhHHHHHHHh--ccCCCe
Confidence            45577788999999999999999999  555555


No 28 
>PRK08233 hypothetical protein; Provisional
Probab=96.88  E-value=0.001  Score=48.94  Aligned_cols=24  Identities=21%  Similarity=0.238  Sum_probs=21.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ..+|.|.|.+|+||||||+.+...
T Consensus         3 ~~iI~I~G~~GsGKtTla~~L~~~   26 (182)
T PRK08233          3 TKIITIAAVSGGGKTTLTERLTHK   26 (182)
T ss_pred             ceEEEEECCCCCCHHHHHHHHHhh
Confidence            478999999999999999999873


No 29 
>PF00485 PRK:  Phosphoribulokinase / Uridine kinase family;  InterPro: IPR006083 Phosphoribulokinase (PRK) 2.7.1.19 from EC catalyses the ATP-dependent phosphorylation of ribulose-5-phosphate to ribulose-1,5-phosphate, a key step in the pentose phosphate pathway where carbon dioxide is assimilated by autotrophic organisms []. In general, plant enzymes are light-activated by the thioredoxin/ferredoxin system, while those from photosynthetic bacteria are regulated by a system that has an absolute requirement for NADH. Thioredoxin/ferredoxin regulation is mediated by the reversible oxidation/reduction of sulphydryl and disulphide groups.  Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway. It catalyzes the following reaction:  ATP + Uridine = ADP + UMP   Pantothenate kinase (2.7.1.33 from EC) catalyzes the rate-limiting step in the biosynthesis of coenzyme A, the conversion of pantothenate to D-4'-phosphopantothenate in the presence of ATP. ; GO: 0005524 ATP binding, 0016301 kinase activity, 0008152 metabolic process; PDB: 2ZSE_A 2ZS7_A 3AF0_A 3AVP_A 2ZS9_A 2ZS8_A 3AEZ_A 2ZSB_A 2ZSD_A 2GEV_A ....
Probab=96.87  E-value=0.00091  Score=50.46  Aligned_cols=21  Identities=19%  Similarity=0.303  Sum_probs=19.7

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ||+|.|.+|+||||+|+.+..
T Consensus         1 IIgI~G~sgSGKTTla~~L~~   21 (194)
T PF00485_consen    1 IIGIAGPSGSGKTTLAKRLAQ   21 (194)
T ss_dssp             EEEEEESTTSSHHHHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHHHHH
Confidence            689999999999999999877


No 30 
>PTZ00301 uridine kinase; Provisional
Probab=96.86  E-value=0.0015  Score=50.46  Aligned_cols=23  Identities=17%  Similarity=0.330  Sum_probs=20.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..+|+|.|.+|.||||||+.+.+
T Consensus         3 ~~iIgIaG~SgSGKTTla~~l~~   25 (210)
T PTZ00301          3 CTVIGISGASGSGKSSLSTNIVS   25 (210)
T ss_pred             CEEEEEECCCcCCHHHHHHHHHH
Confidence            57899999999999999988765


No 31 
>PRK05480 uridine/cytidine kinase; Provisional
Probab=96.85  E-value=0.0012  Score=50.23  Aligned_cols=24  Identities=21%  Similarity=0.364  Sum_probs=22.1

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+|+|.|.+|+|||||++.++.
T Consensus         5 ~~~iI~I~G~sGsGKTTl~~~l~~   28 (209)
T PRK05480          5 KPIIIGIAGGSGSGKTTVASTIYE   28 (209)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHH
Confidence            467999999999999999999987


No 32 
>TIGR00235 udk uridine kinase. Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below
Probab=96.81  E-value=0.0014  Score=49.91  Aligned_cols=25  Identities=20%  Similarity=0.275  Sum_probs=22.3

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +...+|+|+|.+|.|||||++.+..
T Consensus         4 ~~g~vi~I~G~sGsGKSTl~~~l~~   28 (207)
T TIGR00235         4 PKGIIIGIGGGSGSGKTTVARKIYE   28 (207)
T ss_pred             CCeEEEEEECCCCCCHHHHHHHHHH
Confidence            3457999999999999999999986


No 33 
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=96.77  E-value=0.0021  Score=43.79  Aligned_cols=37  Identities=16%  Similarity=0.120  Sum_probs=26.2

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcC
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAP   54 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs   54 (156)
                      ..+-|+|.+|+||||+++.+..  .........+++..+
T Consensus         3 ~~~~l~G~~G~GKTtl~~~l~~--~~~~~~~~~~~~~~~   39 (148)
T smart00382        3 EVILIVGPPGSGKTTLARALAR--ELGPPGGGVIYIDGE   39 (148)
T ss_pred             CEEEEECCCCCcHHHHHHHHHh--ccCCCCCCEEEECCE
Confidence            5688999999999999999988  333322234555443


No 34 
>PRK05564 DNA polymerase III subunit delta'; Validated
Probab=96.74  E-value=0.02  Score=46.31  Aligned_cols=81  Identities=16%  Similarity=0.272  Sum_probs=50.6

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc----ccccccCceEEEEE-cCCCCCHHHHHHHHHHHhC--CCCc------------
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS----SYMKHYFDYLAWIP-APYHYDPDQILDIVAVILL--PFSM------------   75 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~----~~v~~~F~~~~wv~-vs~~~~~~~l~~~il~~l~--~~~~------------   75 (156)
                      ....-++|..|+||||+|+.++..    .....|.|...|.. -+.....+++ +++.+.+.  +.+.            
T Consensus        26 ~ha~Lf~G~~G~Gk~~la~~~a~~l~c~~~~~~h~D~~~~~~~~~~~i~v~~i-r~~~~~~~~~p~~~~~kv~iI~~ad~  104 (313)
T PRK05564         26 SHAHIIVGEDGIGKSLLAKEIALKILGKSQQREYVDIIEFKPINKKSIGVDDI-RNIIEEVNKKPYEGDKKVIIIYNSEK  104 (313)
T ss_pred             CceEEeECCCCCCHHHHHHHHHHHHcCCCCCCCCCCeEEeccccCCCCCHHHH-HHHHHHHhcCcccCCceEEEEechhh
Confidence            456788999999999999988762    12235667766765 3455555553 34445432  1110            


Q ss_pred             ---------cccCCCCCCCeEEEEEcCCHH
Q 035574           76 ---------FKILPDNQNGSRVLITLTQIK   96 (156)
Q Consensus        76 ---------~~~l~~~~~gsrIivTTR~~~   96 (156)
                               ...+.+..+++.+|++|.+.+
T Consensus       105 m~~~a~naLLK~LEepp~~t~~il~~~~~~  134 (313)
T PRK05564        105 MTEQAQNAFLKTIEEPPKGVFIILLCENLE  134 (313)
T ss_pred             cCHHHHHHHHHHhcCCCCCeEEEEEeCChH
Confidence                     234455556888998887654


No 35 
>PRK06762 hypothetical protein; Provisional
Probab=96.72  E-value=0.0015  Score=47.69  Aligned_cols=22  Identities=18%  Similarity=0.280  Sum_probs=20.4

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .+|.|+|++|+||||+|+.+.+
T Consensus         3 ~li~i~G~~GsGKST~A~~L~~   24 (166)
T PRK06762          3 TLIIIRGNSGSGKTTIAKQLQE   24 (166)
T ss_pred             eEEEEECCCCCCHHHHHHHHHH
Confidence            5789999999999999999977


No 36 
>PF13671 AAA_33:  AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B ....
Probab=96.72  E-value=0.0016  Score=46.05  Aligned_cols=21  Identities=10%  Similarity=0.211  Sum_probs=19.0

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|-++|++|+||||+|+.+..
T Consensus         1 lii~~G~pgsGKSt~a~~l~~   21 (143)
T PF13671_consen    1 LIILCGPPGSGKSTLAKRLAK   21 (143)
T ss_dssp             EEEEEESTTSSHHHHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHHHHH
Confidence            577899999999999999875


No 37 
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]
Probab=96.67  E-value=0.002  Score=48.01  Aligned_cols=22  Identities=18%  Similarity=0.190  Sum_probs=19.9

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      --|.|.|++|+|||||++.+.+
T Consensus         6 mki~ITG~PGvGKtTl~~ki~e   27 (179)
T COG1618           6 MKIFITGRPGVGKTTLVLKIAE   27 (179)
T ss_pred             eEEEEeCCCCccHHHHHHHHHH
Confidence            4578999999999999999987


No 38 
>PRK03839 putative kinase; Provisional
Probab=96.65  E-value=0.0016  Score=48.38  Aligned_cols=22  Identities=23%  Similarity=0.321  Sum_probs=19.7

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .|.|.|++|+||||+++.+++.
T Consensus         2 ~I~l~G~pGsGKsT~~~~La~~   23 (180)
T PRK03839          2 IIAITGTPGVGKTTVSKLLAEK   23 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            4789999999999999999883


No 39 
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=96.63  E-value=0.011  Score=45.41  Aligned_cols=53  Identities=15%  Similarity=0.206  Sum_probs=37.9

Q ss_pred             CCCCcEEEEEEcCCCccHHHHHHHHhcccccccc----CceEEEEEcCCCCCHHHHH
Q 035574           11 GPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHY----FDYLAWIPAPYHYDPDQIL   63 (156)
Q Consensus        11 ~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~----F~~~~wv~vs~~~~~~~l~   63 (156)
                      +-..-.++-|+|.+|.|||+|+.++.........    -...+|++....++...+.
T Consensus        15 Gi~~g~i~~i~G~~GsGKT~l~~~l~~~~~~~~~~~g~~~~viyi~~e~~~~~~rl~   71 (235)
T cd01123          15 GIETGSITEIFGEFGSGKTQLCHQLAVTVQLPIELGGLEGKAVYIDTEGTFRPERLV   71 (235)
T ss_pred             CCCCCeEEEEECCCCCCHHHHHHHHHHHeeCccccCCCCccEEEEeCCCCcCHHHHH
Confidence            3455688999999999999999998753222221    2568899887777765543


No 40 
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily. Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Probab=96.56  E-value=0.0023  Score=47.34  Aligned_cols=24  Identities=13%  Similarity=0.170  Sum_probs=21.4

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+|.|+|.+|+||||+++.+..
T Consensus         2 ~~~ii~i~G~~GsGKsTl~~~l~~   25 (188)
T TIGR01360         2 KCKIIFIVGGPGSGKGTQCEKIVE   25 (188)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHHH
Confidence            467899999999999999999875


No 41 
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=96.53  E-value=0.0035  Score=47.81  Aligned_cols=26  Identities=12%  Similarity=0.091  Sum_probs=22.3

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .....+-++|..|+|||+||+.+++.
T Consensus        36 ~~~~~lll~G~~G~GKT~la~~~~~~   61 (226)
T TIGR03420        36 KGDRFLYLWGESGSGKSHLLQAACAA   61 (226)
T ss_pred             CCCCeEEEECCCCCCHHHHHHHHHHH
Confidence            34567889999999999999999873


No 42 
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=96.53  E-value=0.015  Score=44.47  Aligned_cols=51  Identities=14%  Similarity=0.204  Sum_probs=37.1

Q ss_pred             CCCCcEEEEEEcCCCccHHHHHHHHhccccccccC------ceEEEEEcCCCCCHHHHH
Q 035574           11 GPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYF------DYLAWIPAPYHYDPDQIL   63 (156)
Q Consensus        11 ~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F------~~~~wv~vs~~~~~~~l~   63 (156)
                      +-..-.++-|.|.+|.|||+|+.++...  ....-      ...+|+.....++...+.
T Consensus        15 G~~~g~v~~I~G~~GsGKT~l~~~ia~~--~~~~~~~~g~~~~v~yi~~e~~~~~~rl~   71 (226)
T cd01393          15 GIPTGRITEIFGEFGSGKTQLCLQLAVE--AQLPGELGGLEGKVVYIDTEGAFRPERLV   71 (226)
T ss_pred             CCcCCcEEEEeCCCCCChhHHHHHHHHH--hhcccccCCCcceEEEEecCCCCCHHHHH
Confidence            4455689999999999999999998662  22222      347888887777766554


No 43 
>PRK04040 adenylate kinase; Provisional
Probab=96.52  E-value=0.0031  Score=47.68  Aligned_cols=23  Identities=26%  Similarity=0.377  Sum_probs=20.8

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..+|.|+|++|+||||+++.+.+
T Consensus         2 ~~~i~v~G~pG~GKtt~~~~l~~   24 (188)
T PRK04040          2 MKVVVVTGVPGVGKTTVLNKALE   24 (188)
T ss_pred             CeEEEEEeCCCCCHHHHHHHHHH
Confidence            35789999999999999999977


No 44 
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=96.51  E-value=0.012  Score=45.16  Aligned_cols=49  Identities=14%  Similarity=0.161  Sum_probs=35.2

Q ss_pred             CCCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHH
Q 035574           11 GPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQI   62 (156)
Q Consensus        11 ~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l   62 (156)
                      +-..-.++-|+|.+|.|||+++.++..+  ....-...+|++.. .++...+
T Consensus        19 Gi~~g~i~~i~G~~GsGKT~l~~~la~~--~~~~~~~v~yi~~e-~~~~~r~   67 (225)
T PRK09361         19 GFERGTITQIYGPPGSGKTNICLQLAVE--AAKNGKKVIYIDTE-GLSPERF   67 (225)
T ss_pred             CCCCCeEEEEECCCCCCHHHHHHHHHHH--HHHCCCeEEEEECC-CCCHHHH
Confidence            3355679999999999999999998763  32333557888876 5555443


No 45 
>PF00004 AAA:  ATPase family associated with various cellular activities (AAA);  InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport. Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....
Probab=96.49  E-value=0.0022  Score=44.34  Aligned_cols=21  Identities=14%  Similarity=0.158  Sum_probs=18.9

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |-++|.+|.|||++|+.+.++
T Consensus         1 ill~G~~G~GKT~l~~~la~~   21 (132)
T PF00004_consen    1 ILLHGPPGTGKTTLARALAQY   21 (132)
T ss_dssp             EEEESSTTSSHHHHHHHHHHH
T ss_pred             CEEECcCCCCeeHHHHHHHhh
Confidence            458999999999999999994


No 46 
>PRK14738 gmk guanylate kinase; Provisional
Probab=96.48  E-value=0.003  Score=48.24  Aligned_cols=32  Identities=25%  Similarity=0.301  Sum_probs=27.4

Q ss_pred             HHHhcCCCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574            6 DLLIEGPTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus         6 ~~L~~~~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .|+.++....+.+.|+|..|+|||||++.+.+
T Consensus         4 ~~~~~~~~~~~~ivi~GpsG~GK~tl~~~L~~   35 (206)
T PRK14738          4 PWLFNKPAKPLLVVISGPSGVGKDAVLARMRE   35 (206)
T ss_pred             ccccCCCCCCeEEEEECcCCCCHHHHHHHHHh
Confidence            35666667788999999999999999999976


No 47 
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=96.43  E-value=0.0027  Score=40.13  Aligned_cols=22  Identities=18%  Similarity=0.291  Sum_probs=19.4

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      +|.|.|..|.||||+++.+.+.
T Consensus         1 ~i~i~G~~gsGKst~~~~l~~~   22 (69)
T cd02019           1 IIAITGGSGSGKSTVAKKLAEQ   22 (69)
T ss_pred             CEEEECCCCCCHHHHHHHHHHH
Confidence            4788999999999999998773


No 48 
>PRK00131 aroK shikimate kinase; Reviewed
Probab=96.43  E-value=0.0029  Score=46.00  Aligned_cols=23  Identities=9%  Similarity=0.105  Sum_probs=20.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...|-++|++|.||||+|+.+..
T Consensus         4 ~~~i~l~G~~GsGKstla~~La~   26 (175)
T PRK00131          4 GPNIVLIGFMGAGKSTIGRLLAK   26 (175)
T ss_pred             CCeEEEEcCCCCCHHHHHHHHHH
Confidence            45789999999999999999988


No 49 
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]
Probab=96.40  E-value=0.0026  Score=49.08  Aligned_cols=24  Identities=21%  Similarity=0.257  Sum_probs=21.7

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ..+|+|-||-|+||||||+.+.++
T Consensus         4 ~~~IvI~G~IG~GKSTLa~~La~~   27 (216)
T COG1428           4 AMVIVIEGMIGAGKSTLAQALAEH   27 (216)
T ss_pred             ccEEEEecccccCHHHHHHHHHHH
Confidence            468999999999999999999883


No 50 
>PRK06547 hypothetical protein; Provisional
Probab=96.40  E-value=0.0037  Score=46.68  Aligned_cols=27  Identities=19%  Similarity=0.097  Sum_probs=23.5

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .....+|.|.|..|.||||+|+.+.+.
T Consensus        12 ~~~~~~i~i~G~~GsGKTt~a~~l~~~   38 (172)
T PRK06547         12 GGGMITVLIDGRSGSGKTTLAGALAAR   38 (172)
T ss_pred             cCCCEEEEEECCCCCCHHHHHHHHHHH
Confidence            355789999999999999999999773


No 51 
>PRK00625 shikimate kinase; Provisional
Probab=96.38  E-value=0.0028  Score=47.40  Aligned_cols=20  Identities=15%  Similarity=0.135  Sum_probs=18.6

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |-++||+|+||||+++.+.+
T Consensus         3 I~LiG~pGsGKTT~~k~La~   22 (173)
T PRK00625          3 IFLCGLPTVGKTSFGKALAK   22 (173)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            77899999999999999977


No 52 
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=96.37  E-value=0.0025  Score=48.00  Aligned_cols=21  Identities=24%  Similarity=0.363  Sum_probs=19.2

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|+|.|..|+|||||++.+..
T Consensus         1 iigi~G~~GsGKSTl~~~l~~   21 (198)
T cd02023           1 IIGIAGGSGSGKTTVAEEIIE   21 (198)
T ss_pred             CEEEECCCCCCHHHHHHHHHH
Confidence            589999999999999999866


No 53 
>PRK13947 shikimate kinase; Provisional
Probab=96.35  E-value=0.003  Score=46.25  Aligned_cols=21  Identities=14%  Similarity=0.248  Sum_probs=19.3

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -|.|+|++|+||||+|+.+.+
T Consensus         3 ~I~l~G~~GsGKst~a~~La~   23 (171)
T PRK13947          3 NIVLIGFMGTGKTTVGKRVAT   23 (171)
T ss_pred             eEEEEcCCCCCHHHHHHHHHH
Confidence            478999999999999999987


No 54 
>PRK00889 adenylylsulfate kinase; Provisional
Probab=96.34  E-value=0.0042  Score=45.86  Aligned_cols=23  Identities=17%  Similarity=0.011  Sum_probs=21.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+|.++|.+|+||||+|+.+..
T Consensus         4 g~~i~~~G~~GsGKST~a~~la~   26 (175)
T PRK00889          4 GVTVWFTGLSGAGKTTIARALAE   26 (175)
T ss_pred             CeEEEEECCCCCCHHHHHHHHHH
Confidence            46899999999999999999987


No 55 
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=96.32  E-value=0.0029  Score=44.77  Aligned_cols=21  Identities=19%  Similarity=0.210  Sum_probs=19.4

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|.|.|.+|.||||+|+.+..
T Consensus         1 ~I~i~G~~GsGKst~a~~la~   21 (147)
T cd02020           1 IIAIDGPAGSGKSTVAKLLAK   21 (147)
T ss_pred             CEEEECCCCCCHHHHHHHHHH
Confidence            588999999999999999876


No 56 
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN. Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.
Probab=96.32  E-value=0.0036  Score=46.29  Aligned_cols=23  Identities=13%  Similarity=0.193  Sum_probs=20.3

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .++.|+|+.|+|||||++.+...
T Consensus         2 ~~~~i~G~sGsGKttl~~~l~~~   24 (179)
T TIGR02322         2 RLIYVVGPSGAGKDTLLDYARAR   24 (179)
T ss_pred             cEEEEECCCCCCHHHHHHHHHHH
Confidence            46899999999999999998773


No 57 
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=96.31  E-value=0.02  Score=43.64  Aligned_cols=46  Identities=15%  Similarity=0.067  Sum_probs=31.7

Q ss_pred             CCCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCC
Q 035574           11 GPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYD   58 (156)
Q Consensus        11 ~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~   58 (156)
                      +-..-+++-|.|.+|+|||||+.++...  ...+=...+|++..+.++
T Consensus        15 Gi~~g~i~~i~G~~GsGKT~l~~~~a~~--~~~~g~~v~yi~~e~~~~   60 (218)
T cd01394          15 GVERGTVTQVYGPPGTGKTNIAIQLAVE--TAGQGKKVAYIDTEGLSS   60 (218)
T ss_pred             CccCCeEEEEECCCCCCHHHHHHHHHHH--HHhcCCeEEEEECCCCCH
Confidence            3455688999999999999999998763  222223466776554443


No 58 
>PF01637 Arch_ATPase:  Archaeal ATPase;  InterPro: IPR011579  This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP.; GO: 0005524 ATP binding; PDB: 2FNA_A 2QEN_A.
Probab=96.30  E-value=0.0031  Score=47.57  Aligned_cols=38  Identities=24%  Similarity=0.180  Sum_probs=26.4

Q ss_pred             CHHHHHHHhcC--CCCcEEEEEEcCCCccHHHHHHHHhcc
Q 035574            1 MEELLDLLIEG--PTQLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus         1 r~~l~~~L~~~--~~~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |++.++.|.+-  ......+.|+|..|+|||+|++++.+.
T Consensus         4 R~~el~~l~~~l~~~~~~~~~l~G~rg~GKTsLl~~~~~~   43 (234)
T PF01637_consen    4 REKELEKLKELLESGPSQHILLYGPRGSGKTSLLKEFINE   43 (234)
T ss_dssp             -HHHHHHHHHCHHH--SSEEEEEESTTSSHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhhcCcEEEEEcCCcCCHHHHHHHHHHH
Confidence            34444555432  223678889999999999999999883


No 59 
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed
Probab=96.28  E-value=0.0071  Score=46.82  Aligned_cols=27  Identities=19%  Similarity=0.256  Sum_probs=23.5

Q ss_pred             CCCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           11 GPTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        11 ~~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ......+++|.|..|.|||||++.+..
T Consensus        29 ~~~~~~iigi~G~~GsGKTTl~~~L~~   55 (229)
T PRK09270         29 EPQRRTIVGIAGPPGAGKSTLAEFLEA   55 (229)
T ss_pred             cCCCCEEEEEECCCCCCHHHHHHHHHH
Confidence            345678999999999999999998876


No 60 
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]
Probab=96.24  E-value=0.0046  Score=47.97  Aligned_cols=25  Identities=20%  Similarity=0.298  Sum_probs=22.8

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..+.+|+|-|.+|.||||+|+.+++
T Consensus         6 ~~~iiIgIaG~SgSGKTTva~~l~~   30 (218)
T COG0572           6 EKVIIIGIAGGSGSGKTTVAKELSE   30 (218)
T ss_pred             CceEEEEEeCCCCCCHHHHHHHHHH
Confidence            4568999999999999999999988


No 61 
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family. This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic.
Probab=96.22  E-value=0.0034  Score=46.44  Aligned_cols=21  Identities=29%  Similarity=0.260  Sum_probs=19.1

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|-|+|++|+||||+|+.+..
T Consensus         1 ~i~i~G~pGsGKst~a~~la~   21 (183)
T TIGR01359         1 VVFVLGGPGSGKGTQCAKIVE   21 (183)
T ss_pred             CEEEECCCCCCHHHHHHHHHH
Confidence            478999999999999999877


No 62 
>PRK06217 hypothetical protein; Validated
Probab=96.20  E-value=0.0047  Score=46.11  Aligned_cols=35  Identities=20%  Similarity=0.300  Sum_probs=25.2

Q ss_pred             EEEEEcCCCccHHHHHHHHhccccccccC--ceEEEEE
Q 035574           17 VVAILDSIGLDKTAFTAEAYNSSYMKHYF--DYLAWIP   52 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~~~v~~~F--~~~~wv~   52 (156)
                      .|.|.|.+|.||||||+.+...... .+|  |...|..
T Consensus         3 ~I~i~G~~GsGKSTla~~L~~~l~~-~~~~~D~~~~~~   39 (183)
T PRK06217          3 RIHITGASGSGTTTLGAALAERLDI-PHLDTDDYFWLP   39 (183)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHcCC-cEEEcCceeecc
Confidence            4889999999999999999874322 233  3455643


No 63 
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=96.18  E-value=0.0063  Score=43.20  Aligned_cols=39  Identities=8%  Similarity=0.128  Sum_probs=27.7

Q ss_pred             EEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCC
Q 035574           18 VAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYD   58 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~   58 (156)
                      +.|+|.+|.||||++..+...  ...+-..++|+.......
T Consensus         2 ~~i~G~~G~GKT~l~~~i~~~--~~~~~~~v~~~~~e~~~~   40 (165)
T cd01120           2 ILVFGPTGSGKTTLALQLALN--IATKGGKVVYVDIEEEIE   40 (165)
T ss_pred             eeEeCCCCCCHHHHHHHHHHH--HHhcCCEEEEEECCcchH
Confidence            678999999999999998773  333334567776655443


No 64 
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=96.18  E-value=0.0034  Score=48.62  Aligned_cols=21  Identities=14%  Similarity=0.245  Sum_probs=19.2

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|+|.|..|.||||||+.+..
T Consensus         1 IigI~G~sGSGKTTla~~L~~   21 (220)
T cd02025           1 IIGIAGSVAVGKSTTARVLQA   21 (220)
T ss_pred             CEEeeCCCCCCHHHHHHHHHH
Confidence            579999999999999999876


No 65 
>TIGR02236 recomb_radA DNA repair and recombination protein RadA. This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein.
Probab=96.18  E-value=0.029  Score=45.33  Aligned_cols=52  Identities=12%  Similarity=0.236  Sum_probs=38.3

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhccccccccC----ceEEEEEcCCCCCHHHHHH
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYF----DYLAWIPAPYHYDPDQILD   64 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F----~~~~wv~vs~~~~~~~l~~   64 (156)
                      ..-.++-|+|.+|+|||+|+.+++.+.......    ...+||.....|+.+++.+
T Consensus        93 ~~g~i~ei~G~~g~GKT~l~~~~~~~~~~~~~~g~~~~~~~yi~te~~f~~~rl~~  148 (310)
T TIGR02236        93 ETQAITEVFGEFGSGKTQICHQLAVNVQLPEEKGGLGGKAVYIDTENTFRPERIMQ  148 (310)
T ss_pred             CCCeEEEEECCCCCCHHHHHHHHHHHhcCCcccCCCcceEEEEECCCCCCHHHHHH
Confidence            456788899999999999999987643321111    2689999888888877653


No 66 
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=96.18  E-value=0.005  Score=41.98  Aligned_cols=22  Identities=18%  Similarity=0.379  Sum_probs=19.6

Q ss_pred             EEEEcCCCccHHHHHHHHhccc
Q 035574           18 VAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      |.|+|..|+|||||.+.+.+.+
T Consensus         2 I~V~G~~g~GKTsLi~~l~~~~   23 (119)
T PF08477_consen    2 IVVLGDSGVGKTSLIRRLCGGE   23 (119)
T ss_dssp             EEEECSTTSSHHHHHHHHHHSS
T ss_pred             EEEECcCCCCHHHHHHHHhcCC
Confidence            6799999999999999998754


No 67 
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=96.17  E-value=0.0054  Score=45.88  Aligned_cols=22  Identities=36%  Similarity=0.440  Sum_probs=19.8

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      +|+|.|..|.||||||+.+...
T Consensus         1 ii~i~G~sgsGKttla~~l~~~   22 (179)
T cd02028           1 VVGIAGPSGSGKTTFAKKLSNQ   22 (179)
T ss_pred             CEEEECCCCCCHHHHHHHHHHH
Confidence            5899999999999999998773


No 68 
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+). This enzyme catalyzes the phosphorylation of nicotinamide riboside (NR) to form nicotinamide mononucleotide (NMN). It defines the NR salvage pathway of NAD+ biosynthesis in addition to the pathways through nicotinic acid mononucleotide (NaMN). This enzyme can also phosphorylate the anticancer drug tiazofurin, which is an analog of nicotinamide riboside.
Probab=96.17  E-value=0.0037  Score=47.40  Aligned_cols=22  Identities=18%  Similarity=0.110  Sum_probs=19.9

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      +|+|.|.+|.||||||+.+...
T Consensus         1 ii~i~G~sgsGKTtla~~l~~~   22 (187)
T cd02024           1 IVGISGVTNSGKTTLAKLLQRI   22 (187)
T ss_pred             CEEEECCCCCCHHHHHHHHHHH
Confidence            5889999999999999999883


No 69 
>PF07728 AAA_5:  AAA domain (dynein-related subfamily);  InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of this ATPase AAA domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. This ATPase domain includes some proteins not detected by the IPR003959 from INTERPRO model.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NBX_X 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=96.16  E-value=0.015  Score=41.01  Aligned_cols=41  Identities=15%  Similarity=0.215  Sum_probs=27.7

Q ss_pred             EEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHH
Q 035574           18 VAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQIL   63 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~   63 (156)
                      |-++|.+|+|||+||+.++.  ....   ...-+.+++..+..++.
T Consensus         2 vlL~G~~G~GKt~l~~~la~--~~~~---~~~~i~~~~~~~~~dl~   42 (139)
T PF07728_consen    2 VLLVGPPGTGKTTLARELAA--LLGR---PVIRINCSSDTTEEDLI   42 (139)
T ss_dssp             EEEEESSSSSHHHHHHHHHH--HHTC---EEEEEE-TTTSTHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHH--Hhhc---ceEEEEeccccccccce
Confidence            45799999999999999987  3321   12334566666666554


No 70 
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=96.15  E-value=0.0049  Score=45.45  Aligned_cols=22  Identities=14%  Similarity=0.283  Sum_probs=20.4

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +++.|+|..|+|||||++.+..
T Consensus         2 ~ii~l~G~~GsGKsTl~~~L~~   23 (180)
T TIGR03263         2 LLIVISGPSGVGKSTLVKALLE   23 (180)
T ss_pred             cEEEEECCCCCCHHHHHHHHHc
Confidence            4789999999999999999988


No 71 
>PRK04301 radA DNA repair and recombination protein RadA; Validated
Probab=96.15  E-value=0.026  Score=45.89  Aligned_cols=53  Identities=13%  Similarity=0.177  Sum_probs=38.7

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhccccccccC----ceEEEEEcCCCCCHHHHHHH
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYF----DYLAWIPAPYHYDPDQILDI   65 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F----~~~~wv~vs~~~~~~~l~~~   65 (156)
                      ..-.++-|+|.+|+|||+++.++.........+    ...+||+....|+..++.+.
T Consensus       100 ~~g~vtei~G~~GsGKT~l~~~~~~~~~~~~~~gg~~~~~~yi~te~~f~~~rl~~~  156 (317)
T PRK04301        100 ETQSITEFYGEFGSGKTQICHQLAVNVQLPEEKGGLEGKAVYIDTEGTFRPERIEQM  156 (317)
T ss_pred             cCCcEEEEECCCCCCHhHHHHHHHHHhccccccCCCCceEEEEeCCCCcCHHHHHHH
Confidence            456788899999999999999987632222111    36899998888888776543


No 72 
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step in either de novo or salvage biosynthesis of thymidine triphosphate (TTP).
Probab=96.12  E-value=0.017  Score=42.68  Aligned_cols=21  Identities=14%  Similarity=0.064  Sum_probs=19.6

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|.|.|..|+||||+++.+.+
T Consensus         2 ~I~ieG~~GsGKtT~~~~L~~   22 (200)
T cd01672           2 FIVFEGIDGAGKTTLIELLAE   22 (200)
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            688999999999999999987


No 73 
>PRK03846 adenylylsulfate kinase; Provisional
Probab=96.12  E-value=0.0066  Score=45.94  Aligned_cols=25  Identities=12%  Similarity=0.021  Sum_probs=22.5

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ....++.|+|++|.||||||+.+..
T Consensus        22 ~~~~~i~i~G~~GsGKSTla~~l~~   46 (198)
T PRK03846         22 HKGVVLWFTGLSGSGKSTVAGALEE   46 (198)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHH
Confidence            4567999999999999999999877


No 74 
>PRK13949 shikimate kinase; Provisional
Probab=96.11  E-value=0.0053  Score=45.55  Aligned_cols=22  Identities=14%  Similarity=0.220  Sum_probs=19.8

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +-|.|+|+.|.||||+++.+..
T Consensus         2 ~~I~liG~~GsGKstl~~~La~   23 (169)
T PRK13949          2 ARIFLVGYMGAGKTTLGKALAR   23 (169)
T ss_pred             cEEEEECCCCCCHHHHHHHHHH
Confidence            3588999999999999999887


No 75 
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.
Probab=96.10  E-value=0.0051  Score=45.53  Aligned_cols=23  Identities=4%  Similarity=0.101  Sum_probs=20.6

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ++|-+.|++|.||||+|+.+...
T Consensus         3 ~~i~l~G~~gsGKst~a~~l~~~   25 (175)
T cd00227           3 RIIILNGGSSAGKSSIARALQSV   25 (175)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHh
Confidence            57899999999999999998773


No 76 
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=96.09  E-value=0.012  Score=47.92  Aligned_cols=26  Identities=27%  Similarity=0.293  Sum_probs=22.2

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .....+-++|.+|+|||+||+.+.+.
T Consensus        49 ~~~~~~ll~GppG~GKT~la~~ia~~   74 (328)
T PRK00080         49 EALDHVLLYGPPGLGKTTLANIIANE   74 (328)
T ss_pred             CCCCcEEEECCCCccHHHHHHHHHHH
Confidence            34567789999999999999999883


No 77 
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]
Probab=96.09  E-value=0.011  Score=48.54  Aligned_cols=47  Identities=11%  Similarity=0.049  Sum_probs=30.8

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHH
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQIL   63 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~   63 (156)
                      .+++-+.|.|||||||+|....-  +.........-|+.....++.+++
T Consensus         2 ~riv~f~GKGGVGKTT~aaA~A~--~lA~~g~kvLlvStDPAhsL~d~f   48 (322)
T COG0003           2 TRIVFFTGKGGVGKTTIAAATAV--KLAESGKKVLLVSTDPAHSLGDVF   48 (322)
T ss_pred             cEEEEEecCCcccHHHHHHHHHH--HHHHcCCcEEEEEeCCCCchHhhh
Confidence            57889999999999999887543  333333335556555555555444


No 78 
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]
Probab=96.08  E-value=0.0051  Score=51.71  Aligned_cols=32  Identities=16%  Similarity=0.179  Sum_probs=25.2

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhccccccccCc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFD   46 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~   46 (156)
                      ..+...-.||.+|+||||||+.+..  .....|.
T Consensus        46 ~~l~SmIl~GPPG~GKTTlA~liA~--~~~~~f~   77 (436)
T COG2256          46 GHLHSMILWGPPGTGKTTLARLIAG--TTNAAFE   77 (436)
T ss_pred             CCCceeEEECCCCCCHHHHHHHHHH--hhCCceE
Confidence            3466677899999999999999988  5555553


No 79 
>PHA00729 NTP-binding motif containing protein
Probab=96.08  E-value=0.011  Score=46.26  Aligned_cols=24  Identities=17%  Similarity=0.256  Sum_probs=21.0

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +...|.|.|.+|+||||||..+.+
T Consensus        16 ~f~nIlItG~pGvGKT~LA~aLa~   39 (226)
T PHA00729         16 GFVSAVIFGKQGSGKTTYALKVAR   39 (226)
T ss_pred             CeEEEEEECCCCCCHHHHHHHHHH
Confidence            345688999999999999999877


No 80 
>PRK13975 thymidylate kinase; Provisional
Probab=96.07  E-value=0.0059  Score=45.66  Aligned_cols=22  Identities=14%  Similarity=-0.008  Sum_probs=20.5

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..|.|.|+.|+||||+++.+.+
T Consensus         3 ~~I~ieG~~GsGKtT~~~~L~~   24 (196)
T PRK13975          3 KFIVFEGIDGSGKTTQAKLLAE   24 (196)
T ss_pred             eEEEEECCCCCCHHHHHHHHHH
Confidence            4789999999999999999988


No 81 
>PF00448 SRP54:  SRP54-type protein, GTPase domain;  InterPro: IPR000897  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the GTPase domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species. The GTPase domain is evolutionary related to P-loop NTPase domains found in a variety of other proteins []. These proteins include Escherichia coli and Bacillus subtilis ffh protein (P48), which seems to be the prokaryotic counterpart of SRP54; signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures, in conjunction with SRP, the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; bacterial FtsY protein, which is believed to play a similar role to that of the docking protein in eukaryotes; the pilA protein from Neisseria gonorrhoeae, the homologue of ftsY; and bacterial flagellar biosynthesis protein flhF.; GO: 0005525 GTP binding, 0006614 SRP-dependent cotranslational protein targeting to membrane; PDB: 2OG2_A 3B9Q_A 3DM9_B 3DMD_B 3E70_C 3DM5_B 2XXA_C 2J28_9 1ZU5_B 1ZU4_A ....
Probab=96.06  E-value=0.021  Score=43.49  Aligned_cols=55  Identities=27%  Similarity=0.242  Sum_probs=33.6

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcC-CCCCHHHHHHHHHHHhC
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAP-YHYDPDQILDIVAVILL   71 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs-~~~~~~~l~~~il~~l~   71 (156)
                      .+++.++|..|+||||.+.++...  .+.+=..+..++.. ......+-++..++.+.
T Consensus         1 p~vi~lvGptGvGKTTt~aKLAa~--~~~~~~~v~lis~D~~R~ga~eQL~~~a~~l~   56 (196)
T PF00448_consen    1 PKVIALVGPTGVGKTTTIAKLAAR--LKLKGKKVALISADTYRIGAVEQLKTYAEILG   56 (196)
T ss_dssp             SEEEEEEESTTSSHHHHHHHHHHH--HHHTT--EEEEEESTSSTHHHHHHHHHHHHHT
T ss_pred             CEEEEEECCCCCchHhHHHHHHHH--HhhccccceeecCCCCCccHHHHHHHHHHHhc
Confidence            368999999999999977777663  22222236666643 22334444566666554


No 82 
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=96.05  E-value=0.0067  Score=43.24  Aligned_cols=23  Identities=22%  Similarity=0.290  Sum_probs=19.9

Q ss_pred             EEEEEcCCCccHHHHHHHHhccc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      -|.++|.+|+|||||+..+.++.
T Consensus         2 ki~~~G~~~~GKTsl~~~l~~~~   24 (164)
T cd04139           2 KVIVVGAGGVGKSALTLQFMYDE   24 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCC
Confidence            37899999999999999987654


No 83 
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]
Probab=96.05  E-value=0.006  Score=54.56  Aligned_cols=42  Identities=17%  Similarity=0.287  Sum_probs=31.1

Q ss_pred             HHHHHHHhc----CCCCcEEEEEEcCCCccHHHHHHHHhccccccccC
Q 035574            2 EELLDLLIE----GPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYF   45 (156)
Q Consensus         2 ~~l~~~L~~----~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F   45 (156)
                      |++++.|.-    ....-.++.+||.+|+|||+|++.+..  .....|
T Consensus       333 eRIlEyLAV~~l~~~~kGpILcLVGPPGVGKTSLgkSIA~--al~Rkf  378 (782)
T COG0466         333 ERILEYLAVQKLTKKLKGPILCLVGPPGVGKTSLGKSIAK--ALGRKF  378 (782)
T ss_pred             HHHHHHHHHHHHhccCCCcEEEEECCCCCCchhHHHHHHH--HhCCCE
Confidence            455666532    233447899999999999999999988  555555


No 84 
>smart00763 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=96.05  E-value=0.0092  Score=49.65  Aligned_cols=38  Identities=11%  Similarity=0.222  Sum_probs=28.5

Q ss_pred             HHHHHHHhcC----CCCcEEEEEEcCCCccHHHHHHHHhccc
Q 035574            2 EELLDLLIEG----PTQLSVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus         2 ~~l~~~L~~~----~~~~~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      +++++++...    ....+++.++|.+|.||||||+.+.+..
T Consensus        61 ~~lv~~l~~~a~g~~~~r~il~L~GPPGsGKStla~~La~~l  102 (361)
T smart00763       61 ERFVNYFKSAAQGLEERKQILYLLGPVGGGKSSLVECLKRGL  102 (361)
T ss_pred             HHHHHHHHHHHhcCCCCCcEEEEECCCCCCHHHHHHHHHHHH
Confidence            3455666441    3456889999999999999999998743


No 85 
>PRK00300 gmk guanylate kinase; Provisional
Probab=96.04  E-value=0.0057  Score=46.13  Aligned_cols=24  Identities=8%  Similarity=0.138  Sum_probs=21.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+|.|+|..|+|||||++.+...
T Consensus         5 g~~i~i~G~sGsGKstl~~~l~~~   28 (205)
T PRK00300          5 GLLIVLSGPSGAGKSTLVKALLER   28 (205)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHhh
Confidence            468999999999999999999873


No 86 
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]
Probab=96.03  E-value=0.045  Score=49.95  Aligned_cols=67  Identities=22%  Similarity=0.303  Sum_probs=48.0

Q ss_pred             CHHHHHHHhcCCCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCC-CCHHHHHHHHHHHhC
Q 035574            1 MEELLDLLIEGPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYH-YDPDQILDIVAVILL   71 (156)
Q Consensus         1 r~~l~~~L~~~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~-~~~~~l~~~il~~l~   71 (156)
                      |.++++.|... .+.|.+-|....|.|||||+.+...  +... =..+.|+++.+. -++..+.+-++..+.
T Consensus        24 R~rL~~~L~~~-~~~RL~li~APAGfGKttl~aq~~~--~~~~-~~~v~Wlslde~dndp~rF~~yLi~al~   91 (894)
T COG2909          24 RPRLLDRLRRA-NDYRLILISAPAGFGKTTLLAQWRE--LAAD-GAAVAWLSLDESDNDPARFLSYLIAALQ   91 (894)
T ss_pred             cHHHHHHHhcC-CCceEEEEeCCCCCcHHHHHHHHHH--hcCc-ccceeEeecCCccCCHHHHHHHHHHHHH
Confidence            45666766543 3589999999999999999999865  2221 234899998664 467777777777664


No 87 
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=96.03  E-value=0.0051  Score=44.07  Aligned_cols=21  Identities=10%  Similarity=0.196  Sum_probs=18.8

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      +-+.|.+|+||||+|+.+...
T Consensus         2 i~l~G~~GsGKST~a~~l~~~   22 (150)
T cd02021           2 IVVMGVSGSGKSTVGKALAER   22 (150)
T ss_pred             EEEEcCCCCCHHHHHHHHHhh
Confidence            678999999999999999774


No 88 
>PF03205 MobB:  Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A.
Probab=96.02  E-value=0.013  Score=42.30  Aligned_cols=38  Identities=16%  Similarity=0.126  Sum_probs=26.6

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcccccc-ccCceEEEEEcCC
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSSYMK-HYFDYLAWIPAPY   55 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~~v~-~~F~~~~wv~vs~   55 (156)
                      .+|.|+|..++|||||++.+.+  ... ..+...+.....+
T Consensus         1 pvv~VvG~~~sGKTTl~~~Li~--~l~~~g~~v~~ik~~~~   39 (140)
T PF03205_consen    1 PVVQVVGPKNSGKTTLIRKLIN--ELKRRGYRVAVIKHTDH   39 (140)
T ss_dssp             -EEEEEESTTSSHHHHHHHHHH--HHHHTT--EEEEEE-ST
T ss_pred             CEEEEECCCCCCHHHHHHHHHH--HHhHcCCceEEEEEccC
Confidence            3789999999999999999988  443 4455555565544


No 89 
>PRK13342 recombination factor protein RarA; Reviewed
Probab=96.02  E-value=0.024  Score=47.76  Aligned_cols=23  Identities=22%  Similarity=0.211  Sum_probs=20.6

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+-++|.+|+||||||+.+++
T Consensus        36 ~~~ilL~GppGtGKTtLA~~ia~   58 (413)
T PRK13342         36 LSSMILWGPPGTGKTTLARIIAG   58 (413)
T ss_pred             CceEEEECCCCCCHHHHHHHHHH
Confidence            45677899999999999999988


No 90 
>PRK13230 nitrogenase reductase-like protein; Reviewed
Probab=96.02  E-value=0.006  Score=48.51  Aligned_cols=23  Identities=9%  Similarity=0.131  Sum_probs=19.0

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +++|+|+|-||+||||++..+..
T Consensus         1 ~~~i~~~gKGGVGKTT~a~nLA~   23 (279)
T PRK13230          1 MRKFCFYGKGGIGKSTTVCNIAA   23 (279)
T ss_pred             CcEEEEECCCCCcHHHHHHHHHH
Confidence            36789999999999998777644


No 91 
>PRK13236 nitrogenase reductase; Reviewed
Probab=96.00  E-value=0.0073  Score=48.73  Aligned_cols=26  Identities=12%  Similarity=0.236  Sum_probs=21.1

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +.+.+++++.|-||+||||++..+..
T Consensus         3 ~~~~~~~~~~GKGGVGKTt~a~NLA~   28 (296)
T PRK13236          3 DENIRQIAFYGKGGIGKSTTSQNTLA   28 (296)
T ss_pred             CcCceEEEEECCCcCCHHHHHHHHHH
Confidence            34679999999999999997666543


No 92 
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase. Nitrogenase is responsible for the biological nitrogen fixation, i.e. reduction of molecular nitrogen to ammonia. NifH consists of two oxygen-sensitive metallosulfur proteins: the mollybdenum-iron (alternatively, vanadium-iron or iron-iron) protein (commonly referred to as component 1), and the iron protein (commonly referred to as component 2). The iron protein is a homodimer, with an Fe4S4 cluster bound between the subunits and two ATP-binding domains. It supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component 1 for the reduction of molecular nitrogen to ammonia.
Probab=96.00  E-value=0.006  Score=47.86  Aligned_cols=22  Identities=23%  Similarity=0.243  Sum_probs=18.7

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ++|+|.|-||+||||++..+..
T Consensus         2 ~~iav~~KGGvGKTT~~~nLA~   23 (270)
T cd02040           2 RQIAIYGKGGIGKSTTTQNLSA   23 (270)
T ss_pred             cEEEEEeCCcCCHHHHHHHHHH
Confidence            5788899999999998877654


No 93 
>PF00625 Guanylate_kin:  Guanylate kinase;  InterPro: IPR008144 Guanylate kinase (2.7.4.8 from EC) (GK) [] catalyzes the ATP-dependent phosphorylation of GMP into GDP. It is essential for recycling GMP and indirectly, cGMP. In prokaryotes (such as Escherichia coli), lower eukaryotes (such as yeast) and in vertebrates, GK is a highly conserved monomeric protein of about 200 amino acids. GK has been shown [, , ] to be structurally similar to protein A57R (or SalG2R) from various strains of Vaccinia virus. Proteins containing one or more copies of the DHR domain, an SH3 domain as well as a C-terminal GK-like domain, are collectively termed MAGUKs (membrane-associated guanylate kinase homologs) [], and include Drosophila lethal(1)discs large-1 tumor suppressor protein (gene dlg1); mammalian tight junction protein Zo-1; a family of mammalian synaptic proteins that seem to interact with the cytoplasmic tail of NMDA receptor subunits (SAP90/PSD-95, CHAPSYN-110/PSD-93, SAP97/DLG1 and SAP102); vertebrate 55kDa erythrocyte membrane protein (p55); Caenorhabditis elegans protein lin-2; rat protein CASK; and human proteins DLG2 and DLG3. There is an ATP-binding site (P-loop) in the N-terminal section of GK, which is not conserved in the GK-like domain of the above proteins. However these proteins retain the residues known, in GK, to be involved in the binding of GMP.; GO: 0005515 protein binding; PDB: 3UAT_A 3KFV_A 2ANC_F 2F3T_E 2ANB_A 2AN9_A 1S96_A 2F3R_B 3TR0_A 1LVG_A ....
Probab=96.00  E-value=0.011  Score=44.15  Aligned_cols=36  Identities=8%  Similarity=0.113  Sum_probs=28.3

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEE
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIP   52 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~   52 (156)
                      .+++.|+|..|+|||||++.+..  .....|...+..+
T Consensus         2 ~r~ivl~Gpsg~GK~~l~~~L~~--~~~~~~~~~v~~T   37 (183)
T PF00625_consen    2 RRPIVLVGPSGSGKSTLAKRLIQ--EFPDKFGRVVSHT   37 (183)
T ss_dssp             SSEEEEESSTTSSHHHHHHHHHH--HSTTTEEEEEEEE
T ss_pred             CCEEEEECCCCCCHHHHHHHHHH--hcccccccceeec
Confidence            47889999999999999999988  5556675444443


No 94 
>PF01583 APS_kinase:  Adenylylsulphate kinase;  InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This domain contains an ATP binding P-loop motif [].; GO: 0005524 ATP binding, 0016301 kinase activity, 0016772 transferase activity, transferring phosphorus-containing groups, 0000103 sulfate assimilation; PDB: 1M7H_B 1M7G_B 3CR7_B 1D6J_A 2OFW_G 1X6V_B 1XNJ_A 1XJQ_B 2PEY_A 2PEZ_B ....
Probab=96.00  E-value=0.0094  Score=43.98  Aligned_cols=34  Identities=12%  Similarity=-0.068  Sum_probs=25.5

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccccccccCceEEEE
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWI   51 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv   51 (156)
                      .+|=+.|.+|.||||||+.+..  +....-....++
T Consensus         3 ~vIwltGlsGsGKtTlA~~L~~--~L~~~g~~~~~L   36 (156)
T PF01583_consen    3 FVIWLTGLSGSGKTTLARALER--RLFARGIKVYLL   36 (156)
T ss_dssp             EEEEEESSTTSSHHHHHHHHHH--HHHHTTS-EEEE
T ss_pred             EEEEEECCCCCCHHHHHHHHHH--HHHHcCCcEEEe
Confidence            5778899999999999999988  554443445555


No 95 
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=95.99  E-value=0.006  Score=43.61  Aligned_cols=20  Identities=15%  Similarity=0.248  Sum_probs=18.5

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |.++|++|.||||+|+.+..
T Consensus         2 i~l~G~~GsGKstla~~la~   21 (154)
T cd00464           2 IVLIGMMGAGKTTVGRLLAK   21 (154)
T ss_pred             EEEEcCCCCCHHHHHHHHHH
Confidence            67899999999999999976


No 96 
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional
Probab=95.98  E-value=0.009  Score=44.80  Aligned_cols=24  Identities=21%  Similarity=0.224  Sum_probs=21.6

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+++|+|..|.|||||++.+..
T Consensus         5 ~~~ii~ivG~sgsGKTTLi~~li~   28 (173)
T PRK10751          5 MIPLLAIAAWSGTGKTTLLKKLIP   28 (173)
T ss_pred             CceEEEEECCCCChHHHHHHHHHH
Confidence            457899999999999999999886


No 97 
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]
Probab=95.97  E-value=0.014  Score=45.99  Aligned_cols=53  Identities=19%  Similarity=0.167  Sum_probs=40.1

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHHHHH
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDIVAV   68 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~il~   68 (156)
                      -+.-+++-|.|.+|+|||+++.+...  +.....+..+||+..+.  ..++.+...+
T Consensus        20 ~p~g~~~lI~G~pGsGKT~f~~qfl~--~~~~~ge~vlyvs~~e~--~~~l~~~~~~   72 (260)
T COG0467          20 LPRGSVVLITGPPGTGKTIFALQFLY--EGAREGEPVLYVSTEES--PEELLENARS   72 (260)
T ss_pred             CcCCcEEEEEcCCCCcHHHHHHHHHH--HHHhcCCcEEEEEecCC--HHHHHHHHHH
Confidence            45678999999999999999999877  45555788999987664  4455555543


No 98 
>PRK06893 DNA replication initiation factor; Validated
Probab=95.95  E-value=0.0074  Score=46.85  Aligned_cols=37  Identities=14%  Similarity=0.065  Sum_probs=27.2

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcC
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAP   54 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs   54 (156)
                      ..+-++|.+|+|||+|++.+++.  ...+.....|+.+.
T Consensus        40 ~~l~l~G~~G~GKThL~~ai~~~--~~~~~~~~~y~~~~   76 (229)
T PRK06893         40 PFFYIWGGKSSGKSHLLKAVSNH--YLLNQRTAIYIPLS   76 (229)
T ss_pred             CeEEEECCCCCCHHHHHHHHHHH--HHHcCCCeEEeeHH
Confidence            56789999999999999999983  32223345666654


No 99 
>TIGR01287 nifH nitrogenase iron protein. This model describes nitrogenase (EC 1.18.6.1) iron protein, also called nitrogenase reductase or nitrogenase component II. This model includes molybdenum-iron nitrogenase reductase (nifH), vanadium-iron nitrogenase reductase (vnfH), and iron-iron nitrogenase reductase (anfH). The model excludes the homologous protein from the light-independent protochlorophyllide reductase.
Probab=95.94  E-value=0.006  Score=48.30  Aligned_cols=22  Identities=23%  Similarity=0.244  Sum_probs=18.3

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +.|+|.|-||+||||++..+..
T Consensus         1 ~~ia~~gKGGVGKTT~a~nLA~   22 (275)
T TIGR01287         1 RQIAIYGKGGIGKSTTTQNIAA   22 (275)
T ss_pred             CeeEEeCCCcCcHHHHHHHHHH
Confidence            4689999999999998776654


No 100
>PF03308 ArgK:  ArgK protein;  InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components. In Escherichia coli, the arginine-ornithine transport system requires an arginine-ornithine-binding protein and the lysine-arginine-ornithine (LAO) transport system includes a LAO-binding protein. Both periplasmic proteins can be phosphorylated by a single kinase, ArgK [] resulting in reduced levels of transport activity of the periplasmic transport systems that include each of the binding proteins. The ArgK protein acts as an ATPase enzyme and as a kinase.; PDB: 3MD0_A 3P32_A 2QM7_A 2QM8_A 2WWW_D 2P67_A 3NXS_A.
Probab=95.94  E-value=0.012  Score=46.80  Aligned_cols=35  Identities=23%  Similarity=0.271  Sum_probs=26.4

Q ss_pred             HHHHHHhcCCCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574            3 ELLDLLIEGPTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus         3 ~l~~~L~~~~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +++..|.....+..+|+|.|.+|.||+||...+-.
T Consensus        17 ~ll~~l~~~~g~a~~iGiTG~PGaGKSTli~~l~~   51 (266)
T PF03308_consen   17 ELLKRLYPHTGRAHVIGITGPPGAGKSTLIDALIR   51 (266)
T ss_dssp             HHHHHHGGGTT-SEEEEEEE-TTSSHHHHHHHHHH
T ss_pred             HHHHHHHhhcCCceEEEeeCCCCCcHHHHHHHHHH
Confidence            45666665556778999999999999999887755


No 101
>TIGR00150 HI0065_YjeE ATPase, YjeE family. Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.
Probab=95.90  E-value=0.013  Score=42.03  Aligned_cols=36  Identities=14%  Similarity=0.097  Sum_probs=26.2

Q ss_pred             HHHHHhcCCCCcEEEEEEcCCCccHHHHHHHHhccc
Q 035574            4 LLDLLIEGPTQLSVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus         4 l~~~L~~~~~~~~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      +.+.|.+.-..-.++.+.|.-|.||||+++.+....
T Consensus        11 l~~~l~~~l~~~~~i~l~G~lGaGKTtl~~~l~~~l   46 (133)
T TIGR00150        11 FGKAFAKPLDFGTVVLLKGDLGAGKTTLVQGLLQGL   46 (133)
T ss_pred             HHHHHHHhCCCCCEEEEEcCCCCCHHHHHHHHHHHc
Confidence            333443333345689999999999999999998743


No 102
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN. Members of this family are the GvpN protein associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy. This family belongs to a larger family of ATPases (pfam07728).
Probab=95.90  E-value=0.013  Score=46.35  Aligned_cols=21  Identities=19%  Similarity=0.213  Sum_probs=18.6

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -+-+.|.+|+|||+||+.+..
T Consensus        23 ~vLL~G~~GtGKT~lA~~la~   43 (262)
T TIGR02640        23 PVHLRGPAGTGKTTLAMHVAR   43 (262)
T ss_pred             eEEEEcCCCCCHHHHHHHHHH
Confidence            345899999999999999986


No 103
>PLN02318 phosphoribulokinase/uridine kinase
Probab=95.89  E-value=0.013  Score=51.93  Aligned_cols=33  Identities=27%  Similarity=0.390  Sum_probs=27.1

Q ss_pred             HHHHhcCCCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574            5 LDLLIEGPTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus         5 ~~~L~~~~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .+.|.+...+..+|+|.|..|.||||||+.+..
T Consensus        55 ~qlL~~~~~~riIIGIaGpSGSGKTTLAk~Lag   87 (656)
T PLN02318         55 CQLLAQKNDGIILVGVAGPSGAGKTVFTEKVLN   87 (656)
T ss_pred             HHHHHhcCCCeEEEEEECCCCCcHHHHHHHHHh
Confidence            344555556688999999999999999999977


No 104
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=95.88  E-value=0.0078  Score=45.03  Aligned_cols=23  Identities=13%  Similarity=0.222  Sum_probs=20.5

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ..+.|+|+.|.|||||++.+...
T Consensus         3 ~~i~l~G~sGsGKsTl~~~l~~~   25 (186)
T PRK10078          3 KLIWLMGPSGSGKDSLLAALRQR   25 (186)
T ss_pred             cEEEEECCCCCCHHHHHHHHhcc
Confidence            46889999999999999999773


No 105
>PF04665 Pox_A32:  Poxvirus A32 protein;  InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein. This is thought to be an ATPase involved in viral DNA packaging [].
Probab=95.88  E-value=0.012  Score=46.32  Aligned_cols=35  Identities=26%  Similarity=0.432  Sum_probs=29.0

Q ss_pred             EEEEEcCCCccHHHHHHHHhccccccccCceEEEEEc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPA   53 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~v   53 (156)
                      .+.|+|..|.|||||...+..  ...+.|+.+.+++-
T Consensus        15 r~viIG~sGSGKT~li~~lL~--~~~~~f~~I~l~t~   49 (241)
T PF04665_consen   15 RMVIIGKSGSGKTTLIKSLLY--YLRHKFDHIFLITP   49 (241)
T ss_pred             eEEEECCCCCCHHHHHHHHHH--hhcccCCEEEEEec
Confidence            578999999999999999987  56778877776653


No 106
>TIGR00554 panK_bact pantothenate kinase, bacterial type. Shown to be a homodimer in E. coli. This enzyme catalyzes the rate-limiting step in the biosynthesis of coenzyme A. It is very well conserved from E. coli to B. subtilis, but differs considerably from known eukaryotic forms, described in a separate model.
Probab=95.87  E-value=0.012  Score=47.52  Aligned_cols=24  Identities=13%  Similarity=0.133  Sum_probs=20.8

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHh
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAY   36 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy   36 (156)
                      ....+|+|.|..|+||||+|+.+.
T Consensus        60 ~~p~IIGIaG~~GSGKSTlar~L~   83 (290)
T TIGR00554        60 KIPYIISIAGSVAVGKSTTARILQ   83 (290)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHH
Confidence            456899999999999999998663


No 107
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the  protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase. Members of this family use energey from ATP hydrolysis and transfer electrons through a Fe4-S4 cluster to other subunit for reduction of substrate.
Probab=95.86  E-value=0.0075  Score=46.03  Aligned_cols=22  Identities=18%  Similarity=0.228  Sum_probs=18.2

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ++|+|.|-||+||||++..+..
T Consensus         1 ~~iav~gKGGvGKTt~~~nLA~   22 (212)
T cd02117           1 RQIAIYGKGGIGKSTTSQNLSA   22 (212)
T ss_pred             CEEEEECCCcCcHHHHHHHHHH
Confidence            5789999999999997766544


No 108
>TIGR00064 ftsY signal recognition particle-docking protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In E.coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.
Probab=95.85  E-value=0.019  Score=45.90  Aligned_cols=25  Identities=24%  Similarity=0.282  Sum_probs=21.2

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+++.++|.+|+||||.+..+..
T Consensus        70 ~~~~vi~l~G~~G~GKTTt~akLA~   94 (272)
T TIGR00064        70 NKPNVILFVGVNGVGKTTTIAKLAN   94 (272)
T ss_pred             CCCeEEEEECCCCCcHHHHHHHHHH
Confidence            3468999999999999998887765


No 109
>PRK13232 nifH nitrogenase reductase; Reviewed
Probab=95.85  E-value=0.0076  Score=47.76  Aligned_cols=22  Identities=23%  Similarity=0.243  Sum_probs=18.3

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ++|+|.|-||+||||++..+..
T Consensus         2 ~~iav~gKGGVGKTT~a~nLA~   23 (273)
T PRK13232          2 RQIAIYGKGGIGKSTTTQNLTA   23 (273)
T ss_pred             CEEEEECCCCCcHHHHHHHHHH
Confidence            5788899999999998776544


No 110
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.
Probab=95.84  E-value=0.0085  Score=42.89  Aligned_cols=20  Identities=10%  Similarity=0.282  Sum_probs=18.9

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      +.|+|..|+|||||++.+..
T Consensus         2 i~i~GpsGsGKstl~~~L~~   21 (137)
T cd00071           2 IVLSGPSGVGKSTLLKRLLE   21 (137)
T ss_pred             EEEECCCCCCHHHHHHHHHh
Confidence            68999999999999999987


No 111
>PRK04182 cytidylate kinase; Provisional
Probab=95.82  E-value=0.0088  Score=43.80  Aligned_cols=21  Identities=19%  Similarity=0.197  Sum_probs=19.7

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|.|.|+.|.||||+|+.+.+
T Consensus         2 ~I~i~G~~GsGKstia~~la~   22 (180)
T PRK04182          2 IITISGPPGSGKTTVARLLAE   22 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            689999999999999999987


No 112
>TIGR00073 hypB hydrogenase accessory protein HypB. HypB is implicated in insertion of nickel into the large subunit of NiFe hydrogenases.
Probab=95.81  E-value=0.0095  Score=45.36  Aligned_cols=26  Identities=23%  Similarity=0.305  Sum_probs=23.6

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..+.++|.++|..|.|||||..++..
T Consensus        19 ~~~~~~i~~~G~~gsGKTTli~~l~~   44 (207)
T TIGR00073        19 KHGLVVLNFMSSPGSGKTTLIEKLID   44 (207)
T ss_pred             hcCcEEEEEECCCCCCHHHHHHHHHH
Confidence            46799999999999999999999876


No 113
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB. This molybdenum cofactor biosynthesis enzyme is similar to the urease accessory protein UreG and to the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocenters of their respective target enzymes.
Probab=95.80  E-value=0.012  Score=43.17  Aligned_cols=21  Identities=19%  Similarity=0.227  Sum_probs=19.4

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      |+.|+|..|+|||||+..+..
T Consensus         1 vi~i~G~~gsGKTtl~~~l~~   21 (155)
T TIGR00176         1 VLQIVGPKNSGKTTLIERLVK   21 (155)
T ss_pred             CEEEECCCCCCHHHHHHHHHH
Confidence            578999999999999999888


No 114
>PF00910 RNA_helicase:  RNA helicase;  InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5). All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below:  Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein.   The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity
Probab=95.79  E-value=0.0062  Score=41.69  Aligned_cols=20  Identities=20%  Similarity=0.325  Sum_probs=16.8

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |-|+|.+|+|||+||+.+..
T Consensus         1 I~i~G~~G~GKS~l~~~l~~   20 (107)
T PF00910_consen    1 IWIYGPPGIGKSTLAKELAK   20 (107)
T ss_pred             CEEECCCCCCHHHHHHHHHH
Confidence            35899999999999999654


No 115
>PF07726 AAA_3:  ATPase family associated with various cellular activities (AAA);  InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model. AAA ATPases form a large, functionally diverse protein family belonging to the AAA+ superfamily of ring-shaped P-loop NTPases, which exert their activity through the energy-dependent unfolding of macromolecules. AAA ATPases contain a P-loop NTPase domain, which is the most abundant class of NTP-binding protein fold, and is found throughout all kingdoms of life []. P-loop NTPase domains act to hydrolyse the beta-gamma phosphate bond of bound nucleoside triphosphate. There are two classes of P-loop domains: the KG (kinase-GTPase) division, and the ASCE division, the latter including the AAA+ group as well as several other ATPases. There are at least six major clades of AAA domains (metalloproteases, meiotic proteins, D1 and D2 domains of ATPases with two AAA domains, proteasome subunits, and BSC1), as well as several minor clades, some of which consist of hypothetical proteins []. The domain organisation of AAA ATPases consists of a non-ATPase N-terminal domain that acts in substrate recognition, followed by one or two AAA domains (D1 and D2), one of which may be degenerate.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 2R44_A.
Probab=95.79  E-value=0.0064  Score=43.54  Aligned_cols=27  Identities=19%  Similarity=0.201  Sum_probs=18.0

Q ss_pred             EEEEcCCCccHHHHHHHHhccccccccCc
Q 035574           18 VAILDSIGLDKTAFTAEAYNSSYMKHYFD   46 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~~v~~~F~   46 (156)
                      +=++|.+|+||||+|+.+..  .+...|.
T Consensus         2 vLleg~PG~GKT~la~~lA~--~~~~~f~   28 (131)
T PF07726_consen    2 VLLEGVPGVGKTTLAKALAR--SLGLSFK   28 (131)
T ss_dssp             EEEES---HHHHHHHHHHHH--HTT--EE
T ss_pred             EeeECCCccHHHHHHHHHHH--HcCCcee
Confidence            34799999999999999988  5666664


No 116
>PRK13946 shikimate kinase; Provisional
Probab=95.78  E-value=0.0084  Score=44.86  Aligned_cols=23  Identities=13%  Similarity=0.190  Sum_probs=20.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .+.|.++|+.|.||||+++.+.+
T Consensus        10 ~~~I~l~G~~GsGKsti~~~LA~   32 (184)
T PRK13946         10 KRTVVLVGLMGAGKSTVGRRLAT   32 (184)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHH
Confidence            35789999999999999999987


No 117
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to drive ATP synthesis and hydrolyzes ATP to build the proton gradient. The extrinisic membrane domain, F1,  is composed of alpha, beta, gamma, delta and epsilon subunits with a stoichiometry of 3:3:1:1:1. The beta subunit of ATP synthase is catalytic.
Probab=95.78  E-value=0.014  Score=46.85  Aligned_cols=50  Identities=10%  Similarity=0.129  Sum_probs=34.9

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccccccccCce-EEEEEcCCCCC-HHHHHHHHH
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSSYMKHYFDY-LAWIPAPYHYD-PDQILDIVA   67 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~-~~wv~vs~~~~-~~~l~~~il   67 (156)
                      .-+.|.|-.|+|||||++.+++  .++.+|+. ++++-+++... ..++.+++.
T Consensus        70 Qr~~If~~~G~GKTtLa~~i~~--~i~~~~~~~~V~~~iGer~~Ev~e~~~~~~  121 (274)
T cd01133          70 GKIGLFGGAGVGKTVLIMELIN--NIAKAHGGYSVFAGVGERTREGNDLYHEMK  121 (274)
T ss_pred             CEEEEecCCCCChhHHHHHHHH--HHHhcCCCEEEEEEeccCcHHHHHHHHHHH
Confidence            4568899999999999999999  55555654 55555666543 445555543


No 118
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]
Probab=95.78  E-value=0.0084  Score=45.29  Aligned_cols=24  Identities=17%  Similarity=0.228  Sum_probs=21.0

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      .-|.++|.+|+|||||+..+..+.
T Consensus         6 ~kivv~G~~g~GKTtl~~~l~~~~   29 (219)
T COG1100           6 FKIVVLGDGGVGKTTLLNRLVGDE   29 (219)
T ss_pred             EEEEEEcCCCccHHHHHHHHhcCc
Confidence            467899999999999999998754


No 119
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=95.77  E-value=0.016  Score=41.98  Aligned_cols=24  Identities=17%  Similarity=0.058  Sum_probs=21.3

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ...+.|+|..|+|||||...+.+.
T Consensus        14 ~~~v~i~G~~g~GKStLl~~l~~~   37 (173)
T cd04155          14 EPRILILGLDNAGKTTILKQLASE   37 (173)
T ss_pred             ccEEEEEccCCCCHHHHHHHHhcC
Confidence            455899999999999999999884


No 120
>PRK08084 DNA replication initiation factor; Provisional
Probab=95.76  E-value=0.019  Score=44.75  Aligned_cols=38  Identities=8%  Similarity=0.162  Sum_probs=26.6

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcC
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAP   54 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs   54 (156)
                      ...+-|+|..|+|||+|++.+++.  ....-....++.+.
T Consensus        45 ~~~l~l~Gp~G~GKThLl~a~~~~--~~~~~~~v~y~~~~   82 (235)
T PRK08084         45 SGYIYLWSREGAGRSHLLHAACAE--LSQRGRAVGYVPLD   82 (235)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHHH--HHhCCCeEEEEEHH
Confidence            457889999999999999998873  22222234555553


No 121
>PRK09435 membrane ATPase/protein kinase; Provisional
Probab=95.76  E-value=0.017  Score=47.56  Aligned_cols=26  Identities=15%  Similarity=0.130  Sum_probs=22.5

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .....+|+|.|.+|+|||||+..+..
T Consensus        53 ~~~~~~igi~G~~GaGKSTl~~~l~~   78 (332)
T PRK09435         53 TGNALRIGITGVPGVGKSTFIEALGM   78 (332)
T ss_pred             CCCcEEEEEECCCCCCHHHHHHHHHH
Confidence            45678999999999999999998655


No 122
>PRK13948 shikimate kinase; Provisional
Probab=95.75  E-value=0.01  Score=44.71  Aligned_cols=24  Identities=21%  Similarity=0.201  Sum_probs=21.5

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..+.|.++||.|+||||+++.+.+
T Consensus         9 ~~~~I~LiG~~GsGKSTvg~~La~   32 (182)
T PRK13948          9 PVTWVALAGFMGTGKSRIGWELSR   32 (182)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHH
Confidence            457788999999999999999977


No 123
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional
Probab=95.74  E-value=0.012  Score=47.31  Aligned_cols=23  Identities=17%  Similarity=0.277  Sum_probs=20.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +++++|+|..|+|||||+.++..
T Consensus         1 M~~i~i~G~~gSGKTTLi~~Li~   23 (274)
T PRK14493          1 MKVLSIVGYKATGKTTLVERLVD   23 (274)
T ss_pred             CcEEEEECCCCCCHHHHHHHHHH
Confidence            36899999999999999998876


No 124
>PRK05439 pantothenate kinase; Provisional
Probab=95.73  E-value=0.019  Score=46.98  Aligned_cols=26  Identities=12%  Similarity=0.101  Sum_probs=22.6

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ....-+|+|.|.+|+||||+|+.+..
T Consensus        83 ~~~~~iIgIaG~~gsGKSTla~~L~~  108 (311)
T PRK05439         83 QKVPFIIGIAGSVAVGKSTTARLLQA  108 (311)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHH
Confidence            45567999999999999999998765


No 125
>PRK12339 2-phosphoglycerate kinase; Provisional
Probab=95.72  E-value=0.011  Score=45.09  Aligned_cols=24  Identities=17%  Similarity=0.088  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ..+|-|.|.+|+||||+|+.+...
T Consensus         3 ~~~i~i~G~~G~GKst~a~~l~~~   26 (197)
T PRK12339          3 STIHFIGGIPGVGKTSISGYIARH   26 (197)
T ss_pred             ceEEEEECCCCCCHHHHHHHHHHh
Confidence            468899999999999999998873


No 126
>PRK14530 adenylate kinase; Provisional
Probab=95.70  E-value=0.0092  Score=45.66  Aligned_cols=21  Identities=14%  Similarity=0.191  Sum_probs=19.1

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .|.|+|++|+||||+|+.+..
T Consensus         5 ~I~i~G~pGsGKsT~~~~La~   25 (215)
T PRK14530          5 RILLLGAPGAGKGTQSSNLAE   25 (215)
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            588999999999999999866


No 127
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]
Probab=95.70  E-value=0.018  Score=51.80  Aligned_cols=42  Identities=19%  Similarity=0.382  Sum_probs=32.2

Q ss_pred             HHHHHHHhc----CCCCcEEEEEEcCCCccHHHHHHHHhccccccccC
Q 035574            2 EELLDLLIE----GPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYF   45 (156)
Q Consensus         2 ~~l~~~L~~----~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F   45 (156)
                      ++++++|.-    ++.+-.++..+|.+|||||++|+.+..  .....|
T Consensus       421 eRILEfiAV~kLrgs~qGkIlCf~GPPGVGKTSI~kSIA~--ALnRkF  466 (906)
T KOG2004|consen  421 ERILEFIAVGKLRGSVQGKILCFVGPPGVGKTSIAKSIAR--ALNRKF  466 (906)
T ss_pred             HHHHHHHHHHhhcccCCCcEEEEeCCCCCCcccHHHHHHH--HhCCce
Confidence            456666632    456678999999999999999999988  555554


No 128
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=95.69  E-value=0.017  Score=45.52  Aligned_cols=23  Identities=13%  Similarity=0.125  Sum_probs=20.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||++.+..
T Consensus        33 Ge~lgivGeSGsGKSTL~r~l~G   55 (252)
T COG1124          33 GETLGIVGESGSGKSTLARLLAG   55 (252)
T ss_pred             CCEEEEEcCCCCCHHHHHHHHhc
Confidence            46889999999999999999854


No 129
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.
Probab=95.68  E-value=0.017  Score=46.31  Aligned_cols=26  Identities=23%  Similarity=0.266  Sum_probs=21.8

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .....+-++|.+|+|||+||+.+.+.
T Consensus        28 ~~~~~~ll~Gp~G~GKT~la~~ia~~   53 (305)
T TIGR00635        28 EALDHLLLYGPPGLGKTTLAHIIANE   53 (305)
T ss_pred             CCCCeEEEECCCCCCHHHHHHHHHHH
Confidence            33556789999999999999999883


No 130
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=95.67  E-value=0.012  Score=41.92  Aligned_cols=22  Identities=14%  Similarity=0.234  Sum_probs=19.3

Q ss_pred             EEEEcCCCccHHHHHHHHhccc
Q 035574           18 VAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      |.++|.+|+|||||+..+.++.
T Consensus         3 i~~vG~~~vGKTsli~~l~~~~   24 (168)
T cd04119           3 VISMGNSGVGKSCIIKRYCEGR   24 (168)
T ss_pred             EEEECCCCCCHHHHHHHHHhCC
Confidence            6899999999999999987653


No 131
>PF13521 AAA_28:  AAA domain; PDB: 1LW7_A.
Probab=95.67  E-value=0.009  Score=43.56  Aligned_cols=20  Identities=15%  Similarity=0.119  Sum_probs=16.8

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |.|.|..|+|||||++.+..
T Consensus         2 I~i~G~~stGKTTL~~~L~~   21 (163)
T PF13521_consen    2 IVITGGPSTGKTTLIEALAA   21 (163)
T ss_dssp             EEEE--TTSHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            78999999999999999987


No 132
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.
Probab=95.67  E-value=0.0086  Score=43.40  Aligned_cols=21  Identities=14%  Similarity=0.137  Sum_probs=18.8

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ++-|+|.+|.||||||+.+..
T Consensus         1 ~i~i~G~~GsGKSTla~~L~~   21 (149)
T cd02027           1 VIWLTGLSGSGKSTIARALEE   21 (149)
T ss_pred             CEEEEcCCCCCHHHHHHHHHH
Confidence            467899999999999999877


No 133
>PRK13235 nifH nitrogenase reductase; Reviewed
Probab=95.67  E-value=0.0093  Score=47.27  Aligned_cols=22  Identities=27%  Similarity=0.283  Sum_probs=18.5

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ++|+|.|-||+||||++-.+..
T Consensus         2 ~~iav~~KGGVGKTT~~~nLA~   23 (274)
T PRK13235          2 RKVAIYGKGGIGKSTTTQNTVA   23 (274)
T ss_pred             CEEEEeCCCCccHHHHHHHHHH
Confidence            6899999999999998776544


No 134
>TIGR02173 cyt_kin_arch cytidylate kinase, putative. Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by TIGR00017.
Probab=95.66  E-value=0.011  Score=43.00  Aligned_cols=21  Identities=19%  Similarity=0.202  Sum_probs=19.6

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|.|.|..|.||||+|+.+.+
T Consensus         2 iI~i~G~~GSGKstia~~la~   22 (171)
T TIGR02173         2 IITISGPPGSGKTTVAKILAE   22 (171)
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            689999999999999999976


No 135
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family. This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.
Probab=95.65  E-value=0.008  Score=43.71  Aligned_cols=20  Identities=10%  Similarity=0.243  Sum_probs=17.9

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |.++|..|.||||+|+.+..
T Consensus         1 i~l~G~~GsGKSTla~~l~~   20 (163)
T TIGR01313         1 FVLMGVAGSGKSTIASALAH   20 (163)
T ss_pred             CEEECCCCCCHHHHHHHHHH
Confidence            46899999999999999877


No 136
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]
Probab=95.62  E-value=0.022  Score=44.85  Aligned_cols=21  Identities=29%  Similarity=0.284  Sum_probs=18.0

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .|+|+|-||+||||+|..+..
T Consensus         2 kIaI~GKGG~GKTtiaalll~   22 (255)
T COG3640           2 KIAITGKGGVGKTTIAALLLK   22 (255)
T ss_pred             eEEEecCCCccHHHHHHHHHH
Confidence            589999999999999888444


No 137
>PRK05057 aroK shikimate kinase I; Reviewed
Probab=95.61  E-value=0.012  Score=43.69  Aligned_cols=23  Identities=9%  Similarity=0.190  Sum_probs=20.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...|.|+|+.|.|||||++.+..
T Consensus         4 ~~~I~liG~~GaGKStl~~~La~   26 (172)
T PRK05057          4 KRNIFLVGPMGAGKSTIGRQLAQ   26 (172)
T ss_pred             CCEEEEECCCCcCHHHHHHHHHH
Confidence            34689999999999999999987


No 138
>PRK08903 DnaA regulatory inactivator Hda; Validated
Probab=95.61  E-value=0.018  Score=44.20  Aligned_cols=26  Identities=4%  Similarity=0.023  Sum_probs=22.1

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ...+.+-++|..|+|||+||+.+++.
T Consensus        40 ~~~~~~~l~G~~G~GKT~La~ai~~~   65 (227)
T PRK08903         40 VADRFFYLWGEAGSGRSHLLQALVAD   65 (227)
T ss_pred             CCCCeEEEECCCCCCHHHHHHHHHHH
Confidence            34467889999999999999999884


No 139
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=95.60  E-value=0.012  Score=40.17  Aligned_cols=21  Identities=19%  Similarity=0.256  Sum_probs=19.4

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.|+|+.|+|||||...+.+.
T Consensus         2 V~iiG~~~~GKSTlin~l~~~   22 (116)
T PF01926_consen    2 VAIIGRPNVGKSTLINALTGK   22 (116)
T ss_dssp             EEEEESTTSSHHHHHHHHHTS
T ss_pred             EEEECCCCCCHHHHHHHHhcc
Confidence            689999999999999999974


No 140
>PRK13231 nitrogenase reductase-like protein; Reviewed
Probab=95.57  E-value=0.013  Score=46.19  Aligned_cols=24  Identities=17%  Similarity=0.264  Sum_probs=20.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .++|+|.|-||+||||++.++...
T Consensus         2 ~~~iav~~KGGvGKTT~a~nLA~~   25 (264)
T PRK13231          2 MKKIAIYGKGGIGKSTTVSNMAAA   25 (264)
T ss_pred             ceEEEEECCCCCcHHHHHHHHhcc
Confidence            468999999999999999998773


No 141
>TIGR00041 DTMP_kinase thymidylate kinase. Function: phosphorylation of DTMP to form DTDP in both de novo and salvage pathways of DTTP synthesis. Catalytic activity: ATP + thymidine 5'-phosphate = ADP + thymidine 5'-diphosphate.
Probab=95.57  E-value=0.043  Score=40.92  Aligned_cols=23  Identities=17%  Similarity=-0.002  Sum_probs=20.7

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ..|.|.|..|+||||+++.+.+.
T Consensus         4 ~~IvieG~~GsGKsT~~~~L~~~   26 (195)
T TIGR00041         4 MFIVIEGIDGAGKTTQANLLKKL   26 (195)
T ss_pred             eEEEEECCCCCCHHHHHHHHHHH
Confidence            56899999999999999999873


No 142
>PF02374 ArsA_ATPase:  Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B ....
Probab=95.57  E-value=0.019  Score=46.63  Aligned_cols=23  Identities=17%  Similarity=0.133  Sum_probs=18.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .+++-+.|-||+||||+|....-
T Consensus         1 ~r~~~~~GKGGVGKTT~aaA~A~   23 (305)
T PF02374_consen    1 MRILFFGGKGGVGKTTVAAALAL   23 (305)
T ss_dssp             -SEEEEEESTTSSHHHHHHHHHH
T ss_pred             CeEEEEecCCCCCcHHHHHHHHH
Confidence            36788999999999999866543


No 143
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.
Probab=95.56  E-value=0.011  Score=38.17  Aligned_cols=21  Identities=24%  Similarity=0.336  Sum_probs=18.4

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ++.+.|.+|+||||++..+..
T Consensus         1 ~~~~~g~~G~Gktt~~~~l~~   21 (99)
T cd01983           1 VIVVTGKGGVGKTTLAANLAA   21 (99)
T ss_pred             CEEEECCCCCCHHHHHHHHHH
Confidence            467889999999999998877


No 144
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=95.55  E-value=0.016  Score=40.89  Aligned_cols=24  Identities=17%  Similarity=0.191  Sum_probs=21.0

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ..+|.++|..|+|||||...+...
T Consensus         3 ~~~i~~~G~~g~GKttl~~~l~~~   26 (168)
T cd04163           3 SGFVAIVGRPNVGKSTLLNALVGQ   26 (168)
T ss_pred             eeEEEEECCCCCCHHHHHHHHhCC
Confidence            467999999999999999998664


No 145
>PRK13233 nifH nitrogenase reductase; Reviewed
Probab=95.53  E-value=0.012  Score=46.50  Aligned_cols=22  Identities=23%  Similarity=0.262  Sum_probs=18.7

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ++|+|.|-||+||||++..+..
T Consensus         3 ~vIav~~KGGVGKTT~a~nLA~   24 (275)
T PRK13233          3 RKIAIYGKGGIGKSTTTQNTAA   24 (275)
T ss_pred             eEEEEEcCCCCcHHHHHHHHHH
Confidence            6889999999999998876544


No 146
>PF05621 TniB:  Bacterial TniB protein;  InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins. TniB is a probable ATP-binding protein [] which is involved in Tn5053 mercury resistance transposition [].
Probab=95.53  E-value=0.093  Score=42.69  Aligned_cols=58  Identities=10%  Similarity=0.071  Sum_probs=44.7

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhcccccc-----ccCceEEEEEcCCCCCHHHHHHHHHHHhC
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMK-----HYFDYLAWIPAPYHYDPDQILDIVAVILL   71 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~-----~~F~~~~wv~vs~~~~~~~l~~~il~~l~   71 (156)
                      ....-+-|||-.+.|||+++++...+--..     ..+ .++.|.+....+...+...|+.+++
T Consensus        59 ~Rmp~lLivG~snnGKT~Ii~rF~~~hp~~~d~~~~~~-PVv~vq~P~~p~~~~~Y~~IL~~lg  121 (302)
T PF05621_consen   59 HRMPNLLIVGDSNNGKTMIIERFRRLHPPQSDEDAERI-PVVYVQMPPEPDERRFYSAILEALG  121 (302)
T ss_pred             cCCCceEEecCCCCcHHHHHHHHHHHCCCCCCCCCccc-cEEEEecCCCCChHHHHHHHHHHhC
Confidence            445678899999999999999987531111     111 4677788899999999999999996


No 147
>PRK06761 hypothetical protein; Provisional
Probab=95.52  E-value=0.031  Score=45.07  Aligned_cols=23  Identities=13%  Similarity=0.127  Sum_probs=21.1

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .+|.|.|.+|.||||+++.+++.
T Consensus         4 ~lIvI~G~~GsGKTTla~~L~~~   26 (282)
T PRK06761          4 KLIIIEGLPGFGKSTTAKMLNDI   26 (282)
T ss_pred             cEEEEECCCCCCHHHHHHHHHHh
Confidence            57899999999999999999984


No 148
>smart00173 RAS Ras subfamily of RAS small GTPases. Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors  to protein kinase cascades
Probab=95.51  E-value=0.015  Score=41.69  Aligned_cols=22  Identities=27%  Similarity=0.362  Sum_probs=19.1

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -|.|+|-+|+|||||+..+.++
T Consensus         2 ki~v~G~~~~GKTsli~~~~~~   23 (164)
T smart00173        2 KLVVLGSGGVGKSALTIQFVQG   23 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHhC
Confidence            3789999999999999988764


No 149
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=95.51  E-value=0.016  Score=40.69  Aligned_cols=21  Identities=10%  Similarity=0.109  Sum_probs=19.3

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.|+|..|+|||||.+.+.+.
T Consensus         2 i~i~G~~~~GKssl~~~l~~~   22 (159)
T cd04159           2 ITLVGLQNSGKTTLVNVIAGG   22 (159)
T ss_pred             EEEEcCCCCCHHHHHHHHccC
Confidence            689999999999999999875


No 150
>TIGR00750 lao LAO/AO transport system ATPase. Mutations have also been found that do not phosphorylate the periplasmic binding proteins, yet still allow transport. The ATPase activity of this protein seems to be necessary, however.
Probab=95.50  E-value=0.019  Score=46.37  Aligned_cols=26  Identities=15%  Similarity=0.079  Sum_probs=22.6

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .....++.|.|.+|+|||||+..+..
T Consensus        31 ~~~~~~i~i~G~~G~GKttl~~~l~~   56 (300)
T TIGR00750        31 TGNAHRVGITGTPGAGKSTLLEALGM   56 (300)
T ss_pred             cCCceEEEEECCCCCCHHHHHHHHHH
Confidence            45678999999999999999988765


No 151
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]
Probab=95.49  E-value=0.022  Score=46.30  Aligned_cols=61  Identities=16%  Similarity=0.099  Sum_probs=37.9

Q ss_pred             HHHHHHhcCCCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHH
Q 035574            3 ELLDLLIEGPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQIL   63 (156)
Q Consensus         3 ~l~~~L~~~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~   63 (156)
                      +++..|.....+..+|+|.|.+|+||+||...+-....-+.+==.++=|.-|.+++--.++
T Consensus        39 ~ll~~l~p~tG~a~viGITG~PGaGKSTli~~L~~~l~~~G~rVaVlAVDPSSp~TGGsiL   99 (323)
T COG1703          39 ELLRALYPRTGNAHVIGITGVPGAGKSTLIEALGRELRERGHRVAVLAVDPSSPFTGGSIL   99 (323)
T ss_pred             HHHHHHhhcCCCCcEEEecCCCCCchHHHHHHHHHHHHHCCcEEEEEEECCCCCCCCcccc
Confidence            4455555556677899999999999999988775522212221123334446666655544


No 152
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]
Probab=95.49  E-value=0.011  Score=44.30  Aligned_cols=20  Identities=25%  Similarity=0.288  Sum_probs=17.9

Q ss_pred             EEEEEcCCCccHHHHHHHHh
Q 035574           17 VVAILDSIGLDKTAFTAEAY   36 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy   36 (156)
                      .|.|.|.+|+||||+++.+-
T Consensus         2 ~I~ITGTPGvGKTT~~~~L~   21 (180)
T COG1936           2 LIAITGTPGVGKTTVCKLLR   21 (180)
T ss_pred             eEEEeCCCCCchHHHHHHHH
Confidence            47899999999999999875


No 153
>cd01858 NGP_1 NGP-1.  Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.
Probab=95.48  E-value=0.023  Score=41.18  Aligned_cols=25  Identities=8%  Similarity=0.070  Sum_probs=21.0

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      ...+.++|++|+|||||...+..+.
T Consensus       102 ~~~v~~~G~~nvGKStliN~l~~~~  126 (157)
T cd01858         102 QISVGFIGYPNVGKSSIINTLRSKK  126 (157)
T ss_pred             ceEEEEEeCCCCChHHHHHHHhcCC
Confidence            3457799999999999999998754


No 154
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents archaeal proteins with this activity.
Probab=95.48  E-value=0.012  Score=46.13  Aligned_cols=20  Identities=20%  Similarity=0.370  Sum_probs=18.3

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |.++|.+|+||||+|+.+..
T Consensus         2 Ivl~G~pGSGKST~a~~La~   21 (249)
T TIGR03574         2 IILTGLPGVGKSTFSKELAK   21 (249)
T ss_pred             EEEEcCCCCCHHHHHHHHHH
Confidence            67899999999999999876


No 155
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=95.47  E-value=0.057  Score=45.07  Aligned_cols=52  Identities=19%  Similarity=0.135  Sum_probs=42.0

Q ss_pred             EEEEcCCCccHHHHHHHHhccccccccCc-e-EEEEEcCCCCCHHHHHHHHHHHhC
Q 035574           18 VAILDSIGLDKTAFTAEAYNSSYMKHYFD-Y-LAWIPAPYHYDPDQILDIVAVILL   71 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~~v~~~F~-~-~~wv~vs~~~~~~~l~~~il~~l~   71 (156)
                      +-|+|..|.|||+.++.+.+  ++..... . .++|..-......+++..|++++.
T Consensus        45 ~~iyG~~GTGKT~~~~~v~~--~l~~~~~~~~~~yINc~~~~t~~~i~~~i~~~~~   98 (366)
T COG1474          45 IIIYGPTGTGKTATVKFVME--ELEESSANVEVVYINCLELRTPYQVLSKILNKLG   98 (366)
T ss_pred             EEEECCCCCCHhHHHHHHHH--HHHhhhccCceEEEeeeeCCCHHHHHHHHHHHcC
Confidence            88899999999999999998  4443321 1 688888888888999999999874


No 156
>PF08423 Rad51:  Rad51;  InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51. It is critical for DNA binding []. Rad51 is a homologue of the bacterial RecA protein. Rad51 and RecA share a core ATPase domain.; PDB: 2ZUC_A 2Z43_C 2ZUD_B 2DFL_A 2ZUB_A 2BKE_A 2KZ3_A 2CVH_B 2CVF_B 1SZP_D ....
Probab=95.47  E-value=0.046  Score=43.32  Aligned_cols=57  Identities=14%  Similarity=0.206  Sum_probs=40.0

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhcccccccc---C-ceEEEEEcCCCCCHHHHHHHHHHHh
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMKHY---F-DYLAWIPAPYHYDPDQILDIVAVIL   70 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~---F-~~~~wv~vs~~~~~~~l~~~il~~l   70 (156)
                      ..-.++-|+|.+|+|||.|+.+++-+..+...   . ...+|++-...|+.+.+. +|++..
T Consensus        36 ~~g~itEi~G~~gsGKTql~l~l~~~~~l~~~~~g~~~~vvyidTe~~f~~~Rl~-~i~~~~   96 (256)
T PF08423_consen   36 PTGSITEIVGESGSGKTQLCLQLAVNVQLPEEIGGLGGKVVYIDTEGTFSPERLQ-QIAERF   96 (256)
T ss_dssp             ETTSEEEEEESTTSSHHHHHHHHHHHTTSGGCTTSSSSEEEEEESSSSS-HHHHH-HHHHHT
T ss_pred             CCCcEEEEEEecccccchHHHHHHHHhhcccccccCCCceEEEeCCCCCCHHHHH-HHhhcc
Confidence            34568899999999999999887653333322   1 248999988889988765 455543


No 157
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=95.46  E-value=0.015  Score=40.42  Aligned_cols=23  Identities=9%  Similarity=0.203  Sum_probs=20.3

Q ss_pred             EEEEEcCCCccHHHHHHHHhccc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      -|.++|..|+|||||+..+....
T Consensus         3 ki~~~G~~~~GKstl~~~l~~~~   25 (161)
T TIGR00231         3 KIVIVGDPNVGKSTLLNRLLGNK   25 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            47899999999999999987765


No 158
>PRK13695 putative NTPase; Provisional
Probab=95.46  E-value=0.017  Score=42.56  Aligned_cols=21  Identities=19%  Similarity=0.268  Sum_probs=19.0

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      +.|.|.+|+|||||++.+++.
T Consensus         3 i~ltG~~G~GKTTll~~i~~~   23 (174)
T PRK13695          3 IGITGPPGVGKTTLVLKIAEL   23 (174)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            688999999999999998874


No 159
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes. In E. coli, the synthesis of Moco involves genes from several loci: moa, mob, mod, moe and mog. The mob locus contains mobA and mobB genes. MobB catalyzes the attachment of the guanine dinucleotide to molybdopterin.
Probab=95.46  E-value=0.016  Score=42.83  Aligned_cols=22  Identities=18%  Similarity=0.249  Sum_probs=20.6

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .++.|+|..|+|||||+..+..
T Consensus         2 ~vi~i~G~~gsGKTTli~~L~~   23 (159)
T cd03116           2 KVIGFVGYSGSGKTTLLEKLIP   23 (159)
T ss_pred             eEEEEECCCCCCHHHHHHHHHH
Confidence            6899999999999999999887


No 160
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=95.45  E-value=0.016  Score=41.06  Aligned_cols=21  Identities=19%  Similarity=0.385  Sum_probs=18.6

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.++|.+|+|||||+..+.++
T Consensus         4 i~iiG~~~vGKTsl~~~~~~~   24 (162)
T cd04138           4 LVVVGAGGVGKSALTIQLIQN   24 (162)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            688999999999999988764


No 161
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism]
Probab=95.44  E-value=0.016  Score=43.43  Aligned_cols=23  Identities=30%  Similarity=0.258  Sum_probs=20.0

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..++.|+|.+|+||||+.+.+-.
T Consensus         4 ~kvvvitGVpGvGKTTVl~~~~~   26 (189)
T COG2019           4 RKVVVITGVPGVGKTTVLKIALK   26 (189)
T ss_pred             ceEEEEEcCCCCChHHHHHHHHH
Confidence            68999999999999998877655


No 162
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=95.44  E-value=0.015  Score=40.76  Aligned_cols=34  Identities=18%  Similarity=0.069  Sum_probs=25.3

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEE
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWI   51 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv   51 (156)
                      -.++.|+|..|.|||||.+.+...  ... ....+++
T Consensus        11 g~~~~i~G~nGsGKStLl~~l~g~--~~~-~~G~i~~   44 (137)
T PF00005_consen   11 GEIVAIVGPNGSGKSTLLKALAGL--LPP-DSGSILI   44 (137)
T ss_dssp             TSEEEEEESTTSSHHHHHHHHTTS--SHE-SEEEEEE
T ss_pred             CCEEEEEccCCCccccceeeeccc--ccc-ccccccc
Confidence            357899999999999999999883  222 3445554


No 163
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1. This model describes DMC1, a subfamily of a larger family of DNA repair and recombination proteins. It is eukaryotic only and most closely related to eukaryotic RAD51. It also resembles archaeal RadA (TIGR02236) and RadB (TIGR02237) and bacterial RecA (TIGR02012). It has been characterized for human as a recombinase active only in meiosis.
Probab=95.43  E-value=0.049  Score=44.52  Aligned_cols=57  Identities=16%  Similarity=0.246  Sum_probs=39.6

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhccccccc---c-CceEEEEEcCCCCCHHHHHHHHHHHh
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMKH---Y-FDYLAWIPAPYHYDPDQILDIVAVIL   70 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~---~-F~~~~wv~vs~~~~~~~l~~~il~~l   70 (156)
                      ..-+++-|+|.+|+|||+|+.+++-......   . =...+||+....|+++++.+ +++.+
T Consensus        94 ~~G~iteI~G~~GsGKTql~lqla~~~~~~~~~gg~~~~vvYIdtE~~f~~eRi~~-~a~~~  154 (313)
T TIGR02238        94 ESMSITEVFGEFRCGKTQLSHTLCVTAQLPREMGGGNGKVAYIDTEGTFRPDRIRA-IAERF  154 (313)
T ss_pred             cCCeEEEEECCCCCCcCHHHHHHHHHHhcchhhcCCCCeEEEEEcCCCCCHHHHHH-HHHHc
Confidence            4457888999999999999988654222221   1 13588999888888887654 34444


No 164
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=95.39  E-value=0.016  Score=40.61  Aligned_cols=22  Identities=14%  Similarity=0.336  Sum_probs=19.4

Q ss_pred             EEEEcCCCccHHHHHHHHhccc
Q 035574           18 VAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      |.++|.+|+|||||...+.+..
T Consensus         3 i~~~G~~~~GKStl~~~l~~~~   24 (159)
T cd00154           3 IVLIGDSGVGKTSLLLRFVDGK   24 (159)
T ss_pred             EEEECCCCCCHHHHHHHHHhCc
Confidence            6789999999999999987753


No 165
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=95.38  E-value=0.014  Score=43.94  Aligned_cols=22  Identities=18%  Similarity=0.267  Sum_probs=19.5

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .|-|.|.+|.||||+|+.+.+.
T Consensus         2 riiilG~pGaGK~T~A~~La~~   23 (178)
T COG0563           2 RILILGPPGAGKSTLAKKLAKK   23 (178)
T ss_pred             eEEEECCCCCCHHHHHHHHHHH
Confidence            3678999999999999999884


No 166
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=95.38  E-value=0.018  Score=40.74  Aligned_cols=21  Identities=29%  Similarity=0.400  Sum_probs=18.6

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.|+|..|+|||||...+.+.
T Consensus         2 i~i~G~~~~GKTsli~~l~~~   22 (160)
T cd00876           2 VVVLGAGGVGKSAITIQFVKG   22 (160)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            689999999999999988653


No 167
>PF07693 KAP_NTPase:  KAP family P-loop domain;  InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side [].
Probab=95.38  E-value=0.083  Score=42.45  Aligned_cols=66  Identities=15%  Similarity=0.123  Sum_probs=40.3

Q ss_pred             HHHHHhcCC-CCcEEEEEEcCCCccHHHHHHHHhcccccccc----C---ceEEEEEcCCCCCHHHHHHHHHHHhC
Q 035574            4 LLDLLIEGP-TQLSVVAILDSIGLDKTAFTAEAYNSSYMKHY----F---DYLAWIPAPYHYDPDQILDIVAVILL   71 (156)
Q Consensus         4 l~~~L~~~~-~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~----F---~~~~wv~vs~~~~~~~l~~~il~~l~   71 (156)
                      +.+.|.+.+ ....+|+|.|.=|.||||+.+.+.+  +.+..    +   ..-+|-.-....-...++..+..++.
T Consensus         8 la~~I~~~~~~~~~~IgL~G~WGsGKSs~l~~l~~--~L~~~~~~~~~~i~fn~w~~~~~~~~~~~~~~~l~~~l~   81 (325)
T PF07693_consen    8 LAEIIKNPDSDDPFVIGLYGEWGSGKSSFLNMLKE--ELKEDNKEKYIFIYFNAWEYDGEDDLWASFLEELFDQLE   81 (325)
T ss_pred             HHHHHhccCCCCCeEEEEECCCCCCHHHHHHHHHH--HHhcccccceeeEEEccccCCCcchHHHHHHHHHHHHHH
Confidence            444444433 6788999999999999999999887  33333    1   11333332322234455566666553


No 168
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional
Probab=95.35  E-value=0.027  Score=46.81  Aligned_cols=24  Identities=17%  Similarity=0.092  Sum_probs=21.6

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..-+|+|+|..|.|||||+..+..
T Consensus         4 ~~~~i~i~G~~gsGKTTl~~~l~~   27 (369)
T PRK14490          4 HPFEIAFCGYSGSGKTTLITALVR   27 (369)
T ss_pred             CCEEEEEEeCCCCCHHHHHHHHHH
Confidence            356899999999999999999887


No 169
>PRK03731 aroL shikimate kinase II; Reviewed
Probab=95.35  E-value=0.014  Score=42.80  Aligned_cols=22  Identities=14%  Similarity=0.129  Sum_probs=19.6

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..|.|+|+.|.||||+++.+.+
T Consensus         3 ~~i~~~G~~GsGKst~~~~la~   24 (171)
T PRK03731          3 QPLFLVGARGCGKTTVGMALAQ   24 (171)
T ss_pred             CeEEEECCCCCCHHHHHHHHHH
Confidence            3578899999999999999987


No 170
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=95.35  E-value=0.016  Score=41.71  Aligned_cols=21  Identities=33%  Similarity=0.447  Sum_probs=18.8

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.|+|.+|+|||||+..+.++
T Consensus         3 i~viG~~~~GKSsl~~~l~~~   23 (172)
T cd01862           3 VIILGDSGVGKTSLMNQYVNK   23 (172)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            789999999999999988764


No 171
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family. Members of this family contain a single copy of the KaiC domain (pfam06745) that occurs in two copies of the circadian clock protein kinase KaiC itself. Members occur primarily in thermophilic archaea and in Thermotoga.
Probab=95.33  E-value=0.091  Score=40.87  Aligned_cols=53  Identities=17%  Similarity=0.159  Sum_probs=36.1

Q ss_pred             CCCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHHHH
Q 035574           11 GPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDIVA   67 (156)
Q Consensus        11 ~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~il   67 (156)
                      +-..-+++-|.|.+|.|||+||.++... ..+ .=+..+|++..+  +..++.+.+.
T Consensus        17 G~~~gs~~lI~G~pGsGKT~la~~~l~~-~~~-~ge~~lyvs~ee--~~~~i~~~~~   69 (237)
T TIGR03877        17 GIPERNVVLLSGGPGTGKSIFSQQFLWN-GLQ-MGEPGIYVALEE--HPVQVRRNMA   69 (237)
T ss_pred             CCcCCeEEEEEcCCCCCHHHHHHHHHHH-HHH-cCCcEEEEEeeC--CHHHHHHHHH
Confidence            4455688999999999999999886442 122 234577877654  5556666543


No 172
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional
Probab=95.33  E-value=0.061  Score=44.56  Aligned_cols=57  Identities=14%  Similarity=0.197  Sum_probs=39.8

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhcccccccc----CceEEEEEcCCCCCHHHHHHHHHHHh
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMKHY----FDYLAWIPAPYHYDPDQILDIVAVIL   70 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~----F~~~~wv~vs~~~~~~~l~~~il~~l   70 (156)
                      ..-.++=|+|.+|+|||+|+.+++-.......    -...+||+-...|+++++.+ +++.+
T Consensus       124 ~~G~ItEI~G~~GsGKTql~lqlav~~qlp~~~gg~~~~vvyIdTE~tF~peRl~~-ia~~~  184 (344)
T PLN03187        124 ETRCITEAFGEFRSGKTQLAHTLCVTTQLPTEMGGGNGKVAYIDTEGTFRPDRIVP-IAERF  184 (344)
T ss_pred             CCCeEEEEecCCCCChhHHHHHHHHHHhcchhhCCCCceEEEEEcCCCCCHHHHHH-HHHHc
Confidence            44567779999999999999887542222211    13589999888889888654 34444


No 173
>PRK05973 replicative DNA helicase; Provisional
Probab=95.30  E-value=0.076  Score=41.76  Aligned_cols=53  Identities=17%  Similarity=0.088  Sum_probs=33.2

Q ss_pred             CCCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHHHH
Q 035574           11 GPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDIVA   67 (156)
Q Consensus        11 ~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~il   67 (156)
                      +-..-.++-|.|.+|+|||+++.++..+- .+.. ...++++..+  +..++...+.
T Consensus        60 Gl~~Gsl~LIaG~PG~GKT~lalqfa~~~-a~~G-e~vlyfSlEe--s~~~i~~R~~  112 (237)
T PRK05973         60 QLKPGDLVLLGARPGHGKTLLGLELAVEA-MKSG-RTGVFFTLEY--TEQDVRDRLR  112 (237)
T ss_pred             CCCCCCEEEEEeCCCCCHHHHHHHHHHHH-HhcC-CeEEEEEEeC--CHHHHHHHHH
Confidence            33455788899999999999999875522 1222 2355555443  3555655543


No 174
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=95.30  E-value=0.015  Score=43.19  Aligned_cols=20  Identities=15%  Similarity=0.164  Sum_probs=18.5

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |-|.|++|+||||+|+.+..
T Consensus         2 I~i~G~pGsGKst~a~~La~   21 (194)
T cd01428           2 ILLLGPPGSGKGTQAERLAK   21 (194)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            67899999999999999977


No 175
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=95.28  E-value=0.18  Score=40.32  Aligned_cols=24  Identities=13%  Similarity=0.077  Sum_probs=20.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ...+-++|..|+||||+++.+.+.
T Consensus        38 ~~~~ll~G~~G~GKt~~~~~l~~~   61 (319)
T PRK00440         38 MPHLLFAGPPGTGKTTAALALARE   61 (319)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHHH
Confidence            345789999999999999999873


No 176
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]
Probab=95.28  E-value=0.015  Score=43.13  Aligned_cols=23  Identities=13%  Similarity=0.226  Sum_probs=20.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..+++|+|..++|||||...+..
T Consensus         2 ~~Il~ivG~k~SGKTTLie~lv~   24 (161)
T COG1763           2 MKILGIVGYKNSGKTTLIEKLVR   24 (161)
T ss_pred             CcEEEEEecCCCChhhHHHHHHH
Confidence            47899999999999999999866


No 177
>PRK08356 hypothetical protein; Provisional
Probab=95.28  E-value=0.022  Score=42.98  Aligned_cols=21  Identities=19%  Similarity=0.199  Sum_probs=19.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHH
Q 035574           15 LSVVAILDSIGLDKTAFTAEA   35 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~v   35 (156)
                      ..+|.|+|++|+||||+|+.+
T Consensus         5 ~~~i~~~G~~gsGK~t~a~~l   25 (195)
T PRK08356          5 KMIVGVVGKIAAGKTTVAKFF   25 (195)
T ss_pred             cEEEEEECCCCCCHHHHHHHH
Confidence            357899999999999999999


No 178
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=95.27  E-value=0.16  Score=44.69  Aligned_cols=36  Identities=25%  Similarity=0.268  Sum_probs=27.6

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEE
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIP   52 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~   52 (156)
                      ..+..+-+.|.+|+|||+||..+..    .+.|+.+--++
T Consensus       536 s~lvSvLl~Gp~~sGKTaLAA~iA~----~S~FPFvKiiS  571 (744)
T KOG0741|consen  536 SPLVSVLLEGPPGSGKTALAAKIAL----SSDFPFVKIIS  571 (744)
T ss_pred             CcceEEEEecCCCCChHHHHHHHHh----hcCCCeEEEeC
Confidence            4456667789999999999999955    46788765554


No 179
>cd04113 Rab4 Rab4 subfamily.  Rab4 has been implicated in numerous functions within the cell.  It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A.  Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane.  It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p
Probab=95.27  E-value=0.018  Score=41.24  Aligned_cols=22  Identities=18%  Similarity=0.244  Sum_probs=19.2

Q ss_pred             EEEEcCCCccHHHHHHHHhccc
Q 035574           18 VAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      +.|+|.+|+|||||+..+.+..
T Consensus         3 i~v~G~~~vGKTsli~~l~~~~   24 (161)
T cd04113           3 FIIIGSSGTGKSCLLHRFVENK   24 (161)
T ss_pred             EEEECCCCCCHHHHHHHHHhCC
Confidence            6799999999999999987643


No 180
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]
Probab=95.26  E-value=0.025  Score=47.69  Aligned_cols=22  Identities=32%  Similarity=0.462  Sum_probs=18.2

Q ss_pred             CcEEEEEEcCCCccHHH-HHHHH
Q 035574           14 QLSVVAILDSIGLDKTA-FTAEA   35 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTt-La~~v   35 (156)
                      .-+++.++|..|||||| ||+..
T Consensus       202 ~~~vi~LVGPTGVGKTTTlAKLA  224 (407)
T COG1419         202 QKRVIALVGPTGVGKTTTLAKLA  224 (407)
T ss_pred             cCcEEEEECCCCCcHHHHHHHHH
Confidence            37899999999999998 55543


No 181
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=95.25  E-value=0.017  Score=43.09  Aligned_cols=22  Identities=9%  Similarity=0.111  Sum_probs=20.4

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .++.|+|..|.|||||++.+..
T Consensus         4 e~i~l~G~sGsGKSTl~~~la~   25 (176)
T PRK09825          4 ESYILMGVSGSGKSLIGSKIAA   25 (176)
T ss_pred             cEEEEECCCCCCHHHHHHHHHH
Confidence            4789999999999999999987


No 182
>PRK00698 tmk thymidylate kinase; Validated
Probab=95.25  E-value=0.019  Score=43.07  Aligned_cols=22  Identities=14%  Similarity=0.010  Sum_probs=20.5

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..|.|.|..|+||||+++.+.+
T Consensus         4 ~~I~ieG~~gsGKsT~~~~L~~   25 (205)
T PRK00698          4 MFITIEGIDGAGKSTQIELLKE   25 (205)
T ss_pred             eEEEEECCCCCCHHHHHHHHHH
Confidence            6899999999999999999977


No 183
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein. The BchL peptide (ChlL in chloroplast and cyanobacteria) is an ATP-binding iron-sulfur protein of the dark form protochlorophyllide reductase, an enzyme similar to nitrogenase. This subunit resembles the nitrogenase NifH subunit.
Probab=95.25  E-value=0.017  Score=45.50  Aligned_cols=21  Identities=14%  Similarity=0.270  Sum_probs=16.8

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|++.|-||+||||++..+..
T Consensus         2 ~i~~~gKGGVGKTT~~~nLA~   22 (268)
T TIGR01281         2 ILAVYGKGGIGKSTTSSNLSV   22 (268)
T ss_pred             EEEEEcCCcCcHHHHHHHHHH
Confidence            478889999999997766543


No 184
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=95.24  E-value=0.019  Score=40.98  Aligned_cols=22  Identities=9%  Similarity=0.330  Sum_probs=19.4

Q ss_pred             EEEEcCCCccHHHHHHHHhccc
Q 035574           18 VAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      |.++|.+|+|||||+..+.+..
T Consensus         3 v~v~G~~~~GKTtli~~l~~~~   24 (164)
T smart00175        3 IILIGDSGVGKSSLLSRFTDGK   24 (164)
T ss_pred             EEEECCCCCCHHHHHHHHhcCC
Confidence            6899999999999999997643


No 185
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]
Probab=95.23  E-value=0.014  Score=43.51  Aligned_cols=21  Identities=29%  Similarity=0.264  Sum_probs=19.8

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|+|-|.+|.||||+|+.+.+
T Consensus         2 ~ItIsG~pGsG~TTva~~lAe   22 (179)
T COG1102           2 VITISGLPGSGKTTVARELAE   22 (179)
T ss_pred             EEEeccCCCCChhHHHHHHHH
Confidence            689999999999999999988


No 186
>TIGR02881 spore_V_K stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.
Probab=95.21  E-value=0.02  Score=45.19  Aligned_cols=24  Identities=17%  Similarity=0.047  Sum_probs=20.2

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...-+-++|.+|+||||+|+.++.
T Consensus        41 ~~~~vll~GppGtGKTtlA~~ia~   64 (261)
T TIGR02881        41 QVLHMIFKGNPGTGKTTVARILGK   64 (261)
T ss_pred             CcceEEEEcCCCCCHHHHHHHHHH
Confidence            345567899999999999999866


No 187
>PRK14737 gmk guanylate kinase; Provisional
Probab=95.21  E-value=0.023  Score=42.83  Aligned_cols=24  Identities=13%  Similarity=0.102  Sum_probs=21.9

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +..+|.|+|..|+|||||++.+..
T Consensus         3 ~~~~ivl~GpsG~GK~tl~~~l~~   26 (186)
T PRK14737          3 SPKLFIISSVAGGGKSTIIQALLE   26 (186)
T ss_pred             CCeEEEEECCCCCCHHHHHHHHHh
Confidence            457899999999999999999987


No 188
>cd04177 RSR1 RSR1 subgroup.  RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi.  In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization.  The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site.  It is believed that cdc42 interacts directly with RSR1 in vivo.  In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha.  In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key featu
Probab=95.20  E-value=0.021  Score=41.36  Aligned_cols=22  Identities=23%  Similarity=0.397  Sum_probs=19.2

Q ss_pred             EEEEcCCCccHHHHHHHHhccc
Q 035574           18 VAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      |.++|.+|+|||||++.+.++.
T Consensus         4 i~liG~~~~GKTsli~~~~~~~   25 (168)
T cd04177           4 IVVLGAGGVGKSALTVQFVQNV   25 (168)
T ss_pred             EEEECCCCCCHHHHHHHHHhCC
Confidence            7899999999999999876544


No 189
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=95.18  E-value=0.021  Score=45.80  Aligned_cols=24  Identities=29%  Similarity=0.325  Sum_probs=21.2

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..+++.++|..|+||||++..+..
T Consensus       193 ~~~vi~~vGptGvGKTTt~~kLa~  216 (282)
T TIGR03499       193 QGGVIALVGPTGVGKTTTLAKLAA  216 (282)
T ss_pred             CCeEEEEECCCCCCHHHHHHHHHH
Confidence            457999999999999999988876


No 190
>PRK13768 GTPase; Provisional
Probab=95.18  E-value=0.02  Score=45.16  Aligned_cols=23  Identities=26%  Similarity=0.364  Sum_probs=19.2

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..++.|.|.+|+||||++..+..
T Consensus         2 ~~~i~v~G~~G~GKTt~~~~~~~   24 (253)
T PRK13768          2 MYIVFFLGTAGSGKTTLTKALSD   24 (253)
T ss_pred             cEEEEEECCCCccHHHHHHHHHH
Confidence            35788999999999998877654


No 191
>PF03266 NTPase_1:  NTPase;  InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []. It includes proteins from bacteria to human, and the function was determined first in a hyperthermophilic bacterium to be an NTPase []. The structure of one member-sequence represents a variation of the RecA fold, and implies that the function might be that of a DNA/RNA modifying enzyme []. The sequence carries both a Walker A and Walker B motif which together are characteristic of ATPases or GTPases. The protein exhibits an increased expression profile in human liver cholangiocarcinoma when compared to normal tissue [].; GO: 0005524 ATP binding, 0016740 transferase activity, 0019204 nucleotide phosphatase activity; PDB: 1YE8_A 2I3B_A.
Probab=95.18  E-value=0.017  Score=42.94  Aligned_cols=21  Identities=19%  Similarity=0.290  Sum_probs=17.6

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |-|.|.+|+|||||++.+.+.
T Consensus         2 i~iTG~pG~GKTTll~k~i~~   22 (168)
T PF03266_consen    2 IFITGPPGVGKTTLLKKVIEE   22 (168)
T ss_dssp             EEEES-TTSSHHHHHHHHHHH
T ss_pred             EEEECcCCCCHHHHHHHHHHH
Confidence            568899999999999998873


No 192
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional
Probab=95.18  E-value=0.02  Score=45.13  Aligned_cols=22  Identities=18%  Similarity=0.259  Sum_probs=18.4

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ++|+|.|-||+||||++..+..
T Consensus         3 ~iIav~~KGGVGKTT~~~nLA~   24 (270)
T PRK13185          3 LVLAVYGKGGIGKSTTSSNLSA   24 (270)
T ss_pred             eEEEEECCCCCCHHHHHHHHHH
Confidence            6888999999999997776544


No 193
>cd00983 recA RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange.
Probab=95.18  E-value=0.046  Score=44.93  Aligned_cols=46  Identities=20%  Similarity=0.195  Sum_probs=30.8

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCH
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDP   59 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~   59 (156)
                      -+.-+++-|+|.+|+||||||.+++..  ....-...+|+...+.++.
T Consensus        52 lp~G~iteI~Gp~GsGKTtLal~~~~~--~~~~g~~~vyId~E~~~~~   97 (325)
T cd00983          52 YPKGRIIEIYGPESSGKTTLALHAIAE--AQKLGGTVAFIDAEHALDP   97 (325)
T ss_pred             ccCCeEEEEECCCCCCHHHHHHHHHHH--HHHcCCCEEEECccccHHH
Confidence            345678889999999999999987652  2222234666665444443


No 194
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=95.17  E-value=0.019  Score=40.93  Aligned_cols=22  Identities=23%  Similarity=0.137  Sum_probs=19.6

Q ss_pred             EEEEcCCCccHHHHHHHHhccc
Q 035574           18 VAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      |.++|.+|+|||||...+.+..
T Consensus         2 i~iiG~~~~GKssli~~~~~~~   23 (158)
T cd00878           2 ILILGLDGAGKTTILYKLKLGE   23 (158)
T ss_pred             EEEEcCCCCCHHHHHHHHhcCC
Confidence            6899999999999999997753


No 195
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism]
Probab=95.16  E-value=0.02  Score=43.87  Aligned_cols=23  Identities=13%  Similarity=0.268  Sum_probs=20.3

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..+|++.|+.|+||||.|+.+-+
T Consensus         2 ~~iIglTG~igsGKStva~~~~~   24 (201)
T COG0237           2 MLIIGLTGGIGSGKSTVAKILAE   24 (201)
T ss_pred             ceEEEEecCCCCCHHHHHHHHHH
Confidence            46899999999999999998754


No 196
>PRK14527 adenylate kinase; Provisional
Probab=95.16  E-value=0.021  Score=42.83  Aligned_cols=24  Identities=21%  Similarity=0.160  Sum_probs=21.1

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+|.|+|.+|.||||+|+.+.+
T Consensus         5 ~~~~i~i~G~pGsGKsT~a~~La~   28 (191)
T PRK14527          5 KNKVVIFLGPPGAGKGTQAERLAQ   28 (191)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHHH
Confidence            346899999999999999999875


No 197
>PF03029 ATP_bind_1:  Conserved hypothetical ATP binding protein;  InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity.; GO: 0000166 nucleotide binding; PDB: 1YR7_A 1YRA_B 1YR8_A 1YR6_A 1YR9_A 1YRB_A 2OXR_A.
Probab=95.15  E-value=0.021  Score=44.77  Aligned_cols=19  Identities=21%  Similarity=0.287  Sum_probs=16.5

Q ss_pred             EEcCCCccHHHHHHHHhcc
Q 035574           20 ILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        20 I~G~gGvGKTtLa~~vy~~   38 (156)
                      |+|++|+||||+++.+.+.
T Consensus         1 ViGpaGSGKTT~~~~~~~~   19 (238)
T PF03029_consen    1 VIGPAGSGKTTFCKGLSEW   19 (238)
T ss_dssp             -EESTTSSHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHH
Confidence            6899999999999998873


No 198
>PLN03186 DNA repair protein RAD51 homolog; Provisional
Probab=95.15  E-value=0.066  Score=44.33  Aligned_cols=57  Identities=12%  Similarity=0.115  Sum_probs=40.0

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhcccccccc---C-ceEEEEEcCCCCCHHHHHHHHHHHh
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMKHY---F-DYLAWIPAPYHYDPDQILDIVAVIL   70 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~---F-~~~~wv~vs~~~~~~~l~~~il~~l   70 (156)
                      ....++-|.|.+|+|||+|+..++-.......   - ...+|+.....|+.+++. ++++.+
T Consensus       121 ~~g~i~~i~G~~g~GKT~l~~~l~~~~~~~~~~gg~~g~vlyIdtE~~f~~eRl~-qia~~~  181 (342)
T PLN03186        121 ETGSITEIYGEFRTGKTQLCHTLCVTCQLPLDQGGGEGKAMYIDTEGTFRPQRLI-QIAERF  181 (342)
T ss_pred             cCceEEEEECCCCCCccHHHHHHHHHhhcchhhCCCCceEEEEECCCCccHHHHH-HHHHHc
Confidence            45678889999999999999887643222211   1 258999999888888764 444444


No 199
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]
Probab=95.15  E-value=0.017  Score=46.74  Aligned_cols=32  Identities=22%  Similarity=0.210  Sum_probs=25.5

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhccccccccC
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYF   45 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F   45 (156)
                      ...+.=+-++|.+|+||||||.-+.+  ++..++
T Consensus        49 ~e~lDHvLl~GPPGlGKTTLA~IIA~--Emgvn~   80 (332)
T COG2255          49 GEALDHVLLFGPPGLGKTTLAHIIAN--ELGVNL   80 (332)
T ss_pred             CCCcCeEEeeCCCCCcHHHHHHHHHH--HhcCCe
Confidence            44566788999999999999999999  444443


No 200
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]
Probab=95.15  E-value=0.093  Score=42.29  Aligned_cols=50  Identities=14%  Similarity=0.106  Sum_probs=39.2

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHH
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQIL   63 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~   63 (156)
                      -+.-+++-|+|..|.||||+|-+++-.  .+..-...+|+.--+.+++..+.
T Consensus        57 l~~g~ItEiyG~~gsGKT~lal~~~~~--aq~~g~~a~fIDtE~~l~p~r~~  106 (279)
T COG0468          57 LPRGRITEIYGPESSGKTTLALQLVAN--AQKPGGKAAFIDTEHALDPERAK  106 (279)
T ss_pred             cccceEEEEecCCCcchhhHHHHHHHH--hhcCCCeEEEEeCCCCCCHHHHH
Confidence            355688999999999999999998763  33334478999988888887654


No 201
>PRK07003 DNA polymerase III subunits gamma and tau; Validated
Probab=95.14  E-value=0.15  Score=46.48  Aligned_cols=23  Identities=13%  Similarity=0.088  Sum_probs=18.3

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+-++|..|+||||+|+.+.+
T Consensus        38 ~HAyLFtGPpGvGKTTlAriLAK   60 (830)
T PRK07003         38 HHAYLFTGTRGVGKTTLSRIFAK   60 (830)
T ss_pred             CeEEEEECCCCCCHHHHHHHHHH
Confidence            34555999999999999886654


No 202
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs). This family consists of various deoxynucleoside kinases including deoxyribo- cytidine (EC 2.7.1.74), guanosine (EC 2.7.1.113), adenosine (EC 2.7.1.76), and thymidine (EC 2.7.1.21) kinases. They are key enzymes in the salvage of deoxyribonucleosides originating from extra- or intracellular breakdown of DNA.
Probab=95.14  E-value=0.016  Score=43.31  Aligned_cols=22  Identities=23%  Similarity=0.392  Sum_probs=19.6

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      +|.|.|+.|+||||+++.+.+.
T Consensus         1 ~I~ieG~~GsGKSTl~~~L~~~   22 (193)
T cd01673           1 VIVVEGNIGAGKSTLAKELAEH   22 (193)
T ss_pred             CEEEECCCCCCHHHHHHHHHHH
Confidence            4789999999999999999873


No 203
>cd04136 Rap_like Rap-like subfamily.  The Rap subfamily consists of the Rap1, Rap2, and RSR1.  Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.   Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines.  Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands.  In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres. 
Probab=95.14  E-value=0.023  Score=40.49  Aligned_cols=22  Identities=32%  Similarity=0.400  Sum_probs=18.6

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -|.|+|.+|+|||||+..+..+
T Consensus         3 ki~i~G~~~vGKTsl~~~~~~~   24 (163)
T cd04136           3 KVVVLGSGGVGKSALTVQFVQG   24 (163)
T ss_pred             EEEEECCCCCCHHHHHHHHHhC
Confidence            4789999999999998887653


No 204
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional
Probab=95.13  E-value=0.045  Score=44.30  Aligned_cols=26  Identities=23%  Similarity=0.280  Sum_probs=23.5

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..+..++.|.|.+|.|||||...+.+
T Consensus       101 ~~~~~~v~l~G~pGsGKTTLl~~l~~  126 (290)
T PRK10463        101 ARKQLVLNLVSSPGSGKTTLLTETLM  126 (290)
T ss_pred             hcCCeEEEEECCCCCCHHHHHHHHHH
Confidence            35689999999999999999999887


No 205
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional
Probab=95.12  E-value=0.018  Score=48.57  Aligned_cols=25  Identities=24%  Similarity=0.207  Sum_probs=22.3

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .-.+.|.|+|..|.|||||++.+..
T Consensus       217 ~~~~~IvI~G~~gsGKTTL~~~La~  241 (399)
T PRK08099        217 FFVRTVAILGGESSGKSTLVNKLAN  241 (399)
T ss_pred             CCCcEEEEEcCCCCCHHHHHHHHHH
Confidence            3468899999999999999999877


No 206
>TIGR02528 EutP ethanolamine utilization protein, EutP. This protein is found within operons which code for polyhedral organelles containing the enzyme ethanolamine ammonia lyase. The function of this gene is unknown, although the presence of an N-terminal GxxGxGK motif implies a GTP-binding site.
Probab=95.12  E-value=0.02  Score=40.18  Aligned_cols=23  Identities=22%  Similarity=0.339  Sum_probs=19.8

Q ss_pred             EEEEEcCCCccHHHHHHHHhccc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      -|.++|.+|+|||||...+.++.
T Consensus         2 kv~liG~~~vGKSsL~~~l~~~~   24 (142)
T TIGR02528         2 RIMFIGSVGCGKTTLTQALQGEE   24 (142)
T ss_pred             eEEEECCCCCCHHHHHHHHcCCc
Confidence            37899999999999999987653


No 207
>smart00072 GuKc Guanylate kinase homologues. Active enzymes catalyze ATP-dependent phosphorylation of GMP to GDP. Structure resembles that of adenylate kinase. So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions.
Probab=95.12  E-value=0.029  Score=41.90  Aligned_cols=24  Identities=17%  Similarity=0.214  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .+.+.++|..|+||+||+..+...
T Consensus         2 ~r~ivl~Gpsg~GK~tl~~~L~~~   25 (184)
T smart00072        2 RRPIVLSGPSGVGKGTLLAELIQE   25 (184)
T ss_pred             CcEEEEECCCCCCHHHHHHHHHhc
Confidence            467899999999999999999883


No 208
>PLN02200 adenylate kinase family protein
Probab=95.11  E-value=0.024  Score=44.35  Aligned_cols=24  Identities=13%  Similarity=0.073  Sum_probs=21.0

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+|.|.|++|+||||+|+.+..
T Consensus        42 ~~~ii~I~G~PGSGKsT~a~~La~   65 (234)
T PLN02200         42 TPFITFVLGGPGSGKGTQCEKIVE   65 (234)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHH
Confidence            346789999999999999998876


No 209
>cd02032 Bchl_like This family of proteins contains bchL and chlL. Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls. Three genes, bchL, bchN and bchB, are involved in light-independent protochlorophyllide reduction in bacteriochlorophyll biosynthesis. In cyanobacteria, algae, and gymnosperms, three similar genes, chlL, chlN and chlB are involved in protochlorophyllide reduction during chlorophylls biosynthesis. BchL/chlL, bchN/chlN and bchB/chlB exhibit significant sequence similarity to the nifH, nifD and nifK subunits of nitrogenase, respectively. Nitrogenase catalyzes the reductive formation of ammonia from dinitrogen.
Probab=95.11  E-value=0.02  Score=45.13  Aligned_cols=21  Identities=19%  Similarity=0.275  Sum_probs=17.2

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|+|.|-||+||||++..+..
T Consensus         2 ~i~v~gKGGvGKTT~a~nLA~   22 (267)
T cd02032           2 VLAVYGKGGIGKSTTSSNLSV   22 (267)
T ss_pred             EEEEecCCCCCHHHHHHHHHH
Confidence            588889999999997776544


No 210
>PRK08727 hypothetical protein; Validated
Probab=95.11  E-value=0.024  Score=44.14  Aligned_cols=39  Identities=13%  Similarity=0.087  Sum_probs=27.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCC
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPY   55 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~   55 (156)
                      ...+-++|..|+|||.|++.+++.  ...+.....|+++.+
T Consensus        41 ~~~l~l~G~~G~GKThL~~a~~~~--~~~~~~~~~y~~~~~   79 (233)
T PRK08727         41 SDWLYLSGPAGTGKTHLALALCAA--AEQAGRSSAYLPLQA   79 (233)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHHH--HHHcCCcEEEEeHHH
Confidence            356999999999999999999873  333333456666543


No 211
>PRK06620 hypothetical protein; Validated
Probab=95.11  E-value=0.02  Score=44.18  Aligned_cols=23  Identities=22%  Similarity=-0.025  Sum_probs=20.6

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      +.+-|||..|+|||+|++.+.+.
T Consensus        45 ~~l~l~Gp~G~GKThLl~a~~~~   67 (214)
T PRK06620         45 FTLLIKGPSSSGKTYLTKIWQNL   67 (214)
T ss_pred             ceEEEECCCCCCHHHHHHHHHhc
Confidence            66899999999999999998774


No 212
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=95.10  E-value=0.043  Score=40.48  Aligned_cols=24  Identities=13%  Similarity=0.011  Sum_probs=20.6

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ...|.|+|.+|+|||||+..+..+
T Consensus        19 ~~ki~ilG~~~~GKStLi~~l~~~   42 (190)
T cd00879          19 EAKILFLGLDNAGKTTLLHMLKDD   42 (190)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcC
Confidence            455699999999999999998763


No 213
>PRK09087 hypothetical protein; Validated
Probab=95.07  E-value=0.038  Score=42.93  Aligned_cols=24  Identities=21%  Similarity=0.231  Sum_probs=21.0

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -..+.|||..|+|||+|++..+.+
T Consensus        44 ~~~l~l~G~~GsGKThLl~~~~~~   67 (226)
T PRK09087         44 SPVVVLAGPVGSGKTHLASIWREK   67 (226)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHHh
Confidence            356899999999999999998863


No 214
>PRK14532 adenylate kinase; Provisional
Probab=95.07  E-value=0.019  Score=42.70  Aligned_cols=20  Identities=5%  Similarity=0.042  Sum_probs=18.2

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |-+.|++|+||||+|+.+..
T Consensus         3 i~~~G~pGsGKsT~a~~la~   22 (188)
T PRK14532          3 LILFGPPAAGKGTQAKRLVE   22 (188)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            67899999999999999976


No 215
>TIGR01242 26Sp45 26S proteasome subunit P45 family. Many proteins may score above the trusted cutoff because an internal
Probab=95.07  E-value=0.022  Score=47.13  Aligned_cols=23  Identities=17%  Similarity=0.127  Sum_probs=20.6

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .+-+-++|.+|+|||+||+.+++
T Consensus       156 p~gvLL~GppGtGKT~lakaia~  178 (364)
T TIGR01242       156 PKGVLLYGPPGTGKTLLAKAVAH  178 (364)
T ss_pred             CceEEEECCCCCCHHHHHHHHHH
Confidence            44578999999999999999988


No 216
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=95.07  E-value=0.031  Score=41.90  Aligned_cols=27  Identities=11%  Similarity=0.183  Sum_probs=22.9

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhccc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      .+...|.|+|.+|+|||||...+.++.
T Consensus        39 ~~~~~I~iiG~~g~GKStLl~~l~~~~   65 (204)
T cd01878          39 SGIPTVALVGYTNAGKSTLFNALTGAD   65 (204)
T ss_pred             cCCCeEEEECCCCCCHHHHHHHHhcch
Confidence            445788999999999999999888753


No 217
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=95.07  E-value=0.024  Score=42.41  Aligned_cols=23  Identities=17%  Similarity=0.135  Sum_probs=20.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -..+.|+|..|.|||||++.+..
T Consensus        25 g~~i~I~G~tGSGKTTll~aL~~   47 (186)
T cd01130          25 RKNILISGGTGSGKTTLLNALLA   47 (186)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHh
Confidence            46789999999999999998875


No 218
>PRK01184 hypothetical protein; Provisional
Probab=95.06  E-value=0.019  Score=42.61  Aligned_cols=19  Identities=16%  Similarity=0.351  Sum_probs=16.9

Q ss_pred             EEEEEEcCCCccHHHHHHH
Q 035574           16 SVVAILDSIGLDKTAFTAE   34 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~   34 (156)
                      .+|.++|.+|.||||+++.
T Consensus         2 ~~i~l~G~~GsGKsT~a~~   20 (184)
T PRK01184          2 KIIGVVGMPGSGKGEFSKI   20 (184)
T ss_pred             cEEEEECCCCCCHHHHHHH
Confidence            4789999999999999873


No 219
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=95.06  E-value=0.033  Score=44.96  Aligned_cols=22  Identities=18%  Similarity=0.080  Sum_probs=19.1

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..+-++|..|+||||+|+.+.+
T Consensus        37 ~~lll~Gp~GtGKT~la~~~~~   58 (337)
T PRK12402         37 PHLLVQGPPGSGKTAAVRALAR   58 (337)
T ss_pred             ceEEEECCCCCCHHHHHHHHHH
Confidence            3567999999999999998876


No 220
>PRK00771 signal recognition particle protein Srp54; Provisional
Probab=95.06  E-value=0.084  Score=45.10  Aligned_cols=24  Identities=17%  Similarity=0.173  Sum_probs=21.4

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...++-++|.+|+||||.+..+..
T Consensus        94 ~p~vI~lvG~~GsGKTTtaakLA~  117 (437)
T PRK00771         94 KPQTIMLVGLQGSGKTTTAAKLAR  117 (437)
T ss_pred             CCeEEEEECCCCCcHHHHHHHHHH
Confidence            468999999999999999988876


No 221
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]
Probab=95.04  E-value=0.021  Score=42.82  Aligned_cols=21  Identities=10%  Similarity=0.222  Sum_probs=18.9

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -|.++||.|.||||+.+.+..
T Consensus         4 ~IvLiG~mGaGKSTIGr~LAk   24 (172)
T COG0703           4 NIVLIGFMGAGKSTIGRALAK   24 (172)
T ss_pred             cEEEEcCCCCCHhHHHHHHHH
Confidence            477899999999999999976


No 222
>PHA02530 pseT polynucleotide kinase; Provisional
Probab=95.04  E-value=0.023  Score=45.42  Aligned_cols=22  Identities=14%  Similarity=0.231  Sum_probs=19.7

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .+|-+.|.+|+||||+|+.+..
T Consensus         3 ~liil~G~pGSGKSTla~~L~~   24 (300)
T PHA02530          3 KIILTVGVPGSGKSTWAREFAA   24 (300)
T ss_pred             EEEEEEcCCCCCHHHHHHHHHH
Confidence            5678899999999999999876


No 223
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=95.03  E-value=0.033  Score=50.40  Aligned_cols=30  Identities=17%  Similarity=0.259  Sum_probs=23.6

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhccccccccC
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNSSYMKHYF   45 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F   45 (156)
                      ....+-++|.+|+||||||+.+++  .....|
T Consensus        51 ~~~slLL~GPpGtGKTTLA~aIA~--~~~~~f   80 (725)
T PRK13341         51 RVGSLILYGPPGVGKTTLARIIAN--HTRAHF   80 (725)
T ss_pred             CCceEEEECCCCCCHHHHHHHHHH--HhcCcc
Confidence            344567899999999999999998  444444


No 224
>PLN02348 phosphoribulokinase
Probab=95.03  E-value=0.034  Score=46.83  Aligned_cols=26  Identities=15%  Similarity=0.226  Sum_probs=23.2

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .....+|+|.|-+|.||||+|+.+.+
T Consensus        46 ~~~p~IIGIaG~SGSGKSTfA~~L~~   71 (395)
T PLN02348         46 DDGTVVIGLAADSGCGKSTFMRRLTS   71 (395)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHH
Confidence            45678999999999999999999877


No 225
>cd04124 RabL2 RabL2 subfamily.  RabL2 (Rab-like2) subfamily.  RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share  98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=95.02  E-value=0.023  Score=41.02  Aligned_cols=21  Identities=10%  Similarity=0.208  Sum_probs=18.1

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.++|.+|+|||||+..+.++
T Consensus         3 i~vvG~~~vGKTsli~~~~~~   23 (161)
T cd04124           3 IILLGDSAVGKSKLVERFLMD   23 (161)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            678999999999999887653


No 226
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X. This model represents the X subunit of the three-subunit enzyme, (bacterio)chlorophyllide reductase. This enzyme is responsible for the reduction of the chlorin B-ring and is closely related to the protochlorophyllide reductase complex which reduces the D-ring. Both of these complexes in turn are homologous to nitrogenase. This subunit is homologous to the nitrogenase component II, or "iron" protein.
Probab=95.01  E-value=0.021  Score=46.21  Aligned_cols=22  Identities=23%  Similarity=0.229  Sum_probs=18.6

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ++|+|.|-||+||||+|..+..
T Consensus         1 ~vIav~gKGGvGKTT~a~nLA~   22 (296)
T TIGR02016         1 RIIAIYGKGGSGKSFTTTNLSH   22 (296)
T ss_pred             CEEEEECCCCCCHHHHHHHHHH
Confidence            5788999999999998776654


No 227
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=95.01  E-value=0.022  Score=44.39  Aligned_cols=25  Identities=20%  Similarity=0.167  Sum_probs=21.9

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .-.|+.|+|..|.|||||.+.+..=
T Consensus        27 ~Gevv~iiGpSGSGKSTlLRclN~L   51 (240)
T COG1126          27 KGEVVVIIGPSGSGKSTLLRCLNGL   51 (240)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCC
Confidence            4578999999999999999998663


No 228
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) catalyzes the phosphorylation of dephosphocoenzyme A (dCoA) to yield CoA, which is the final step in CoA biosynthesis.
Probab=95.01  E-value=0.019  Score=42.79  Aligned_cols=21  Identities=14%  Similarity=0.283  Sum_probs=18.8

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|+|.|+.|.||||+++.+.+
T Consensus         1 ii~itG~~gsGKst~~~~l~~   21 (179)
T cd02022           1 IIGLTGGIGSGKSTVAKLLKE   21 (179)
T ss_pred             CEEEECCCCCCHHHHHHHHHH
Confidence            478999999999999999865


No 229
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=95.01  E-value=0.023  Score=43.25  Aligned_cols=24  Identities=21%  Similarity=0.098  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+..-
T Consensus        30 G~~~~l~G~nGsGKSTLl~~i~Gl   53 (218)
T cd03255          30 GEFVAIVGPSGSGKSTLLNILGGL   53 (218)
T ss_pred             CCEEEEEcCCCCCHHHHHHHHhCC
Confidence            468899999999999999999773


No 230
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=94.99  E-value=0.024  Score=42.97  Aligned_cols=25  Identities=16%  Similarity=0.082  Sum_probs=21.8

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .-.+++|+|..|.|||||++.++.-
T Consensus        26 ~G~~~~l~G~nGsGKSTLl~~l~G~   50 (211)
T cd03225          26 KGEFVLIVGPNGSGKSTLLRLLNGL   50 (211)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhcC
Confidence            3468899999999999999999873


No 231
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=94.97  E-value=0.022  Score=40.30  Aligned_cols=19  Identities=11%  Similarity=0.169  Sum_probs=18.0

Q ss_pred             EEEEcCCCccHHHHHHHHh
Q 035574           18 VAILDSIGLDKTAFTAEAY   36 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy   36 (156)
                      |.++|..|+|||||...+.
T Consensus         2 i~l~G~~g~GKTtL~~~l~   20 (170)
T cd01876           2 IAFAGRSNVGKSSLINALT   20 (170)
T ss_pred             EEEEcCCCCCHHHHHHHHh
Confidence            6899999999999999998


No 232
>PRK13234 nifH nitrogenase reductase; Reviewed
Probab=94.96  E-value=0.026  Score=45.51  Aligned_cols=24  Identities=17%  Similarity=0.295  Sum_probs=19.8

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..++|+|.|-||+||||.+..+..
T Consensus         3 ~~~~iai~~KGGvGKTt~~~nLa~   26 (295)
T PRK13234          3 KLRQIAFYGKGGIGKSTTSQNTLA   26 (295)
T ss_pred             cceEEEEECCCCccHHHHHHHHHH
Confidence            468999999999999997776543


No 233
>TIGR02239 recomb_RAD51 DNA repair protein RAD51. This eukaryotic sequence family consists of RAD51, a protein involved in DNA homologous recombination and repair. It is similar in sequence the exclusively meiotic recombinase DMC1 (TIGR02238), to archaeal families RadA (TIGR02236) and RadB (TIGR02237), and to bacterial RecA (TIGR02012).
Probab=94.96  E-value=0.08  Score=43.26  Aligned_cols=51  Identities=12%  Similarity=0.110  Sum_probs=36.1

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhccccccccC----ceEEEEEcCCCCCHHHH
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYF----DYLAWIPAPYHYDPDQI   62 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F----~~~~wv~vs~~~~~~~l   62 (156)
                      -....++-|+|.+|.|||+|+..++.........    ...+|+.-...++...+
T Consensus        93 i~~g~i~~i~G~~g~GKT~l~~~~~~~~~~~~~~Gg~~~~vvyIdtE~~f~~~Rl  147 (316)
T TIGR02239        93 IETGSITEIFGEFRTGKTQLCHTLAVTCQLPIDQGGGEGKALYIDTEGTFRPERL  147 (316)
T ss_pred             CCCCeEEEEECCCCCCcCHHHHHHHHHHhhhhhcCCCCceEEEEECCCCCCHHHH
Confidence            3557888999999999999999886522221111    24688888777777764


No 234
>PRK07952 DNA replication protein DnaC; Validated
Probab=94.95  E-value=0.041  Score=43.43  Aligned_cols=37  Identities=14%  Similarity=0.075  Sum_probs=26.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPA   53 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~v   53 (156)
                      ...+-++|.+|+|||+||..+.+.  ....-...+++++
T Consensus        99 ~~~~~l~G~~GtGKThLa~aia~~--l~~~g~~v~~it~  135 (244)
T PRK07952         99 IASFIFSGKPGTGKNHLAAAICNE--LLLRGKSVLIITV  135 (244)
T ss_pred             CceEEEECCCCCCHHHHHHHHHHH--HHhcCCeEEEEEH
Confidence            356789999999999999999883  3322234555544


No 235
>PF00308 Bac_DnaA:  Bacterial dnaA  protein;  InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication. DnaA is an ATP- and DNA-binding protein. It binds specifically to 9 bp nucleotide repeats known as dnaA boxes which are found in the chromosome origin of replication (oriC). DnaA is a protein of about 50 kDa that contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP-binding domain, the second is located in the C-terminal half and could be involved in DNA-binding. The protein may also bind the RNA polymerase beta subunit, the dnaB and dnaZ proteins, and the groE gene products (chaperonins) [].; PDB: 2KJQ_A 2Z4S_A 2Z4R_C 2HCB_B 3R8F_C 1L8Q_A 3SC3_B 3BOS_A.
Probab=94.95  E-value=0.09  Score=40.59  Aligned_cols=25  Identities=20%  Similarity=0.247  Sum_probs=22.1

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .....+-|+|..|+|||.|.+.+++
T Consensus        32 ~~~~~l~l~G~~G~GKTHLL~Ai~~   56 (219)
T PF00308_consen   32 ERYNPLFLYGPSGLGKTHLLQAIAN   56 (219)
T ss_dssp             TSSSEEEEEESTTSSHHHHHHHHHH
T ss_pred             CCCCceEEECCCCCCHHHHHHHHHH
Confidence            3456788999999999999999999


No 236
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=94.95  E-value=0.025  Score=40.04  Aligned_cols=21  Identities=19%  Similarity=0.216  Sum_probs=18.8

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.|+|.+|+|||||...+.++
T Consensus         3 i~i~G~~~~GKStli~~l~~~   23 (162)
T cd04123           3 VVLLGEGRVGKTSLVLRYVEN   23 (162)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            689999999999999888764


No 237
>PRK08116 hypothetical protein; Validated
Probab=94.94  E-value=0.038  Score=44.06  Aligned_cols=36  Identities=17%  Similarity=0.050  Sum_probs=26.4

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPA   53 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~v   53 (156)
                      .-+-++|..|+|||.||..+++  ....+-...+++++
T Consensus       115 ~gl~l~G~~GtGKThLa~aia~--~l~~~~~~v~~~~~  150 (268)
T PRK08116        115 VGLLLWGSVGTGKTYLAACIAN--ELIEKGVPVIFVNF  150 (268)
T ss_pred             ceEEEECCCCCCHHHHHHHHHH--HHHHcCCeEEEEEH
Confidence            3578999999999999999999  44333233566653


No 238
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=94.94  E-value=0.023  Score=40.85  Aligned_cols=21  Identities=14%  Similarity=0.200  Sum_probs=18.9

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |+|+|..|+|||||.+.+.+.
T Consensus         3 v~ivG~~~~GKStl~~~l~~~   23 (170)
T cd01898           3 VGLVGLPNAGKSTLLSAISNA   23 (170)
T ss_pred             eEEECCCCCCHHHHHHHHhcC
Confidence            789999999999999998753


No 239
>PRK12377 putative replication protein; Provisional
Probab=94.93  E-value=0.028  Score=44.46  Aligned_cols=38  Identities=13%  Similarity=0.044  Sum_probs=28.3

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcC
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAP   54 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs   54 (156)
                      ...+-++|.+|+|||.||..+.+  ..........++++.
T Consensus       101 ~~~l~l~G~~GtGKThLa~AIa~--~l~~~g~~v~~i~~~  138 (248)
T PRK12377        101 CTNFVFSGKPGTGKNHLAAAIGN--RLLAKGRSVIVVTVP  138 (248)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHH--HHHHcCCCeEEEEHH
Confidence            45788999999999999999998  444333335666553


No 240
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=94.93  E-value=0.028  Score=38.88  Aligned_cols=22  Identities=27%  Similarity=0.238  Sum_probs=19.7

Q ss_pred             cEEEEEEcCCCccHHHHHHHHh
Q 035574           15 LSVVAILDSIGLDKTAFTAEAY   36 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy   36 (156)
                      -..+.|.|..|.|||||++.+.
T Consensus        15 ge~v~I~GpSGsGKSTLl~~l~   36 (107)
T cd00820          15 KVGVLITGDSGIGKTELALELI   36 (107)
T ss_pred             CEEEEEEcCCCCCHHHHHHHhh
Confidence            4678999999999999999975


No 241
>PRK06067 flagellar accessory protein FlaH; Validated
Probab=94.92  E-value=0.11  Score=40.05  Aligned_cols=51  Identities=16%  Similarity=0.108  Sum_probs=33.3

Q ss_pred             CCCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHH
Q 035574           11 GPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDI   65 (156)
Q Consensus        11 ~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~   65 (156)
                      +-..-+++-|.|.+|+|||+|+.++... ..+. =...+|++..+.  ..++.+.
T Consensus        21 G~~~g~~~~i~G~~GsGKt~l~~~~~~~-~~~~-g~~~~y~~~e~~--~~~~~~~   71 (234)
T PRK06067         21 GIPFPSLILIEGDHGTGKSVLSQQFVYG-ALKQ-GKKVYVITTENT--SKSYLKQ   71 (234)
T ss_pred             CCcCCcEEEEECCCCCChHHHHHHHHHH-HHhC-CCEEEEEEcCCC--HHHHHHH
Confidence            3455688899999999999999998432 1222 134677776543  3444444


No 242
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=94.92  E-value=0.086  Score=41.01  Aligned_cols=50  Identities=6%  Similarity=0.138  Sum_probs=30.9

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHHH
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDIV   66 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~i   66 (156)
                      ..-.++.|.|..|.|||||+.++... -.+.. ...++++  ...+..++++.+
T Consensus        22 ~~g~~~~i~G~~G~GKTtl~~~~~~~-~~~~g-~~~~yi~--~e~~~~~~~~~~   71 (230)
T PRK08533         22 PAGSLILIEGDESTGKSILSQRLAYG-FLQNG-YSVSYVS--TQLTTTEFIKQM   71 (230)
T ss_pred             CCCcEEEEECCCCCCHHHHHHHHHHH-HHhCC-CcEEEEe--CCCCHHHHHHHH
Confidence            44568999999999999998655442 11222 2345555  333445665555


No 243
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=94.91  E-value=0.027  Score=41.36  Aligned_cols=21  Identities=24%  Similarity=0.262  Sum_probs=18.8

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ++.++|.+|.||||++..+..
T Consensus         2 ~~~~~G~~G~GKTt~~~~la~   22 (173)
T cd03115           2 VILLVGLQGVGKTTTAAKLAL   22 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            678899999999999888776


No 244
>cd01864 Rab19 Rab19 subfamily.  Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=94.91  E-value=0.039  Score=39.70  Aligned_cols=24  Identities=13%  Similarity=0.167  Sum_probs=20.0

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ..-+.|+|.+|+|||||+..+..+
T Consensus         3 ~~kv~vvG~~~~GKTsli~~l~~~   26 (165)
T cd01864           3 LFKIILIGDSNVGKTCVVQRFKSG   26 (165)
T ss_pred             eeEEEEECCCCCCHHHHHHHHhhC
Confidence            356789999999999999988653


No 245
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein.
Probab=94.90  E-value=0.026  Score=43.00  Aligned_cols=23  Identities=17%  Similarity=0.206  Sum_probs=21.0

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||++.+..
T Consensus        29 Ge~~~i~G~nGsGKSTLl~~l~G   51 (216)
T TIGR00960        29 GEMVFLVGHSGAGKSTFLKLILG   51 (216)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhC
Confidence            46889999999999999999987


No 246
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=94.89  E-value=0.032  Score=41.94  Aligned_cols=52  Identities=17%  Similarity=0.090  Sum_probs=29.8

Q ss_pred             EEEEEcCCCccHHHHHHHHhcccc-----ccccCceEEEEEcCCCCCHHHHHHHHHH
Q 035574           17 VVAILDSIGLDKTAFTAEAYNSSY-----MKHYFDYLAWIPAPYHYDPDQILDIVAV   68 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~~~-----v~~~F~~~~wv~vs~~~~~~~l~~~il~   68 (156)
                      +..|+|.+|.||||++..+.....     ....-+..+-++...+..++.++..+.+
T Consensus        19 ~~~i~GpPGTGKT~~l~~~i~~~~~~~~~~~~~~~~~il~~~~sN~avd~~~~~l~~   75 (236)
T PF13086_consen   19 ITLIQGPPGTGKTTTLASIIAQLLQRFKSRSADRGKKILVVSPSNAAVDNILERLKK   75 (236)
T ss_dssp             -EEEE-STTSSHHHHHHHHHHHH-------HCCCSS-EEEEESSHHHHHHHHHHHHC
T ss_pred             CEEEECCCCCChHHHHHHHHHHhccchhhhhhhccccceeecCCchhHHHHHHHHHh
Confidence            678899999999986555544210     1123344555555666666666666655


No 247
>cd03114 ArgK-like The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.
Probab=94.89  E-value=0.022  Score=41.33  Aligned_cols=21  Identities=19%  Similarity=0.267  Sum_probs=18.4

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ++.+.|.+|+||||++..+..
T Consensus         1 ~i~~~G~~GsGKTt~~~~l~~   21 (148)
T cd03114           1 VIGITGVPGAGKSTLIDALIT   21 (148)
T ss_pred             CEEEECCCCCcHHHHHHHHHH
Confidence            478999999999999988766


No 248
>TIGR00455 apsK adenylylsulfate kinase (apsK). Important residue (active site in E.coli) is residue 100 of the seed alignment.
Probab=94.88  E-value=0.032  Score=41.48  Aligned_cols=24  Identities=13%  Similarity=0.069  Sum_probs=21.6

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...++.+.|.+|.||||+|+.+..
T Consensus        17 ~~~~i~i~G~~GsGKstla~~l~~   40 (184)
T TIGR00455        17 RGVVIWLTGLSGSGKSTIANALEK   40 (184)
T ss_pred             CCeEEEEECCCCCCHHHHHHHHHH
Confidence            357899999999999999999887


No 249
>cd00984 DnaB_C DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=94.88  E-value=0.14  Score=39.52  Aligned_cols=56  Identities=16%  Similarity=0.163  Sum_probs=36.0

Q ss_pred             CCCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHHHHHH
Q 035574           11 GPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDIVAVI   69 (156)
Q Consensus        11 ~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~il~~   69 (156)
                      +-..-.++.|.|.+|.|||+++.++..+.-.... ...+|++...  +..++...++..
T Consensus         9 Gl~~G~l~lI~G~~G~GKT~~~~~~~~~~~~~~g-~~vly~s~E~--~~~~~~~r~~~~   64 (242)
T cd00984           9 GLQPGDLIIIAARPSMGKTAFALNIAENIAKKQG-KPVLFFSLEM--SKEQLLQRLLAS   64 (242)
T ss_pred             CCCCCeEEEEEeCCCCCHHHHHHHHHHHHHHhCC-CceEEEeCCC--CHHHHHHHHHHH
Confidence            4344578899999999999999987663222212 2366665444  555666666544


No 250
>PRK04195 replication factor C large subunit; Provisional
Probab=94.87  E-value=0.031  Score=48.04  Aligned_cols=36  Identities=14%  Similarity=0.191  Sum_probs=26.6

Q ss_pred             HHHHHHhc--CCCCcEEEEEEcCCCccHHHHHHHHhcc
Q 035574            3 ELLDLLIE--GPTQLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus         3 ~l~~~L~~--~~~~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .+.+|+..  .....+.+-|+|.+|+||||+|+.++++
T Consensus        25 ~l~~~l~~~~~g~~~~~lLL~GppG~GKTtla~ala~e   62 (482)
T PRK04195         25 QLREWIESWLKGKPKKALLLYGPPGVGKTSLAHALAND   62 (482)
T ss_pred             HHHHHHHHHhcCCCCCeEEEECCCCCCHHHHHHHHHHH
Confidence            45555533  1222678889999999999999999883


No 251
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.87  E-value=0.03  Score=42.63  Aligned_cols=25  Identities=16%  Similarity=0.201  Sum_probs=22.1

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .. .+++|+|..|.|||||++.+..-
T Consensus        22 ~~-e~~~i~G~nGsGKSTLl~~l~G~   46 (214)
T cd03297          22 NE-EVTGIFGASGAGKSTLLRCIAGL   46 (214)
T ss_pred             cc-eeEEEECCCCCCHHHHHHHHhCC
Confidence            35 78999999999999999999773


No 252
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]
Probab=94.86  E-value=0.038  Score=41.95  Aligned_cols=25  Identities=8%  Similarity=0.189  Sum_probs=21.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      -..+.|.|..|+||+||++.++++.
T Consensus         4 G~l~vlsgPSG~GKsTl~k~L~~~~   28 (191)
T COG0194           4 GLLIVLSGPSGVGKSTLVKALLEDD   28 (191)
T ss_pred             ceEEEEECCCCCCHHHHHHHHHhhc
Confidence            3578899999999999999999954


No 253
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily.  Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation.  It is expressed ubiquitously, with elevated levels in muscle and brain.  Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth.  TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell.  TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb.  The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb.  Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le
Probab=94.85  E-value=0.03  Score=40.93  Aligned_cols=23  Identities=22%  Similarity=0.333  Sum_probs=19.5

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      +-|.++|.+|+|||||+..+.+.
T Consensus         2 ~kv~l~G~~g~GKTtl~~~~~~~   24 (180)
T cd04137           2 RKIAVLGSRSVGKSSLTVQFVEG   24 (180)
T ss_pred             eEEEEECCCCCCHHHHHHHHHhC
Confidence            34779999999999999988753


No 254
>cd04171 SelB SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryo
Probab=94.85  E-value=0.028  Score=39.97  Aligned_cols=21  Identities=14%  Similarity=0.188  Sum_probs=19.3

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|+|+|-.|+|||||...+.+
T Consensus         2 ~i~i~G~~~~GKssl~~~l~~   22 (164)
T cd04171           2 IIGTAGHIDHGKTTLIKALTG   22 (164)
T ss_pred             EEEEEecCCCCHHHHHHHHhC
Confidence            689999999999999999874


No 255
>TIGR00678 holB DNA polymerase III, delta' subunit. At position 126-127 of the seed alignment, this family lacks the HM motif of gamma/tau; at 132 it has a near-invariant A vs. an invariant F in gamma/tau.
Probab=94.83  E-value=0.42  Score=35.52  Aligned_cols=23  Identities=9%  Similarity=0.049  Sum_probs=19.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+-++|..|+||||+|+.+..
T Consensus        14 ~~~~L~~G~~G~gkt~~a~~~~~   36 (188)
T TIGR00678        14 AHAYLFAGPEGVGKELLALALAK   36 (188)
T ss_pred             CeEEEEECCCCCCHHHHHHHHHH
Confidence            36678899999999999987755


No 256
>TIGR02012 tigrfam_recA protein RecA. This model describes orthologs of the recA protein. RecA promotes hybridization of homolgous regions of DNA. A segment of ssDNA can be hybridized to another ssDNA region, or to a dsDNA region. ATP is hydrolyzed in the process. Part of the SOS respones, it is regulated by LexA via autocatalytic cleavage.
Probab=94.82  E-value=0.078  Score=43.54  Aligned_cols=44  Identities=16%  Similarity=0.078  Sum_probs=28.9

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCC
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHY   57 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~   57 (156)
                      -+.-+++-|.|.+|+||||||.++...  ....=...+|+...+.+
T Consensus        52 lp~G~iteI~G~~GsGKTtLaL~~~~~--~~~~g~~v~yId~E~~~   95 (321)
T TIGR02012        52 LPRGRIIEIYGPESSGKTTLALHAIAE--AQKAGGTAAFIDAEHAL   95 (321)
T ss_pred             CcCCeEEEEECCCCCCHHHHHHHHHHH--HHHcCCcEEEEcccchh
Confidence            355678999999999999999887652  22222335566544433


No 257
>cd00157 Rho Rho (Ras homology) family.  Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop.  There are 22 human Rho family members identified currently.  These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli.  They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase.  These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors).  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho protein
Probab=94.82  E-value=0.028  Score=40.39  Aligned_cols=22  Identities=9%  Similarity=0.151  Sum_probs=19.1

Q ss_pred             EEEEcCCCccHHHHHHHHhccc
Q 035574           18 VAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      |.++|.+|+|||||...+.+..
T Consensus         3 i~i~G~~~~GKSsli~~l~~~~   24 (171)
T cd00157           3 IVVVGDGAVGKTCLLISYTTGK   24 (171)
T ss_pred             EEEECCCCCCHHHHHHHHHhCC
Confidence            5699999999999999987653


No 258
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=94.82  E-value=0.043  Score=41.62  Aligned_cols=22  Identities=18%  Similarity=0.240  Sum_probs=18.6

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..+.|+|..|.||||++..+..
T Consensus         2 GlilI~GptGSGKTTll~~ll~   23 (198)
T cd01131           2 GLVLVTGPTGSGKSTTLAAMID   23 (198)
T ss_pred             cEEEEECCCCCCHHHHHHHHHH
Confidence            3678999999999999887654


No 259
>PRK10416 signal recognition particle-docking protein FtsY; Provisional
Probab=94.82  E-value=0.032  Score=45.68  Aligned_cols=24  Identities=17%  Similarity=0.202  Sum_probs=21.3

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...++.++|.+|+||||++..+..
T Consensus       113 ~~~vi~lvGpnGsGKTTt~~kLA~  136 (318)
T PRK10416        113 KPFVILVVGVNGVGKTTTIGKLAH  136 (318)
T ss_pred             CCeEEEEECCCCCcHHHHHHHHHH
Confidence            468999999999999999888766


No 260
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=94.81  E-value=0.038  Score=40.69  Aligned_cols=44  Identities=11%  Similarity=0.200  Sum_probs=27.8

Q ss_pred             EEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHH
Q 035574           18 VAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDI   65 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~   65 (156)
                      +-|.|.+|.|||+|+.++....- +.. ...+|++..+  +..++.+.
T Consensus         2 ~li~G~~G~GKT~l~~~~~~~~~-~~g-~~v~~~s~e~--~~~~~~~~   45 (187)
T cd01124           2 TLLSGGPGTGKTTFALQFLYAGL-ARG-EPGLYVTLEE--SPEELIEN   45 (187)
T ss_pred             EEEEcCCCCCHHHHHHHHHHHHH-HCC-CcEEEEECCC--CHHHHHHH
Confidence            56889999999999998755321 221 3366776543  34454444


No 261
>PF00071 Ras:  Ras family;  InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction; PDB: 1M7B_A 2V55_B 3EG5_C 3LAW_A 1YHN_A 1T91_B 1HE8_B 3SEA_B 3T5G_A 1XTS_A ....
Probab=94.81  E-value=0.034  Score=39.74  Aligned_cols=22  Identities=18%  Similarity=0.398  Sum_probs=19.2

Q ss_pred             EEEEcCCCccHHHHHHHHhccc
Q 035574           18 VAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      |.++|.+|+|||||+..+.+..
T Consensus         2 i~vvG~~~vGKtsl~~~~~~~~   23 (162)
T PF00071_consen    2 IVVVGDSGVGKTSLINRLINGE   23 (162)
T ss_dssp             EEEEESTTSSHHHHHHHHHHSS
T ss_pred             EEEECCCCCCHHHHHHHHHhhc
Confidence            6789999999999999887753


No 262
>TIGR00362 DnaA chromosomal replication initiator protein DnaA. DnaA is involved in DNA biosynthesis; initiation of chromosome replication and can also be transcription regulator. The C-terminal of the family hits the pfam bacterial DnaA (bac_dnaA) domain family. For a review, see Kaguni (2006).
Probab=94.81  E-value=0.086  Score=44.22  Aligned_cols=36  Identities=17%  Similarity=0.196  Sum_probs=26.2

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCc--eEEEEE
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFD--YLAWIP   52 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~--~~~wv~   52 (156)
                      ...+-|+|..|+|||+|++.+++  .+.....  ..++++
T Consensus       136 ~n~l~l~G~~G~GKThL~~ai~~--~l~~~~~~~~v~yi~  173 (405)
T TIGR00362       136 YNPLFIYGGVGLGKTHLLHAIGN--EILENNPNAKVVYVS  173 (405)
T ss_pred             CCeEEEECCCCCcHHHHHHHHHH--HHHHhCCCCcEEEEE
Confidence            45688999999999999999998  4433322  245554


No 263
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=94.81  E-value=0.029  Score=40.05  Aligned_cols=23  Identities=9%  Similarity=0.199  Sum_probs=19.8

Q ss_pred             EEEEEcCCCccHHHHHHHHhccc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      -|.|+|.+|+|||||+..+.++.
T Consensus         3 ki~v~G~~~~GKSsli~~l~~~~   25 (163)
T cd01860           3 KLVLLGDSSVGKSSLVLRFVKNE   25 (163)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCC
Confidence            36899999999999999887754


No 264
>smart00178 SAR Sar1p-like members of the Ras-family  of small GTPases. Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.
Probab=94.79  E-value=0.053  Score=40.21  Aligned_cols=24  Identities=17%  Similarity=0.046  Sum_probs=20.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ...|.++|.+|+|||||...+..+
T Consensus        17 ~~~i~ivG~~~~GKTsli~~l~~~   40 (184)
T smart00178       17 HAKILFLGLDNAGKTTLLHMLKND   40 (184)
T ss_pred             cCEEEEECCCCCCHHHHHHHHhcC
Confidence            356789999999999999998764


No 265
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=94.78  E-value=0.027  Score=40.49  Aligned_cols=20  Identities=30%  Similarity=0.245  Sum_probs=17.5

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |.++|..|+|||||...+..
T Consensus         2 i~~vG~~~~GKstLi~~l~~   21 (167)
T cd04160           2 VLILGLDNAGKTTFLEQLKT   21 (167)
T ss_pred             EEEEecCCCCHHHHHHHHhh
Confidence            67899999999999998754


No 266
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=94.75  E-value=0.03  Score=41.79  Aligned_cols=23  Identities=22%  Similarity=0.250  Sum_probs=21.0

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||.+.+..
T Consensus        18 Ge~~~i~G~nGsGKSTLl~~i~G   40 (190)
T TIGR01166        18 GEVLALLGANGAGKSTLLLHLNG   40 (190)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhC
Confidence            45889999999999999999987


No 267
>cd04140 ARHI_like ARHI subfamily.  ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties.  ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer.  ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity.   Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity.  ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Due to
Probab=94.74  E-value=0.03  Score=40.43  Aligned_cols=22  Identities=14%  Similarity=0.253  Sum_probs=18.9

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .|.++|.+|+|||||...+.++
T Consensus         3 kv~~vG~~~vGKTsli~~~~~~   24 (165)
T cd04140           3 RVVVFGAGGVGKSSLVLRFVKG   24 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHHhC
Confidence            3689999999999999888654


No 268
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.74  E-value=0.031  Score=41.40  Aligned_cols=23  Identities=22%  Similarity=0.213  Sum_probs=20.7

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||++.+..
T Consensus        26 G~~~~i~G~nGsGKSTLl~~l~G   48 (178)
T cd03229          26 GEIVALLGPSGSGKSTLLRCIAG   48 (178)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhC
Confidence            46889999999999999999875


No 269
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily.  Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to t
Probab=94.74  E-value=0.031  Score=40.24  Aligned_cols=22  Identities=9%  Similarity=0.231  Sum_probs=19.2

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -+.|+|.+|+|||||...+.++
T Consensus         4 ki~i~G~~~vGKSsli~~~~~~   25 (166)
T cd01869           4 KLLLIGDSGVGKSCLLLRFADD   25 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            4788999999999999998764


No 270
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans.  NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes.  Thus, defects in NOG1 can lead to defects in 60S biogenesis.  The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function.  It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=94.73  E-value=0.03  Score=40.22  Aligned_cols=22  Identities=9%  Similarity=0.148  Sum_probs=19.9

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .|.++|..|+|||||+..+.+.
T Consensus         2 ~i~~~G~~~~GKssli~~l~~~   23 (168)
T cd01897           2 TLVIAGYPNVGKSSLVNKLTRA   23 (168)
T ss_pred             eEEEEcCCCCCHHHHHHHHhcC
Confidence            5789999999999999998775


No 271
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.73  E-value=0.03  Score=43.24  Aligned_cols=24  Identities=17%  Similarity=0.171  Sum_probs=21.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+...
T Consensus        26 Ge~~~l~G~nGsGKSTLl~~l~G~   49 (235)
T cd03261          26 GEILAIIGPSGSGKSTLLRLIVGL   49 (235)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            458899999999999999998763


No 272
>PLN02796 D-glycerate 3-kinase
Probab=94.72  E-value=0.034  Score=46.09  Aligned_cols=24  Identities=21%  Similarity=0.141  Sum_probs=21.7

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..-+|+|.|..|.|||||++.+..
T Consensus        99 ~pliIGI~G~sGSGKSTLa~~L~~  122 (347)
T PLN02796         99 PPLVIGISAPQGCGKTTLVFALVY  122 (347)
T ss_pred             CCEEEEEECCCCCcHHHHHHHHHH
Confidence            456899999999999999999877


No 273
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=94.71  E-value=0.03  Score=42.67  Aligned_cols=24  Identities=17%  Similarity=0.097  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.++.-
T Consensus        28 Ge~~~i~G~nGsGKSTLl~~l~Gl   51 (220)
T cd03263          28 GEIFGLLGHNGAGKTTTLKMLTGE   51 (220)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            458999999999999999999873


No 274
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.69  E-value=0.031  Score=42.34  Aligned_cols=24  Identities=17%  Similarity=0.116  Sum_probs=21.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+...
T Consensus        26 G~~~~i~G~nGsGKSTLl~~l~G~   49 (210)
T cd03269          26 GEIFGLLGPNGAGKTTTIRMILGI   49 (210)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            468899999999999999999874


No 275
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.68  E-value=0.032  Score=42.38  Aligned_cols=23  Identities=22%  Similarity=0.173  Sum_probs=20.8

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||++.+..
T Consensus        26 Ge~~~i~G~nGsGKSTLl~~l~G   48 (213)
T cd03259          26 GEFLALLGPSGCGKTTLLRLIAG   48 (213)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhC
Confidence            46789999999999999999876


No 276
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.67  E-value=0.031  Score=42.69  Aligned_cols=24  Identities=17%  Similarity=0.116  Sum_probs=21.3

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+..-
T Consensus        30 G~~~~i~G~nGsGKSTLl~~l~Gl   53 (220)
T cd03293          30 GEFVALVGPSGCGKSTLLRIIAGL   53 (220)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            367899999999999999999774


No 277
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair]
Probab=94.67  E-value=0.11  Score=43.72  Aligned_cols=51  Identities=16%  Similarity=0.147  Sum_probs=43.3

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHHHHHHhC
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDIVAVILL   71 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~il~~l~   71 (156)
                      ..+-|.|-.|.|||.+.+.+++..  .   -..+|+++-+.+....++..|+.++.
T Consensus        31 S~~~iyG~sgTGKT~~~r~~l~~~--n---~~~vw~n~~ecft~~~lle~IL~~~~   81 (438)
T KOG2543|consen   31 SIVHIYGHSGTGKTYLVRQLLRKL--N---LENVWLNCVECFTYAILLEKILNKSQ   81 (438)
T ss_pred             eeEEEeccCCCchhHHHHHHHhhc--C---CcceeeehHHhccHHHHHHHHHHHhc
Confidence            445788999999999999999944  1   23699999999999999999999883


No 278
>PRK14531 adenylate kinase; Provisional
Probab=94.66  E-value=0.032  Score=41.63  Aligned_cols=21  Identities=19%  Similarity=0.137  Sum_probs=19.0

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .|-|+|.+|.||||+++.+..
T Consensus         4 ~i~i~G~pGsGKsT~~~~la~   24 (183)
T PRK14531          4 RLLFLGPPGAGKGTQAARLCA   24 (183)
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            478899999999999999876


No 279
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=94.65  E-value=0.033  Score=42.73  Aligned_cols=23  Identities=13%  Similarity=0.163  Sum_probs=20.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||++.+..
T Consensus        26 Ge~~~i~G~nGsGKSTLl~~i~G   48 (227)
T cd03260          26 GEITALIGPSGCGKSTLLRLLNR   48 (227)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHh
Confidence            46889999999999999999877


No 280
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family. This KaiC domain-containing protein family occurs sporadically across a broad taxonomic range (Euryarchaeota, Aquificae, Dictyoglomi, Epsilonproteobacteria, and Firmicutes), but exclusively in thermophiles.
Probab=94.65  E-value=0.033  Score=44.08  Aligned_cols=41  Identities=10%  Similarity=0.048  Sum_probs=28.1

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCC
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPY   55 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~   55 (156)
                      ..-+++-|.|.+|.|||+++.++...- .+ +=+..++++..+
T Consensus        34 p~gs~~lI~G~pGtGKT~l~~qf~~~~-a~-~Ge~vlyis~Ee   74 (259)
T TIGR03878        34 PAYSVINITGVSDTGKSLMVEQFAVTQ-AS-RGNPVLFVTVES   74 (259)
T ss_pred             ECCcEEEEEcCCCCCHHHHHHHHHHHH-Hh-CCCcEEEEEecC
Confidence            446788999999999999999874421 11 113466776653


No 281
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family. Members of this protein family are archaeal single-domain KaiC_related proteins, homologous to the Cyanobacterial circadian clock cycle protein KaiC, an autokinase/autophosphorylase that has two copies of the domain.
Probab=94.64  E-value=0.2  Score=38.40  Aligned_cols=51  Identities=18%  Similarity=0.174  Sum_probs=33.4

Q ss_pred             CCCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHH
Q 035574           11 GPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDI   65 (156)
Q Consensus        11 ~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~   65 (156)
                      +-..-..+.|.|.+|.|||||+.++..+- .+ .-+..+|++...  +.+++.+.
T Consensus        16 Gi~~G~~~~i~G~~G~GKT~l~~~~~~~~-~~-~g~~~~~is~e~--~~~~i~~~   66 (229)
T TIGR03881        16 GIPRGFFVAVTGEPGTGKTIFCLHFAYKG-LR-DGDPVIYVTTEE--SRESIIRQ   66 (229)
T ss_pred             CCcCCeEEEEECCCCCChHHHHHHHHHHH-Hh-cCCeEEEEEccC--CHHHHHHH
Confidence            33456889999999999999999865421 12 234577887644  34455433


No 282
>TIGR02673 FtsE cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.
Probab=94.64  E-value=0.033  Score=42.27  Aligned_cols=23  Identities=17%  Similarity=0.174  Sum_probs=20.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||++.+..
T Consensus        28 G~~~~l~G~nGsGKSTLl~~i~G   50 (214)
T TIGR02673        28 GEFLFLTGPSGAGKTTLLKLLYG   50 (214)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhC
Confidence            45889999999999999999977


No 283
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=94.63  E-value=0.034  Score=47.18  Aligned_cols=24  Identities=21%  Similarity=0.322  Sum_probs=21.0

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..++|.++|.+|+||||++..+..
T Consensus       240 ~~~vI~LVGptGvGKTTTiaKLA~  263 (436)
T PRK11889        240 EVQTIALIGPTGVGKTTTLAKMAW  263 (436)
T ss_pred             CCcEEEEECCCCCcHHHHHHHHHH
Confidence            357999999999999999888865


No 284
>PLN03025 replication factor C subunit; Provisional
Probab=94.63  E-value=0.047  Score=44.38  Aligned_cols=21  Identities=14%  Similarity=0.039  Sum_probs=18.4

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -+-++|.+|+||||+|+.+.+
T Consensus        36 ~lll~Gp~G~GKTtla~~la~   56 (319)
T PLN03025         36 NLILSGPPGTGKTTSILALAH   56 (319)
T ss_pred             eEEEECCCCCCHHHHHHHHHH
Confidence            356899999999999998877


No 285
>PTZ00088 adenylate kinase 1; Provisional
Probab=94.63  E-value=0.029  Score=43.83  Aligned_cols=20  Identities=15%  Similarity=0.341  Sum_probs=18.6

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |.|.|++|+||||+|+.+.+
T Consensus         9 Ivl~G~PGsGK~T~a~~La~   28 (229)
T PTZ00088          9 IVLFGAPGVGKGTFAEILSK   28 (229)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            78899999999999999876


No 286
>PRK05642 DNA replication initiation factor; Validated
Probab=94.63  E-value=0.042  Score=42.82  Aligned_cols=38  Identities=11%  Similarity=0.170  Sum_probs=26.8

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcC
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAP   54 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs   54 (156)
                      .+.+-|+|..|+|||.|++.+++  .....-...+|++..
T Consensus        45 ~~~l~l~G~~G~GKTHLl~a~~~--~~~~~~~~v~y~~~~   82 (234)
T PRK05642         45 ESLIYLWGKDGVGRSHLLQAACL--RFEQRGEPAVYLPLA   82 (234)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHH--HHHhCCCcEEEeeHH
Confidence            36789999999999999999877  322221235666553


No 287
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein. Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.
Probab=94.61  E-value=0.033  Score=43.11  Aligned_cols=23  Identities=22%  Similarity=0.193  Sum_probs=20.7

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||++.+..
T Consensus        28 Ge~~~l~G~nGsGKSTLl~~l~G   50 (243)
T TIGR02315        28 GEFVAIIGPSGAGKSTLLRCINR   50 (243)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhC
Confidence            36899999999999999999876


No 288
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.61  E-value=0.033  Score=42.99  Aligned_cols=23  Identities=17%  Similarity=0.172  Sum_probs=20.7

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||++.+..
T Consensus        27 Ge~~~i~G~nGsGKSTLl~~l~G   49 (241)
T cd03256          27 GEFVALIGPSGAGKSTLLRCLNG   49 (241)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhC
Confidence            45889999999999999999876


No 289
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=94.61  E-value=0.02  Score=39.75  Aligned_cols=19  Identities=5%  Similarity=0.160  Sum_probs=17.0

Q ss_pred             EEcCCCccHHHHHHHHhcc
Q 035574           20 ILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        20 I~G~gGvGKTtLa~~vy~~   38 (156)
                      |+|..|+|||||++.++..
T Consensus         1 i~G~~gsGKstl~~~l~~~   19 (163)
T cd00880           1 LFGRTNAGKSSLLNALLGQ   19 (163)
T ss_pred             CcCCCCCCHHHHHHHHhCc
Confidence            5799999999999998874


No 290
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily.  RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively.  RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis.  Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression.  In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo.  RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors.  Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm.  Both are believed to have tu
Probab=94.60  E-value=0.038  Score=39.79  Aligned_cols=20  Identities=25%  Similarity=0.473  Sum_probs=17.3

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |.|+|.+|+|||||...+..
T Consensus         2 i~vvG~~~~GKtsli~~~~~   21 (165)
T cd04146           2 IAVLGASGVGKSALVVRFLT   21 (165)
T ss_pred             EEEECCCCCcHHHHHHHHHh
Confidence            68999999999999977654


No 291
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.
Probab=94.59  E-value=0.12  Score=40.61  Aligned_cols=52  Identities=12%  Similarity=-0.048  Sum_probs=34.6

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcccccccc-CceEEEEEcCCCCCHHHHHHHHHHHh
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHY-FDYLAWIPAPYHYDPDQILDIVAVIL   70 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~-F~~~~wv~vs~~~~~~~l~~~il~~l   70 (156)
                      -.++.|.|.+|+||||++.++..+  ...+ =...+|++...  +..++...+...+
T Consensus        30 g~~~~i~g~~G~GKT~l~~~~~~~--~~~~~g~~vl~iS~E~--~~~~~~~r~~~~~   82 (271)
T cd01122          30 GELIILTAGTGVGKTTFLREYALD--LITQHGVRVGTISLEE--PVVRTARRLLGQY   82 (271)
T ss_pred             CcEEEEEcCCCCCHHHHHHHHHHH--HHHhcCceEEEEEccc--CHHHHHHHHHHHH
Confidence            457788999999999999988663  2222 13477877654  4455666655543


No 292
>PF06564 YhjQ:  YhjQ protein;  InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon. It is identified as a probable component of the bacterial cellulose metabolic process not only by gene location, but also by partial phylogenetic profiling, or Haft-Selengut algorithm [], based on a bacterial cellulose biosynthesis genome property profile. Cellulose plays an important role in biofilm formation and structural integrity in some bacteria. Mutants in yhjQ in Escherichia coli, show altered morphology an growth, but the function of YhjQ has not yet been determined.
Probab=94.59  E-value=0.033  Score=43.97  Aligned_cols=23  Identities=35%  Similarity=0.430  Sum_probs=18.9

Q ss_pred             cEEEEEEcC-CCccHHHHHHHHhc
Q 035574           15 LSVVAILDS-IGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~-gGvGKTtLa~~vy~   37 (156)
                      +.+|.|+|. ||+||||++..+..
T Consensus         1 M~~iai~s~kGGvG~TTltAnLA~   24 (243)
T PF06564_consen    1 MKVIAIVSPKGGVGKTTLTANLAW   24 (243)
T ss_pred             CcEEEEecCCCCCCHHHHHHHHHH
Confidence            367899998 78999999887655


No 293
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family. Members of this protein family resemble the widely distributed ATP-dependent protease La, also called Lon and LonA. It resembles even more closely LonB, which is a LonA paralog found in genomes if and only if the species is capable of endospore formation (as in Bacillus subtilis, Clostridium tetani, and select other members of the Firmicutes) and expressed specifically in the forespore compartment. Members of this family are restricted to a subset of spore-forming species, and are very likely to participate in the program of endospore formation. We propose the designation LonC.
Probab=94.59  E-value=0.047  Score=48.54  Aligned_cols=26  Identities=15%  Similarity=0.144  Sum_probs=22.3

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcccc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSY   40 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~   40 (156)
                      ...+-|+|.+|+||||||+.+++..+
T Consensus       175 ~~~vlL~Gp~GtGKTTLAr~i~~~~~  200 (615)
T TIGR02903       175 PQHIILYGPPGVGKTTAARLALEEAK  200 (615)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHHhhh
Confidence            45689999999999999999987543


No 294
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=94.58  E-value=0.032  Score=42.33  Aligned_cols=24  Identities=17%  Similarity=0.171  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+...
T Consensus        25 Ge~~~l~G~nGsGKSTLl~~l~G~   48 (213)
T cd03235          25 GEFLAIVGPNGAGKSTLLKAILGL   48 (213)
T ss_pred             CCEEEEECCCCCCHHHHHHHHcCC
Confidence            468899999999999999999773


No 295
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=94.58  E-value=0.035  Score=39.71  Aligned_cols=20  Identities=25%  Similarity=0.285  Sum_probs=18.0

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      +.++|.+|+|||+|+..+.+
T Consensus         3 i~vvG~~~~GKtsl~~~l~~   22 (164)
T cd04101           3 CAVVGDPAVGKTAFVQMFHS   22 (164)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            68999999999999998865


No 296
>cd04135 Tc10 TC10 subfamily.  TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro.  Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration.  TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins.  GTP-bound TC10 in vitro can bind numerous potential effectors.  Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes.  TC10 mRNAs are highly expressed in three types of mouse muscle tissues:  leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns.  TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti
Probab=94.58  E-value=0.044  Score=39.67  Aligned_cols=21  Identities=14%  Similarity=0.158  Sum_probs=18.1

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      +.++|.+|+|||||...+..+
T Consensus         3 i~i~G~~~~GKTsl~~~~~~~   23 (174)
T cd04135           3 CVVVGDGAVGKTCLLMSYAND   23 (174)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            679999999999999887554


No 297
>PLN02924 thymidylate kinase
Probab=94.57  E-value=0.12  Score=40.01  Aligned_cols=25  Identities=8%  Similarity=-0.051  Sum_probs=22.1

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ....|.|.|..|+||||+++.+.+.
T Consensus        15 ~g~~IviEGiDGsGKsTq~~~L~~~   39 (220)
T PLN02924         15 RGALIVLEGLDRSGKSTQCAKLVSF   39 (220)
T ss_pred             CCeEEEEECCCCCCHHHHHHHHHHH
Confidence            3468999999999999999999884


No 298
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=94.57  E-value=0.055  Score=39.43  Aligned_cols=23  Identities=17%  Similarity=0.092  Sum_probs=19.3

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ..+.++|.+|+|||||+..+...
T Consensus        15 ~kv~ivG~~~~GKTsL~~~l~~~   37 (173)
T cd04154          15 MRILILGLDNAGKTTILKKLLGE   37 (173)
T ss_pred             cEEEEECCCCCCHHHHHHHHccC
Confidence            35679999999999999988653


No 299
>PRK12608 transcription termination factor Rho; Provisional
Probab=94.57  E-value=0.086  Score=44.21  Aligned_cols=54  Identities=9%  Similarity=-0.060  Sum_probs=37.7

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccccccccC-ce-EEEEEcCC-CCCHHHHHHHHHHHhC
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSSYMKHYF-DY-LAWIPAPY-HYDPDQILDIVAVILL   71 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F-~~-~~wv~vs~-~~~~~~l~~~il~~l~   71 (156)
                      .-..|+|..|+|||||++.+.+  .+..+. +. .+|+.+.+ .-.+.++.+.+...+.
T Consensus       134 QR~LIvG~pGtGKTTLl~~la~--~i~~~~~dv~~vv~lIgER~~EV~df~~~i~~~Vv  190 (380)
T PRK12608        134 QRGLIVAPPRAGKTVLLQQIAA--AVAANHPEVHLMVLLIDERPEEVTDMRRSVKGEVY  190 (380)
T ss_pred             ceEEEECCCCCCHHHHHHHHHH--HHHhcCCCceEEEEEecCCCCCHHHHHHHHhhhEE
Confidence            3458999999999999999887  443322 44 36666655 4567778877766553


No 300
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]
Probab=94.56  E-value=0.22  Score=41.63  Aligned_cols=24  Identities=21%  Similarity=0.160  Sum_probs=20.6

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .+=|-++|.+|.|||-||++|.++
T Consensus       185 PKGVLLYGPPGTGKTLLAkAVA~~  208 (406)
T COG1222         185 PKGVLLYGPPGTGKTLLAKAVANQ  208 (406)
T ss_pred             CCceEeeCCCCCcHHHHHHHHHhc
Confidence            444668999999999999999993


No 301
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]
Probab=94.56  E-value=0.056  Score=43.22  Aligned_cols=24  Identities=8%  Similarity=0.148  Sum_probs=21.6

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .-.+++++|..|.|||||++.+..
T Consensus        38 ~ge~~glVGESG~GKSTlgr~i~~   61 (268)
T COG4608          38 EGETLGLVGESGCGKSTLGRLILG   61 (268)
T ss_pred             CCCEEEEEecCCCCHHHHHHHHHc
Confidence            356889999999999999999987


No 302
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=94.55  E-value=0.036  Score=41.62  Aligned_cols=24  Identities=13%  Similarity=0.070  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+...
T Consensus        26 Ge~~~l~G~nGsGKSTLl~~l~G~   49 (195)
T PRK13541         26 SAITYIKGANGCGKSSLLRMIAGI   49 (195)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhcC
Confidence            358899999999999999999884


No 303
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=94.55  E-value=0.035  Score=42.56  Aligned_cols=24  Identities=17%  Similarity=0.149  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.++.-
T Consensus        36 Ge~~~i~G~nGsGKSTLl~~i~Gl   59 (228)
T PRK10584         36 GETIALIGESGSGKSTLLAILAGL   59 (228)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHcC
Confidence            468999999999999999999873


No 304
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes. This enzyme catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.
Probab=94.55  E-value=0.027  Score=45.06  Aligned_cols=21  Identities=14%  Similarity=0.338  Sum_probs=19.2

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +++|.|..|.|||||++.+..
T Consensus         1 iigI~G~sGsGKSTl~~~L~~   21 (273)
T cd02026           1 IIGVAGDSGCGKSTFLRRLTS   21 (273)
T ss_pred             CEEEECCCCCCHHHHHHHHHH
Confidence            579999999999999999875


No 305
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair]
Probab=94.54  E-value=0.036  Score=44.82  Aligned_cols=25  Identities=16%  Similarity=0.290  Sum_probs=21.3

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ....|-++||.|.||||..+.++.+
T Consensus        18 ~p~~ilVvGMAGSGKTTF~QrL~~h   42 (366)
T KOG1532|consen   18 RPVIILVVGMAGSGKTTFMQRLNSH   42 (366)
T ss_pred             CCcEEEEEecCCCCchhHHHHHHHH
Confidence            3457788999999999999999884


No 306
>PF00406 ADK:  Adenylate kinase;  InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction  AMP + MgATP = ADP + MgADP  an essential reaction for many processes in living cells. Two ADK isozymes have been identified in mammalian cells. These specifically bind AMP and favour binding to ATP over other nucleotide triphosphates (AK1 is cytosolic and AK2 is located in the mitochondria). A third ADK has been identified in bovine heart and human cells [], this is a mitochondrial GTP:AMP phosphotransferase, also specific for the phosphorylation of AMP, but can only use GTP or ITP as a substrate []. ADK has also been identified in different bacterial species and in yeast []. Two further enzymes are known to be related to the ADK family, i.e. yeast uridine monophosphokinase and slime mold UMP-CMP kinase. Within the ADK family there are several conserved regions, including the ATP-binding domains. One of the most conserved areas includes an Arg residue, whose modification inactivates the enzyme, together with an Asp that resides in the catalytic cleft of the enzyme and participates in a salt bridge.; GO: 0005524 ATP binding, 0019205 nucleobase-containing compound kinase activity, 0006139 nucleobase-containing compound metabolic process; PDB: 1ZD8_A 3TLX_D 1TEV_A 1ZAK_B 3CM0_A 3ADK_A 1ZIP_A 1ZIO_A 1ZIN_A 3NDP_A ....
Probab=94.53  E-value=0.028  Score=40.43  Aligned_cols=18  Identities=22%  Similarity=0.161  Sum_probs=16.9

Q ss_pred             EEcCCCccHHHHHHHHhc
Q 035574           20 ILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        20 I~G~gGvGKTtLa~~vy~   37 (156)
                      |.|.+|+||||+|+.+..
T Consensus         1 i~G~PgsGK~t~~~~la~   18 (151)
T PF00406_consen    1 ILGPPGSGKGTQAKRLAK   18 (151)
T ss_dssp             EEESTTSSHHHHHHHHHH
T ss_pred             CcCCCCCChHHHHHHHHH
Confidence            689999999999999988


No 307
>cd01855 YqeH YqeH.  YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts.  Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.
Probab=94.53  E-value=0.042  Score=40.98  Aligned_cols=36  Identities=11%  Similarity=0.178  Sum_probs=25.5

Q ss_pred             HHHHHHhcCCCCcEEEEEEcCCCccHHHHHHHHhcc
Q 035574            3 ELLDLLIEGPTQLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus         3 ~l~~~L~~~~~~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      +|.+.|.+.-.....+.++|.+|+|||||...+...
T Consensus       115 eL~~~l~~~l~~~~~~~~~G~~nvGKStliN~l~~~  150 (190)
T cd01855         115 ELINAIKKLAKKGGDVYVVGATNVGKSTLINALLKK  150 (190)
T ss_pred             HHHHHHHHHhhcCCcEEEEcCCCCCHHHHHHHHHHh
Confidence            445555432223356889999999999999999874


No 308
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.
Probab=94.52  E-value=0.036  Score=42.84  Aligned_cols=24  Identities=21%  Similarity=0.144  Sum_probs=21.2

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+...
T Consensus        27 Ge~~~i~G~nGsGKSTLl~~l~G~   50 (236)
T TIGR03864        27 GEFVALLGPNGAGKSTLFSLLTRL   50 (236)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            468899999999999999999763


No 309
>PRK00454 engB GTP-binding protein YsxC; Reviewed
Probab=94.52  E-value=0.042  Score=40.66  Aligned_cols=26  Identities=12%  Similarity=0.106  Sum_probs=22.7

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ....-|.|+|.+|+|||||...+.++
T Consensus        22 ~~~~~v~ivG~~~~GKSsli~~l~~~   47 (196)
T PRK00454         22 DDGPEIAFAGRSNVGKSSLINALTNR   47 (196)
T ss_pred             CCCCEEEEEcCCCCCHHHHHHHHhCC
Confidence            34567999999999999999999874


No 310
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=94.50  E-value=0.037  Score=41.92  Aligned_cols=24  Identities=17%  Similarity=0.232  Sum_probs=21.2

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||.+.+...
T Consensus        27 G~~~~i~G~nGsGKSTLl~~l~G~   50 (214)
T cd03292          27 GEFVFLVGPSGAGKSTLLKLIYKE   50 (214)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcC
Confidence            457899999999999999999873


No 311
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional
Probab=94.50  E-value=0.25  Score=45.80  Aligned_cols=23  Identities=13%  Similarity=0.081  Sum_probs=19.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+-++|..|+||||+|+.+.+
T Consensus        38 ~HAyLFtGPpGtGKTTLARiLAk   60 (944)
T PRK14949         38 HHAYLFTGTRGVGKTSLARLFAK   60 (944)
T ss_pred             CeEEEEECCCCCCHHHHHHHHHH
Confidence            34557899999999999999876


No 312
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily.  Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project.  It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2).  This is a novel subfamily identified in human cancers that is uncharacterized to date.
Probab=94.49  E-value=0.035  Score=40.39  Aligned_cols=21  Identities=19%  Similarity=0.218  Sum_probs=18.7

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.|+|.+|+|||||...+.+.
T Consensus         2 i~ivG~~~vGKTsli~~~~~~   22 (164)
T cd04162           2 ILVLGLDGAGKTSLLHSLSSE   22 (164)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            678999999999999988764


No 313
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=94.49  E-value=0.034  Score=41.24  Aligned_cols=24  Identities=13%  Similarity=0.267  Sum_probs=21.8

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      +++.++|..|+|||||...+..+.
T Consensus        36 k~~vl~G~SGvGKSSLiN~L~~~~   59 (161)
T PF03193_consen   36 KTSVLLGQSGVGKSSLINALLPEA   59 (161)
T ss_dssp             SEEEEECSTTSSHHHHHHHHHTSS
T ss_pred             CEEEEECCCCCCHHHHHHHHHhhc
Confidence            788999999999999999998854


No 314
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.49  E-value=0.037  Score=42.24  Aligned_cols=24  Identities=17%  Similarity=0.084  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||.+.+...
T Consensus        26 Ge~~~i~G~nGsGKSTLl~~i~G~   49 (220)
T cd03265          26 GEIFGLLGPNGAGKTTTIKMLTTL   49 (220)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            468899999999999999999873


No 315
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.48  E-value=0.037  Score=42.89  Aligned_cols=24  Identities=25%  Similarity=0.174  Sum_probs=21.2

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+..-
T Consensus        28 Ge~~~i~G~nGsGKSTLl~~l~Gl   51 (239)
T cd03296          28 GELVALLGPSGSGKTTLLRLIAGL   51 (239)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            468899999999999999998763


No 316
>PRK14974 cell division protein FtsY; Provisional
Probab=94.47  E-value=0.04  Score=45.48  Aligned_cols=24  Identities=21%  Similarity=0.163  Sum_probs=20.6

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...++.++|..|+||||++..+..
T Consensus       139 ~~~vi~~~G~~GvGKTTtiakLA~  162 (336)
T PRK14974        139 KPVVIVFVGVNGTGKTTTIAKLAY  162 (336)
T ss_pred             CCeEEEEEcCCCCCHHHHHHHHHH
Confidence            368999999999999997777765


No 317
>PRK09354 recA recombinase A; Provisional
Probab=94.46  E-value=0.11  Score=43.07  Aligned_cols=46  Identities=22%  Similarity=0.166  Sum_probs=31.4

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCH
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDP   59 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~   59 (156)
                      -+.-+++-|+|.+|+|||||+.++...  ....=...+|+...+.++.
T Consensus        57 ip~G~IteI~G~~GsGKTtLal~~~~~--~~~~G~~~~yId~E~s~~~  102 (349)
T PRK09354         57 LPRGRIVEIYGPESSGKTTLALHAIAE--AQKAGGTAAFIDAEHALDP  102 (349)
T ss_pred             CcCCeEEEEECCCCCCHHHHHHHHHHH--HHHcCCcEEEECCccchHH
Confidence            345678889999999999999987652  2222234667665555544


No 318
>PRK15455 PrkA family serine protein kinase; Provisional
Probab=94.46  E-value=0.049  Score=48.20  Aligned_cols=26  Identities=12%  Similarity=0.268  Sum_probs=23.0

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...-+++-++|.+|+||||||+.+..
T Consensus       100 ~~~~~IL~LvGPpG~GKSsLa~~la~  125 (644)
T PRK15455        100 EEKKQILYLLGPVGGGKSSLAERLKS  125 (644)
T ss_pred             CCCCceEEEecCCCCCchHHHHHHHH
Confidence            44567999999999999999999977


No 319
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=94.46  E-value=0.04  Score=42.01  Aligned_cols=23  Identities=26%  Similarity=0.291  Sum_probs=20.8

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||++.+..
T Consensus        26 Ge~~~i~G~nGsGKSTLl~~l~G   48 (222)
T cd03224          26 GEIVALLGRNGAGKTTLLKTIMG   48 (222)
T ss_pred             CeEEEEECCCCCCHHHHHHHHhC
Confidence            46899999999999999999876


No 320
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.
Probab=94.46  E-value=0.037  Score=42.18  Aligned_cols=24  Identities=25%  Similarity=0.156  Sum_probs=21.3

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||.+.++..
T Consensus        31 G~~~~i~G~nGsGKSTLl~~i~G~   54 (221)
T TIGR02211        31 GEIVAIVGSSGSGKSTLLHLLGGL   54 (221)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            458899999999999999999773


No 321
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily.  Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases.  Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS).  Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions.  Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=94.46  E-value=0.036  Score=40.36  Aligned_cols=21  Identities=10%  Similarity=0.041  Sum_probs=18.6

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.++|.+|+|||||+..+.+.
T Consensus         2 i~~~G~~~~GKTsl~~~l~~~   22 (167)
T cd04161           2 LLTVGLDNAGKTTLVSALQGE   22 (167)
T ss_pred             EEEECCCCCCHHHHHHHHhCC
Confidence            678999999999999988664


No 322
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=94.46  E-value=0.038  Score=41.72  Aligned_cols=24  Identities=17%  Similarity=0.134  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||.+.++.-
T Consensus        26 Ge~~~i~G~nGsGKSTLl~~l~Gl   49 (205)
T cd03226          26 GEIIALTGKNGAGKTTLAKILAGL   49 (205)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcC
Confidence            468899999999999999999873


No 323
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily.  Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice.  This isoform is associated with membrane ruffles and promotes macropinosome formation.  Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further re
Probab=94.45  E-value=0.049  Score=39.88  Aligned_cols=21  Identities=14%  Similarity=0.309  Sum_probs=18.9

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.++|-+|+|||+|++.+.++
T Consensus         3 i~ivG~~~vGKTsli~~~~~~   23 (170)
T cd04108           3 VIVVGDLSVGKTCLINRFCKD   23 (170)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            679999999999999998775


No 324
>TIGR01351 adk adenylate kinases. Adenylate kinase (EC 2.7.4.3) converts ATP + AMP to ADP + ADP, that is, uses ATP as a phosphate donor for AMP. Most members of this family are known or believed to be adenylate kinase. However, some members accept other nucleotide triphosphates as donors, may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (EC 2.7.4.10) is a GTP:AMP phosphotransferase. This family is designated subfamily rather than equivalog for this reason.
Probab=94.45  E-value=0.034  Score=42.37  Aligned_cols=20  Identities=15%  Similarity=0.165  Sum_probs=18.2

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |-|.|.+|+||||+|+.+..
T Consensus         2 I~i~G~pGsGKsT~a~~La~   21 (210)
T TIGR01351         2 LVLLGPPGSGKGTQAKRIAE   21 (210)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            67899999999999999876


No 325
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.44  E-value=0.034  Score=42.12  Aligned_cols=21  Identities=19%  Similarity=0.200  Sum_probs=20.0

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +++|+|..|.|||||++.++.
T Consensus        27 ~~~i~G~nGsGKSTLl~~l~G   47 (211)
T cd03264          27 MYGLLGPNGAGKTTLMRILAT   47 (211)
T ss_pred             cEEEECCCCCCHHHHHHHHhC
Confidence            889999999999999999986


No 326
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=94.43  E-value=0.039  Score=41.56  Aligned_cols=23  Identities=17%  Similarity=0.056  Sum_probs=20.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||.+.+..
T Consensus        24 Ge~~~i~G~nGsGKSTLl~~l~G   46 (206)
T TIGR03608        24 GKMYAIIGESGSGKSTLLNIIGL   46 (206)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhc
Confidence            35789999999999999999987


No 327
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=94.43  E-value=0.04  Score=41.31  Aligned_cols=23  Identities=22%  Similarity=0.141  Sum_probs=21.0

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||.+.+..
T Consensus        25 Ge~~~l~G~nGsGKSTLl~~l~G   47 (177)
T cd03222          25 GEVIGIVGPNGTGKTTAVKILAG   47 (177)
T ss_pred             CCEEEEECCCCChHHHHHHHHHc
Confidence            46899999999999999999977


No 328
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional
Probab=94.43  E-value=0.073  Score=45.33  Aligned_cols=23  Identities=26%  Similarity=0.183  Sum_probs=20.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..++.++|.+|+||||++.++..
T Consensus       223 ~~vi~lvGptGvGKTTtaaKLA~  245 (432)
T PRK12724        223 RKVVFFVGPTGSGKTTSIAKLAA  245 (432)
T ss_pred             CeEEEEECCCCCCHHHHHHHHHH
Confidence            46899999999999999998875


No 329
>PRK00279 adk adenylate kinase; Reviewed
Probab=94.42  E-value=0.034  Score=42.47  Aligned_cols=20  Identities=15%  Similarity=0.094  Sum_probs=18.4

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |.|.|.+|+||||+|+.+..
T Consensus         3 I~v~G~pGsGKsT~a~~la~   22 (215)
T PRK00279          3 LILLGPPGAGKGTQAKFIAE   22 (215)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            78899999999999999876


No 330
>PF08433 KTI12:  Chromatin associated protein KTI12 ;  InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II []. The Elongator complex has histone acetyltransferase activity. ; PDB: 3ADB_B 3ADC_B 3A4M_B 3A4N_B 3AM1_A 3A4L_B 3ADD_A.
Probab=94.42  E-value=0.036  Score=44.39  Aligned_cols=22  Identities=14%  Similarity=0.027  Sum_probs=17.4

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..|-|+|.+|+||||+|+++..
T Consensus         2 pLiil~G~P~SGKTt~a~~L~~   23 (270)
T PF08433_consen    2 PLIILCGLPCSGKTTRAKELKK   23 (270)
T ss_dssp             -EEEEE--TTSSHHHHHHHHHH
T ss_pred             EEEEEEcCCCCcHHHHHHHHHH
Confidence            4678999999999999999977


No 331
>PRK14088 dnaA chromosomal replication initiation protein; Provisional
Probab=94.41  E-value=0.12  Score=44.20  Aligned_cols=36  Identities=25%  Similarity=0.347  Sum_probs=26.8

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccC-c-eEEEEE
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYF-D-YLAWIP   52 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F-~-~~~wv~   52 (156)
                      ..-+-|+|..|+|||+|++.+.+  .+.... + ...|++
T Consensus       130 ~n~l~lyG~~G~GKTHLl~ai~~--~l~~~~~~~~v~yi~  167 (440)
T PRK14088        130 YNPLFIYGGVGLGKTHLLQSIGN--YVVQNEPDLRVMYIT  167 (440)
T ss_pred             CCeEEEEcCCCCcHHHHHHHHHH--HHHHhCCCCeEEEEE
Confidence            45689999999999999999998  444332 2 255554


No 332
>cd04175 Rap1 Rap1 subgroup.  The Rap1 subgroup is part of the Rap subfamily of the Ras family.  It can be further divided into the Rap1a and Rap1b isoforms.  In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively.  Rap1a is sometimes called smg p21 or Krev1 in the older literature.  Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds.  For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.  High expression of Rap1 has been observed in the n
Probab=94.40  E-value=0.045  Score=39.27  Aligned_cols=22  Identities=27%  Similarity=0.376  Sum_probs=18.5

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .|.++|.+|+|||||+..+.++
T Consensus         3 ki~~~G~~~~GKTsli~~~~~~   24 (164)
T cd04175           3 KLVVLGSGGVGKSALTVQFVQG   24 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHhC
Confidence            3689999999999998887653


No 333
>cd01868 Rab11_like Rab11-like.  Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP
Probab=94.40  E-value=0.052  Score=38.91  Aligned_cols=24  Identities=8%  Similarity=0.216  Sum_probs=20.2

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      --+.++|.+|+|||||..++..+.
T Consensus         4 ~ki~vvG~~~~GKSsli~~l~~~~   27 (165)
T cd01868           4 FKIVLIGDSGVGKSNLLSRFTRNE   27 (165)
T ss_pred             eEEEEECCCCCCHHHHHHHHhcCC
Confidence            357899999999999999987643


No 334
>TIGR00101 ureG urease accessory protein UreG. This model represents UreG, a GTP hydrolase that acts in the assembly of the nickel metallocenter of urease. It is found only in urease-positive species, although some urease-positive species (e.g. Bacillus subtilis) lack this protein. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel.
Probab=94.39  E-value=0.054  Score=41.26  Aligned_cols=21  Identities=19%  Similarity=0.298  Sum_probs=19.5

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .++|.|..|.|||||.+.+.+
T Consensus         3 ~i~i~G~~GsGKTTll~~l~~   23 (199)
T TIGR00101         3 KIGVAGPVGSGKTALIEALTR   23 (199)
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            578999999999999999987


No 335
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=94.39  E-value=0.04  Score=41.69  Aligned_cols=24  Identities=21%  Similarity=0.062  Sum_probs=21.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||.+.+...
T Consensus        27 Ge~~~l~G~nGsGKSTLl~~l~G~   50 (204)
T PRK13538         27 GELVQIEGPNGAGKTSLLRILAGL   50 (204)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            458899999999999999999873


No 336
>PRK13973 thymidylate kinase; Provisional
Probab=94.39  E-value=0.15  Score=39.06  Aligned_cols=22  Identities=9%  Similarity=0.022  Sum_probs=20.4

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..|.|-|..|+||||+++.+++
T Consensus         4 ~~IviEG~dGsGKtTq~~~l~~   25 (213)
T PRK13973          4 RFITFEGGEGAGKSTQIRLLAE   25 (213)
T ss_pred             eEEEEEcCCCCCHHHHHHHHHH
Confidence            5788999999999999999988


No 337
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed
Probab=94.39  E-value=0.061  Score=43.71  Aligned_cols=25  Identities=12%  Similarity=0.133  Sum_probs=22.0

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..-..|.++|+.|.||||+++.+..
T Consensus       131 ~~~~~I~l~G~~GsGKStvg~~La~  155 (309)
T PRK08154        131 ARRRRIALIGLRGAGKSTLGRMLAA  155 (309)
T ss_pred             cCCCEEEEECCCCCCHHHHHHHHHH
Confidence            4456899999999999999999977


No 338
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=94.39  E-value=0.049  Score=39.18  Aligned_cols=24  Identities=17%  Similarity=0.264  Sum_probs=20.7

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ....+.++|.+|+|||||...+..
T Consensus         6 ~~~~v~v~G~~~~GKSsli~~l~~   29 (169)
T cd04114           6 FLFKIVLIGNAGVGKTCLVRRFTQ   29 (169)
T ss_pred             ceeEEEEECCCCCCHHHHHHHHHh
Confidence            357789999999999999998864


No 339
>PF00158 Sigma54_activat:  Sigma-54 interaction domain;  InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor. These have a conserved domain of about 230 residues involved in the ATP-dependent [, ] interaction with sigma-54. About half of the proteins in which this domain is found (algB, dcdT, flbD, hoxA, hupR1, hydG, ntrC, pgtA and pilR) belong to signal transduction two-component systems [] and possess a domain that can be phosphorylated by a sensor-kinase protein in their N-terminal section. Almost all of these proteins possess a helix-turn-helix DNA-binding domain in their C-terminal section. The domain which interacts with the sigma-54 factor has an ATPase activity. This may be required to promote a conformational change necessary for the interaction []. The domain contains an atypical ATP-binding motif A (P-loop) as well as a form of motif B. The two ATP-binding motifs are located in the N-terminal section of the domain.; GO: 0005524 ATP binding, 0008134 transcription factor binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1NY6_K 3M0E_G 1NY5_A 1OJL_A 3DZD_B 2C9C_A 2C98_A 2C96_A 2BJV_A 2C99_A ....
Probab=94.38  E-value=0.19  Score=37.31  Aligned_cols=23  Identities=22%  Similarity=0.172  Sum_probs=19.6

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .-|-|+|-.|+||+.+|+.+++.
T Consensus        23 ~pVlI~GE~GtGK~~lA~~IH~~   45 (168)
T PF00158_consen   23 LPVLITGETGTGKELLARAIHNN   45 (168)
T ss_dssp             S-EEEECSTTSSHHHHHHHHHHC
T ss_pred             CCEEEEcCCCCcHHHHHHHHHHh
Confidence            44559999999999999999993


No 340
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=94.38  E-value=0.04  Score=42.48  Aligned_cols=24  Identities=21%  Similarity=0.111  Sum_probs=21.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.++.-
T Consensus        35 Ge~~~l~G~nGsGKSTLl~~l~Gl   58 (233)
T PRK11629         35 GEMMAIVGSSGSGKSTLLHLLGGL   58 (233)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhcC
Confidence            357899999999999999999763


No 341
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH). CODH from Rhodospirillum rubrum catalyzes the reversible oxidation of CO to CO2. CODH contains a nickel-iron-sulfur cluster (C-center) and an iron-sulfur cluster (B-center). CO oxidation occurs at the C-center. Three accessory proteins encoded by cooCTJ genes are involved in nickel incorporation into a nickel site. CooC functions as a nickel insertase that mobilizes nickel to apoCODH using energy released from ATP hydrolysis. CooC is a homodimer and has NTPase activities. Mutation at the P-loop abolishs its function.
Probab=94.37  E-value=0.04  Score=38.45  Aligned_cols=20  Identities=30%  Similarity=0.282  Sum_probs=18.4

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      +.+.|.||+||||++..+..
T Consensus         2 i~~~GkgG~GKTt~a~~la~   21 (116)
T cd02034           2 IAITGKGGVGKTTIAALLAR   21 (116)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            67899999999999999877


No 342
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]
Probab=94.37  E-value=0.086  Score=40.37  Aligned_cols=31  Identities=16%  Similarity=0.233  Sum_probs=25.7

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCce
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDY   47 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~   47 (156)
                      ...|.+-|..|+|||+|..+...  ..++.|..
T Consensus        13 ~~~i~v~Gp~GSGKTaLie~~~~--~L~~~~~~   43 (202)
T COG0378          13 MLRIGVGGPPGSGKTALIEKTLR--ALKDEYKI   43 (202)
T ss_pred             eEEEEecCCCCcCHHHHHHHHHH--HHHhhCCe
Confidence            57899999999999999999888  55555554


No 343
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=94.37  E-value=0.042  Score=41.66  Aligned_cols=24  Identities=21%  Similarity=0.080  Sum_probs=21.2

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|.|..|.|||||++.+...
T Consensus        26 Ge~~~l~G~nGsGKSTLl~~l~G~   49 (213)
T cd03301          26 GEFVVLLGPSGCGKTTTLRMIAGL   49 (213)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            457899999999999999999874


No 344
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.36  E-value=0.041  Score=42.34  Aligned_cols=24  Identities=13%  Similarity=0.129  Sum_probs=21.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+..-
T Consensus        31 Ge~~~l~G~nGsGKSTLl~~l~G~   54 (233)
T cd03258          31 GEIFGIIGRSGAGKSTLIRCINGL   54 (233)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            468899999999999999998763


No 345
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily.  This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins.  Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation.  Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state.  GDP/GTP exchange exposes the helix, which anchors to the membrane.  Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein.  A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site.  Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned.  Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI.  It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins.  Humans, but not rodents
Probab=94.36  E-value=0.038  Score=39.96  Aligned_cols=20  Identities=10%  Similarity=-0.022  Sum_probs=17.7

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |.++|.+|+|||||+..+..
T Consensus         3 v~~~G~~~~GKTsli~~l~~   22 (159)
T cd04150           3 ILMVGLDAAGKTTILYKLKL   22 (159)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            67899999999999999844


No 346
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=94.36  E-value=0.042  Score=39.16  Aligned_cols=22  Identities=14%  Similarity=0.104  Sum_probs=19.1

Q ss_pred             EEEEcCCCccHHHHHHHHhccc
Q 035574           18 VAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      |.++|.+|+|||||+..+....
T Consensus         2 i~i~G~~~~GKTsl~~~~~~~~   23 (160)
T cd04156           2 VLLLGLDSAGKSTLLYKLKHAE   23 (160)
T ss_pred             EEEEcCCCCCHHHHHHHHhcCC
Confidence            6789999999999999987653


No 347
>TIGR00764 lon_rel lon-related putative ATP-dependent protease. Members of this family from Pyrococcus horikoshii and Pyrococcus abyssi each contain a predicted intein.
Probab=94.36  E-value=0.099  Score=46.46  Aligned_cols=52  Identities=12%  Similarity=0.071  Sum_probs=34.1

Q ss_pred             EEEEEcCCCccHHHHHHHHhcccccccc-CceEEEEEcCCCCCHHHHHHHHHHHhC
Q 035574           17 VVAILDSIGLDKTAFTAEAYNSSYMKHY-FDYLAWIPAPYHYDPDQILDIVAVILL   71 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~~~v~~~-F~~~~wv~vs~~~~~~~l~~~il~~l~   71 (156)
                      -+-++|.+|+||||+++.+.+  .+... |...+++..+ ..+..++++.++..++
T Consensus        39 ~~ll~G~pG~GKT~la~~la~--~l~~~~~~~~~~~~n~-~~~~~~~~~~v~~~~g   91 (608)
T TIGR00764        39 NVLLIGEPGVGKSMLAKAMAE--LLPDEELEDILVYPNP-EDPNMPRIVEVPAGEG   91 (608)
T ss_pred             CEEEECCCCCCHHHHHHHHHH--HcCchhheeEEEEeCC-CCCchHHHHHHHHhhc
Confidence            344899999999999999987  55433 3444444333 2345556777766654


No 348
>PRK06851 hypothetical protein; Provisional
Probab=94.35  E-value=0.061  Score=44.96  Aligned_cols=45  Identities=9%  Similarity=-0.015  Sum_probs=34.0

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcccccc-ccCceEEEEEcCCCCCHH
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNSSYMK-HYFDYLAWIPAPYHYDPD   60 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~~~v~-~~F~~~~wv~vs~~~~~~   60 (156)
                      .-+++-|.|.+|+|||||++.+.+  ... ..|+...+.|-+.+.+++
T Consensus        29 ~~~~~il~G~pGtGKStl~~~i~~--~~~~~g~~Ve~~~~~~d~~slD   74 (367)
T PRK06851         29 ANRIFILKGGPGTGKSTLMKKIGE--EFLEKGYDVEFLHCSSDNDSLD   74 (367)
T ss_pred             cceEEEEECCCCCCHHHHHHHHHH--HHHHcCCeEEEEEcCCCCCcee
Confidence            357889999999999999999988  442 357776777766665544


No 349
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional
Probab=94.35  E-value=0.37  Score=41.97  Aligned_cols=23  Identities=13%  Similarity=0.089  Sum_probs=18.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+=++|..|+||||+|+.+..
T Consensus        38 ~ha~Lf~Gp~G~GKTt~A~~lAk   60 (509)
T PRK14958         38 HHAYLFTGTRGVGKTTISRILAK   60 (509)
T ss_pred             CeeEEEECCCCCCHHHHHHHHHH
Confidence            34567899999999999987765


No 350
>PRK02496 adk adenylate kinase; Provisional
Probab=94.35  E-value=0.045  Score=40.60  Aligned_cols=21  Identities=14%  Similarity=0.063  Sum_probs=18.6

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .+.|.|.+|.||||+|+.+..
T Consensus         3 ~i~i~G~pGsGKst~a~~la~   23 (184)
T PRK02496          3 RLIFLGPPGAGKGTQAVVLAE   23 (184)
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            377899999999999999866


No 351
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional
Probab=94.34  E-value=0.043  Score=42.93  Aligned_cols=23  Identities=9%  Similarity=0.211  Sum_probs=20.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +++++|+|..|+|||||+..+..
T Consensus         1 m~vi~ivG~~gsGKTtl~~~l~~   23 (229)
T PRK14494          1 MRAIGVIGFKDSGKTTLIEKILK   23 (229)
T ss_pred             CeEEEEECCCCChHHHHHHHHHH
Confidence            36899999999999999887765


No 352
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=94.34  E-value=0.051  Score=46.21  Aligned_cols=23  Identities=30%  Similarity=0.304  Sum_probs=19.6

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .+++.++|.+|+||||++..+..
T Consensus       221 ~~~i~~vGptGvGKTTt~~kLA~  243 (424)
T PRK05703        221 GGVVALVGPTGVGKTTTLAKLAA  243 (424)
T ss_pred             CcEEEEECCCCCCHHHHHHHHHH
Confidence            46899999999999998777655


No 353
>cd01865 Rab3 Rab3 subfamily.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D.  All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression.  Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules.  Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot
Probab=94.33  E-value=0.044  Score=39.58  Aligned_cols=23  Identities=22%  Similarity=0.267  Sum_probs=19.7

Q ss_pred             EEEEEcCCCccHHHHHHHHhccc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      -|.++|.+|+|||||...+.++.
T Consensus         3 ki~i~G~~~~GKSsli~~l~~~~   25 (165)
T cd01865           3 KLLIIGNSSVGKTSFLFRYADDS   25 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            37899999999999999987654


No 354
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=94.32  E-value=0.042  Score=42.01  Aligned_cols=24  Identities=8%  Similarity=0.149  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||.+.+...
T Consensus        31 Ge~~~i~G~nGsGKSTLl~~l~G~   54 (228)
T cd03257          31 GETLGLVGESGSGKSTLARAILGL   54 (228)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            468999999999999999999763


No 355
>PHA02544 44 clamp loader, small subunit; Provisional
Probab=94.31  E-value=0.062  Score=43.19  Aligned_cols=23  Identities=22%  Similarity=0.140  Sum_probs=20.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..++-++|.+|+|||++|+.+++
T Consensus        43 ~~~lll~G~~G~GKT~la~~l~~   65 (316)
T PHA02544         43 PNMLLHSPSPGTGKTTVAKALCN   65 (316)
T ss_pred             CeEEEeeCcCCCCHHHHHHHHHH
Confidence            46777799999999999999988


No 356
>PRK14528 adenylate kinase; Provisional
Probab=94.30  E-value=0.043  Score=41.17  Aligned_cols=22  Identities=9%  Similarity=0.066  Sum_probs=19.4

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +.|.|.|.+|+||||+|+.+..
T Consensus         2 ~~i~i~G~pGsGKtt~a~~la~   23 (186)
T PRK14528          2 KNIIFMGPPGAGKGTQAKILCE   23 (186)
T ss_pred             cEEEEECCCCCCHHHHHHHHHH
Confidence            4578999999999999999865


No 357
>cd01866 Rab2 Rab2 subfamily.  Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur
Probab=94.30  E-value=0.042  Score=39.84  Aligned_cols=23  Identities=13%  Similarity=0.196  Sum_probs=20.1

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      --+.|+|.+|+|||||...+.+.
T Consensus         5 ~ki~vvG~~~vGKSsLl~~l~~~   27 (168)
T cd01866           5 FKYIIIGDTGVGKSCLLLQFTDK   27 (168)
T ss_pred             eEEEEECCCCCCHHHHHHHHHcC
Confidence            45789999999999999998764


No 358
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]
Probab=94.30  E-value=0.041  Score=43.80  Aligned_cols=24  Identities=17%  Similarity=0.152  Sum_probs=21.5

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .-.+++|+|..|.|||||.+.++.
T Consensus        27 ~G~i~~iiGpNG~GKSTLLk~l~g   50 (258)
T COG1120          27 KGEITGILGPNGSGKSTLLKCLAG   50 (258)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhc
Confidence            357899999999999999999877


No 359
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily.  This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells.  It interacts with some of the known Ras effectors, but appears to also have its own effectors.  Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts.  Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum.  In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras.  TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali
Probab=94.30  E-value=0.05  Score=38.78  Aligned_cols=22  Identities=23%  Similarity=0.335  Sum_probs=18.5

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -|.++|-+|+|||||+..+.++
T Consensus         4 ki~i~G~~~~GKtsl~~~~~~~   25 (164)
T cd04145           4 KLVVVGGGGVGKSALTIQFIQS   25 (164)
T ss_pred             EEEEECCCCCcHHHHHHHHHhC
Confidence            4789999999999999886543


No 360
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism]
Probab=94.29  E-value=0.12  Score=39.88  Aligned_cols=36  Identities=11%  Similarity=-0.115  Sum_probs=27.0

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEE
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIP   52 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~   52 (156)
                      ...|+|-|+-|.||||.++.++.  +.+...-.++|..
T Consensus         3 g~fI~iEGiDGaGKTT~~~~L~~--~l~~~g~~v~~tr   38 (208)
T COG0125           3 GMFIVIEGIDGAGKTTQAELLKE--RLEERGIKVVLTR   38 (208)
T ss_pred             ceEEEEECCCCCCHHHHHHHHHH--HHHHcCCeEEEEe
Confidence            35689999999999999999999  6555433444443


No 361
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D. This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.
Probab=94.28  E-value=0.044  Score=42.34  Aligned_cols=24  Identities=8%  Similarity=0.106  Sum_probs=21.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+..-
T Consensus        11 Ge~~~i~G~nGsGKSTLl~~l~Gl   34 (230)
T TIGR01184        11 GEFISLIGHSGCGKSTLLNLISGL   34 (230)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            358899999999999999998763


No 362
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated
Probab=94.28  E-value=0.066  Score=47.18  Aligned_cols=25  Identities=16%  Similarity=0.016  Sum_probs=21.8

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..-.+|-++|+.|.||||+|+.++.
T Consensus       390 ~~g~~Ivl~Gl~GSGKSTia~~La~  414 (568)
T PRK05537        390 KQGFTVFFTGLSGAGKSTIAKALMV  414 (568)
T ss_pred             CCCeEEEEECCCCChHHHHHHHHHH
Confidence            3445889999999999999999987


No 363
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional
Probab=94.28  E-value=0.042  Score=42.06  Aligned_cols=24  Identities=25%  Similarity=0.206  Sum_probs=21.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||.+.++.-
T Consensus        13 Ge~~~l~G~NGsGKSTLlk~i~Gl   36 (213)
T PRK15177         13 HEHIGILAAPGSGKTTLTRLLCGL   36 (213)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            468999999999999999999873


No 364
>cd04118 Rab24 Rab24 subfamily.  Rab24 is distinct from other Rabs in several ways.  It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments.  It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita
Probab=94.27  E-value=0.044  Score=40.63  Aligned_cols=21  Identities=19%  Similarity=0.267  Sum_probs=18.7

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.|+|.+|+|||||...+.++
T Consensus         3 i~vvG~~~vGKSsLi~~~~~~   23 (193)
T cd04118           3 VVMLGKESVGKTSLVERYVHH   23 (193)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            689999999999999988764


No 365
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=94.27  E-value=0.043  Score=43.06  Aligned_cols=24  Identities=29%  Similarity=0.371  Sum_probs=21.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+...
T Consensus        25 Ge~~~i~G~NGsGKSTLlk~L~G~   48 (246)
T cd03237          25 SEVIGILGPNGIGKTTFIKMLAGV   48 (246)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            468999999999999999999774


No 366
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily.  Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II.  Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells.  In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine 
Probab=94.27  E-value=0.045  Score=39.79  Aligned_cols=23  Identities=13%  Similarity=0.161  Sum_probs=19.6

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .-|.++|.+|+|||||...+...
T Consensus         3 ~ki~vvG~~~vGKTsli~~~~~~   25 (170)
T cd04115           3 FKIIVIGDSNVGKTCLTYRFCAG   25 (170)
T ss_pred             eEEEEECCCCCCHHHHHHHHHhC
Confidence            35789999999999999988654


No 367
>cd04158 ARD1 ARD1 subfamily.  ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family.  In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif.  This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family.  Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity.  However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain.  The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs.  The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain.  ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=94.27  E-value=0.043  Score=39.95  Aligned_cols=21  Identities=24%  Similarity=0.151  Sum_probs=18.6

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.++|.+|+|||||+..+.++
T Consensus         2 vvlvG~~~~GKTsl~~~l~~~   22 (169)
T cd04158           2 VVTLGLDGAGKTTILFKLKQD   22 (169)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            569999999999999988764


No 368
>PTZ00369 Ras-like protein; Provisional
Probab=94.27  E-value=0.051  Score=40.42  Aligned_cols=22  Identities=18%  Similarity=0.315  Sum_probs=18.7

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -|.|+|-+|+|||||+..+.++
T Consensus         7 Ki~iiG~~~~GKTsLi~~~~~~   28 (189)
T PTZ00369          7 KLVVVGGGGVGKSALTIQFIQN   28 (189)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            4668999999999999887764


No 369
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional
Probab=94.27  E-value=0.048  Score=44.06  Aligned_cols=23  Identities=13%  Similarity=0.104  Sum_probs=20.6

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHh
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAY   36 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy   36 (156)
                      ...+|.|.|+.|.||||+++.+.
T Consensus         5 ~~~~i~i~G~~GsGKtt~~~~l~   27 (288)
T PRK05416          5 PMRLVIVTGLSGAGKSVALRALE   27 (288)
T ss_pred             CceEEEEECCCCCcHHHHHHHHH
Confidence            35789999999999999999984


No 370
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional
Probab=94.26  E-value=0.052  Score=47.17  Aligned_cols=24  Identities=13%  Similarity=-0.054  Sum_probs=20.2

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ...+-++|.+|+||||+|+.+...
T Consensus        36 ~ha~Lf~GppGtGKTTlA~~lA~~   59 (504)
T PRK14963         36 GHAYLFSGPRGVGKTTTARLIAMA   59 (504)
T ss_pred             CeEEEEECCCCCCHHHHHHHHHHH
Confidence            356689999999999999988763


No 371
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=94.26  E-value=0.042  Score=42.34  Aligned_cols=23  Identities=13%  Similarity=0.102  Sum_probs=20.8

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||++.+..
T Consensus        26 Ge~~~l~G~nGsGKSTLl~~l~G   48 (236)
T cd03219          26 GEIHGLIGPNGAGKTTLFNLISG   48 (236)
T ss_pred             CcEEEEECCCCCCHHHHHHHHcC
Confidence            46889999999999999999876


No 372
>PLN02165 adenylate isopentenyltransferase
Probab=94.25  E-value=0.046  Score=45.11  Aligned_cols=25  Identities=20%  Similarity=0.319  Sum_probs=21.3

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .-.++.|+|+.|+|||+||..+...
T Consensus        42 ~g~iivIiGPTGSGKStLA~~LA~~   66 (334)
T PLN02165         42 KDKVVVIMGATGSGKSRLSVDLATR   66 (334)
T ss_pred             CCCEEEEECCCCCcHHHHHHHHHHH
Confidence            3458999999999999999987663


No 373
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=94.24  E-value=0.043  Score=41.11  Aligned_cols=24  Identities=17%  Similarity=0.184  Sum_probs=20.7

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .-.++.|+|..|.|||||.+.+..
T Consensus        20 ~G~~~~l~G~nG~GKSTLl~~il~   43 (176)
T cd03238          20 LNVLVVVTGVSGSGKSTLVNEGLY   43 (176)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhh
Confidence            346889999999999999998863


No 374
>PHA02518 ParA-like protein; Provisional
Probab=94.24  E-value=0.043  Score=41.18  Aligned_cols=21  Identities=24%  Similarity=0.398  Sum_probs=16.4

Q ss_pred             EEEEEc-CCCccHHHHHHHHhc
Q 035574           17 VVAILD-SIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G-~gGvGKTtLa~~vy~   37 (156)
                      +|+|++ -||+||||+|.++..
T Consensus         2 ii~v~~~KGGvGKTT~a~~la~   23 (211)
T PHA02518          2 IIAVLNQKGGAGKTTVATNLAS   23 (211)
T ss_pred             EEEEEcCCCCCCHHHHHHHHHH
Confidence            677774 588999999887644


No 375
>PRK13531 regulatory ATPase RavA; Provisional
Probab=94.23  E-value=0.048  Score=47.19  Aligned_cols=36  Identities=14%  Similarity=0.116  Sum_probs=24.7

Q ss_pred             HHHHHHHhcCCCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574            2 EELLDLLIEGPTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus         2 ~~l~~~L~~~~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +++++.+..--..-.-+-+.|.+|+|||+||+.+..
T Consensus        26 e~vI~lll~aalag~hVLL~GpPGTGKT~LAraLa~   61 (498)
T PRK13531         26 SHAIRLCLLAALSGESVFLLGPPGIAKSLIARRLKF   61 (498)
T ss_pred             HHHHHHHHHHHccCCCEEEECCCChhHHHHHHHHHH
Confidence            444444433212234467899999999999999987


No 376
>PRK04328 hypothetical protein; Provisional
Probab=94.23  E-value=0.23  Score=39.06  Aligned_cols=50  Identities=14%  Similarity=0.097  Sum_probs=33.5

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHH
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDI   65 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~   65 (156)
                      -..-.++-|.|.+|.|||+|+.++... ..+. =+..+|++..+  ++.++.+.
T Consensus        20 ip~gs~ili~G~pGsGKT~l~~~fl~~-~~~~-ge~~lyis~ee--~~~~i~~~   69 (249)
T PRK04328         20 IPERNVVLLSGGPGTGKSIFSQQFLWN-GLQM-GEPGVYVALEE--HPVQVRRN   69 (249)
T ss_pred             CcCCcEEEEEcCCCCCHHHHHHHHHHH-HHhc-CCcEEEEEeeC--CHHHHHHH
Confidence            345678899999999999999986542 2222 34577777655  44444443


No 377
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK). Members of this family have been identified as one of the subunits of NADH:Ubiquinone oxioreductase (complex I), a multi-protein complex located in the inner mitochondrial membrane. The main function of the complex is to transport electrons from NADH to ubiquinone, which is accompanied by the translocation of protons from the mitochondrial matrix to the inter membrane space.
Probab=94.23  E-value=0.036  Score=42.67  Aligned_cols=21  Identities=19%  Similarity=0.235  Sum_probs=19.1

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|+|-|+-|+||||+++.+.+
T Consensus         1 ~I~iEG~~GsGKSTl~~~L~~   21 (219)
T cd02030           1 VITVDGNIASGKGKLAKELAE   21 (219)
T ss_pred             CEEEEcCCCCCHHHHHHHHHH
Confidence            478999999999999999876


No 378
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase).
Probab=94.23  E-value=0.069  Score=43.68  Aligned_cols=37  Identities=19%  Similarity=0.275  Sum_probs=27.8

Q ss_pred             HHHHHH---hcCCCCcEEEEEEcCCCccHHHHHHHHhccc
Q 035574            3 ELLDLL---IEGPTQLSVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus         3 ~l~~~L---~~~~~~~~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      +|++.|   .+.+.+...|.++|.+|+|||++...+....
T Consensus        23 ~l~~~l~~l~~~~~~~~rIllvGktGVGKSSliNsIlG~~   62 (313)
T TIGR00991        23 KLLELLGKLKEEDVSSLTILVMGKGGVGKSSTVNSIIGER   62 (313)
T ss_pred             HHHHHHHhcccccccceEEEEECCCCCCHHHHHHHHhCCC
Confidence            455555   3445556678899999999999999988743


No 379
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=94.23  E-value=0.045  Score=43.06  Aligned_cols=24  Identities=17%  Similarity=0.127  Sum_probs=21.2

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+..-
T Consensus        27 Ge~~~i~G~nGsGKSTLl~~l~Gl   50 (255)
T PRK11248         27 GELLVVLGPSGCGKTTLLNLIAGF   50 (255)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            468899999999999999998763


No 380
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily.  Rab32 and Rab38 are members of the Rab family of small GTPases.  Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=94.23  E-value=0.043  Score=41.21  Aligned_cols=21  Identities=19%  Similarity=0.406  Sum_probs=18.5

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.|+|.+|+|||||+..+.+.
T Consensus         3 ivivG~~~vGKTsli~~l~~~   23 (201)
T cd04107           3 VLVIGDLGVGKTSIIKRYVHG   23 (201)
T ss_pred             EEEECCCCCCHHHHHHHHHcC
Confidence            679999999999999987653


No 381
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=94.22  E-value=0.045  Score=42.04  Aligned_cols=24  Identities=21%  Similarity=0.098  Sum_probs=21.2

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||.+.+..-
T Consensus        26 Ge~~~l~G~nGsGKSTLl~~l~Gl   49 (232)
T cd03218          26 GEIVGLLGPNGAGKTTTFYMIVGL   49 (232)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            468999999999999999998763


No 382
>cd01895 EngA2 EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family.  Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=94.22  E-value=0.052  Score=38.65  Aligned_cols=23  Identities=13%  Similarity=0.219  Sum_probs=20.0

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ..|.++|..|+|||||+..+.+.
T Consensus         3 ~~i~i~G~~~~GKstli~~l~~~   25 (174)
T cd01895           3 IRIAIIGRPNVGKSSLVNALLGE   25 (174)
T ss_pred             cEEEEEcCCCCCHHHHHHHHhCc
Confidence            45899999999999999998664


No 383
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD. This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous.
Probab=94.21  E-value=0.045  Score=42.19  Aligned_cols=24  Identities=17%  Similarity=0.116  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|.|..|.|||||++.++..
T Consensus        12 Ge~~~i~G~nGsGKSTLl~~l~Gl   35 (230)
T TIGR02770        12 GEVLALVGESGSGKSLTCLAILGL   35 (230)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcC
Confidence            468899999999999999998774


No 384
>PRK06851 hypothetical protein; Provisional
Probab=94.21  E-value=0.046  Score=45.67  Aligned_cols=45  Identities=11%  Similarity=-0.008  Sum_probs=35.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHH
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPD   60 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~   60 (156)
                      -+++-|-|.+|+|||||++.++... .+..++..++-|-+.+.+++
T Consensus       214 ~~~~~i~G~pG~GKstl~~~i~~~a-~~~G~~v~~~hC~~dPdslD  258 (367)
T PRK06851        214 KNRYFLKGRPGTGKSTMLKKIAKAA-EERGFDVEVYHCGFDPDSLD  258 (367)
T ss_pred             ceEEEEeCCCCCcHHHHHHHHHHHH-HhCCCeEEEEeCCCCCCCcc
Confidence            4778999999999999999998843 24567887777766665554


No 385
>PF10662 PduV-EutP:  Ethanolamine utilisation - propanediol utilisation;  InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process
Probab=94.21  E-value=0.048  Score=39.66  Aligned_cols=24  Identities=13%  Similarity=0.228  Sum_probs=20.6

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      +.|-++|..|.|||||++.+...+
T Consensus         2 krimliG~~g~GKTTL~q~L~~~~   25 (143)
T PF10662_consen    2 KRIMLIGPSGSGKTTLAQALNGEE   25 (143)
T ss_pred             ceEEEECCCCCCHHHHHHHHcCCC
Confidence            457789999999999999997744


No 386
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=94.19  E-value=0.047  Score=41.95  Aligned_cols=24  Identities=13%  Similarity=-0.009  Sum_probs=21.3

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||.+.+...
T Consensus        33 Ge~~~i~G~nGsGKSTLl~~l~G~   56 (225)
T PRK10247         33 GEFKLITGPSGCGKSTLLKIVASL   56 (225)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcc
Confidence            457899999999999999999874


No 387
>PRK10867 signal recognition particle protein; Provisional
Probab=94.19  E-value=0.11  Score=44.37  Aligned_cols=24  Identities=17%  Similarity=0.203  Sum_probs=19.7

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+|-++|.+|+||||.+..+..
T Consensus        99 ~p~vI~~vG~~GsGKTTtaakLA~  122 (433)
T PRK10867         99 PPTVIMMVGLQGAGKTTTAGKLAK  122 (433)
T ss_pred             CCEEEEEECCCCCcHHHHHHHHHH
Confidence            368999999999999996666544


No 388
>cd01861 Rab6 Rab6 subfamily.  Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate
Probab=94.17  E-value=0.05  Score=38.73  Aligned_cols=22  Identities=14%  Similarity=0.169  Sum_probs=18.8

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -|.++|.+|+|||||...+...
T Consensus         2 ki~liG~~~~GKSsli~~l~~~   23 (161)
T cd01861           2 KLVFLGDQSVGKTSIITRFMYD   23 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHcC
Confidence            3789999999999999887654


No 389
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=94.17  E-value=0.048  Score=41.24  Aligned_cols=23  Identities=17%  Similarity=0.096  Sum_probs=21.0

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.++.|+|..|.|||||.+.+..
T Consensus        26 G~~~~i~G~nGsGKSTLl~~l~G   48 (208)
T cd03268          26 GEIYGFLGPNGAGKTTTMKIILG   48 (208)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhC
Confidence            46889999999999999999976


No 390
>cd04120 Rab12 Rab12 subfamily.  Rab12 was first identified in canine cells, where it was localized to the Golgi complex.  The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported.  More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic
Probab=94.17  E-value=0.046  Score=41.67  Aligned_cols=21  Identities=29%  Similarity=0.387  Sum_probs=18.3

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.++|.+|+|||+|+..+.++
T Consensus         3 vvvlG~~gVGKTSli~r~~~~   23 (202)
T cd04120           3 VIIIGSRGVGKTSLMRRFTDD   23 (202)
T ss_pred             EEEECcCCCCHHHHHHHHHhC
Confidence            678999999999999887664


No 391
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=94.17  E-value=0.088  Score=41.60  Aligned_cols=31  Identities=13%  Similarity=0.177  Sum_probs=25.0

Q ss_pred             hcCCCCcEEEEEEcCCCccHHHHHHHHhccc
Q 035574            9 IEGPTQLSVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus         9 ~~~~~~~~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      .+.....-.|.++|..|+|||||+..+....
T Consensus        25 ~~~~~~~~~IllvG~tGvGKSSliNaLlg~~   55 (249)
T cd01853          25 KEELDFSLTILVLGKTGVGKSSTINSIFGER   55 (249)
T ss_pred             hhhccCCeEEEEECCCCCcHHHHHHHHhCCC
Confidence            3344556678899999999999999998854


No 392
>cd04122 Rab14 Rab14 subfamily.  Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles.  Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments.  Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation.  In addition, Rab14 is believed to play a role in the regulation of phagocytosis.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GT
Probab=94.16  E-value=0.057  Score=38.94  Aligned_cols=22  Identities=14%  Similarity=0.280  Sum_probs=18.8

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -+.++|.+|+|||+|...+.+.
T Consensus         4 ki~iiG~~~vGKTsli~~~~~~   25 (166)
T cd04122           4 KYIIIGDMGVGKSCLLHQFTEK   25 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            3678999999999999988664


No 393
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=94.16  E-value=0.047  Score=42.29  Aligned_cols=24  Identities=13%  Similarity=0.072  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|.|..|.|||||++.++..
T Consensus        28 Ge~~~i~G~nGsGKSTLl~~l~G~   51 (242)
T PRK11124         28 GETLVLLGPSGAGKSSLLRVLNLL   51 (242)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            467899999999999999999764


No 394
>TIGR01978 sufC FeS assembly ATPase SufC. SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.
Probab=94.16  E-value=0.047  Score=42.21  Aligned_cols=24  Identities=17%  Similarity=0.195  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||.+.+...
T Consensus        26 Ge~~~i~G~nGsGKSTLl~~l~Gl   49 (243)
T TIGR01978        26 GEIHAIMGPNGSGKSTLSKTIAGH   49 (243)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            358899999999999999999874


No 395
>PRK10908 cell division protein FtsE; Provisional
Probab=94.15  E-value=0.049  Score=41.66  Aligned_cols=25  Identities=8%  Similarity=0.005  Sum_probs=21.7

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .-.+++|+|..|.|||||.+.+...
T Consensus        27 ~Ge~~~i~G~nGsGKSTLl~~l~G~   51 (222)
T PRK10908         27 PGEMAFLTGHSGAGKSTLLKLICGI   51 (222)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCC
Confidence            3468899999999999999999763


No 396
>PRK12338 hypothetical protein; Provisional
Probab=94.14  E-value=0.051  Score=44.56  Aligned_cols=24  Identities=21%  Similarity=0.279  Sum_probs=21.2

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ..+|.|.|.+|+||||+|+.+...
T Consensus         4 p~ii~i~G~sGsGKST~a~~la~~   27 (319)
T PRK12338          4 PYVILIGSASGIGKSTIASELART   27 (319)
T ss_pred             cEEEEEECCCCCCHHHHHHHHHHH
Confidence            468999999999999999998763


No 397
>cd04110 Rab35 Rab35 subfamily.  Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells.  Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is 
Probab=94.14  E-value=0.046  Score=41.09  Aligned_cols=24  Identities=17%  Similarity=0.259  Sum_probs=20.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .--|.++|.+|+|||||+..+.+.
T Consensus         6 ~~kivvvG~~~vGKTsli~~l~~~   29 (199)
T cd04110           6 LFKLLIIGDSGVGKSSLLLRFADN   29 (199)
T ss_pred             eeEEEEECCCCCCHHHHHHHHhcC
Confidence            445789999999999999988653


No 398
>PF00142 Fer4_NifH:  4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family;  InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family.  Nitrogen fixing bacteria possess a nitrogenase enzyme complex that catalyses the reduction of molecular nitrogen to ammonia [, , ]. The nitrogenase enzyme complex consists of two components:   Component I is nitrogenase MoFe protein or dinitrogenase, which contains 2 molecules each of 2 non-identical subunits. Component II is nitrogenase Fe protein or dinitrogenase reductase, which is a homodimer. The monomer is encoded by the nifH gene [].    Component II has 2 ATP-binding domains and one 4Fe-4S cluster per homodimer: it supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component I for the reduction of molecular nitrogen to ammonia []. There are a number of conserved regions in the sequence of these proteins: in the N-terminal section there is an ATP-binding site motif 'A' (P-loop) IPR001687 from INTERPRO and in the central section there are two conserved cysteines which have been shown, in nifH, to be the ligands of the 4Fe-4S cluster.  Protochlorophyllide reductase is involved in light-independent chlorophyll biosynthesis. The light-independent reaction uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This enzyme complex is composed of three subunits: ChlL, ChlN and ChlB. ChlL is present as a homodimer, and binds one 4Fe-4S cluster per dimer. The conserved domains, including the ATP-binding motif and the Fe-S binding motif found in the three subunits, are similar to those in nitrogenases []. ; GO: 0005524 ATP binding, 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1CP2_A 2AFI_F 1N2C_F 1FP6_C 2AFK_G 1M34_M 1XD8_A 1NIP_A 1M1Y_N 1G21_H ....
Probab=94.14  E-value=0.053  Score=43.40  Aligned_cols=22  Identities=18%  Similarity=0.231  Sum_probs=19.1

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +.|.|+|-|||||+|.+..+.-
T Consensus         1 r~IAiYGKGGIGKST~~~Nlsa   22 (273)
T PF00142_consen    1 RKIAIYGKGGIGKSTTASNLSA   22 (273)
T ss_dssp             EEEEEEESTTSSHHHHHHHHHH
T ss_pred             CeEEEEcCCCcccChhhhHHHH
Confidence            4689999999999999887755


No 399
>PTZ00035 Rad51 protein; Provisional
Probab=94.14  E-value=0.25  Score=40.80  Aligned_cols=50  Identities=12%  Similarity=0.144  Sum_probs=34.6

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhccccccc----cCceEEEEEcCCCCCHHHH
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMKH----YFDYLAWIPAPYHYDPDQI   62 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~----~F~~~~wv~vs~~~~~~~l   62 (156)
                      ..-.++-|+|..|.|||+|+..++-......    .=...+|+.-...|+.+++
T Consensus       116 ~~G~iteI~G~~GsGKT~l~~~l~~~~qlp~~~gg~~g~vvyIdtE~~f~~eri  169 (337)
T PTZ00035        116 ETGSITELFGEFRTGKTQLCHTLCVTCQLPIEQGGGEGKVLYIDTEGTFRPERI  169 (337)
T ss_pred             CCCeEEEEECCCCCchhHHHHHHHHHhccccccCCCCceEEEEEccCCCCHHHH
Confidence            4567889999999999999998865333211    1123568887777777664


No 400
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily.  Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics.   These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains.  Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42.  Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells.  Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42.  This ternary complex is proposed to have physiological function in processes such as tumorigenesis.  Activated Ric is likely to sign
Probab=94.14  E-value=0.049  Score=39.97  Aligned_cols=21  Identities=24%  Similarity=0.347  Sum_probs=18.0

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -|.|+|.+|+|||||+..+..
T Consensus         4 ki~vvG~~~vGKTsL~~~~~~   24 (172)
T cd04141           4 KIVMLGAGGVGKSAVTMQFIS   24 (172)
T ss_pred             EEEEECCCCCcHHHHHHHHHh
Confidence            368999999999999987754


No 401
>cd04116 Rab9 Rab9 subfamily.  Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47).  Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs.  Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX
Probab=94.14  E-value=0.063  Score=38.75  Aligned_cols=24  Identities=21%  Similarity=0.274  Sum_probs=19.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .--|.++|.+|+|||||+..+.++
T Consensus         5 ~~ki~vvG~~~~GKTsli~~~~~~   28 (170)
T cd04116           5 LLKVILLGDGGVGKSSLMNRYVTN   28 (170)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHcC
Confidence            345788999999999999988653


No 402
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.13  E-value=0.049  Score=42.26  Aligned_cols=24  Identities=13%  Similarity=0.055  Sum_probs=21.0

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.++..
T Consensus        27 Ge~~~i~G~nGsGKSTLl~~l~G~   50 (242)
T cd03295          27 GEFLVLIGPSGSGKTTTMKMINRL   50 (242)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcC
Confidence            357899999999999999998763


No 403
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=94.13  E-value=0.04  Score=46.19  Aligned_cols=24  Identities=17%  Similarity=0.119  Sum_probs=21.1

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..+-+-++|.+|+|||++|+.+++
T Consensus       164 ~p~gvLL~GppGtGKT~lAkaia~  187 (389)
T PRK03992        164 PPKGVLLYGPPGTGKTLLAKAVAH  187 (389)
T ss_pred             CCCceEEECCCCCChHHHHHHHHH
Confidence            345678899999999999999988


No 404
>PF11868 DUF3388:  Protein of unknown function (DUF3388);  InterPro: IPR024514 This domain is found in a family of bacterial proteins that are functionally uncharacterised. Proteins in this family are typically between 261 to 275 amino acids in length and have a N-terminal ACT domain.
Probab=94.13  E-value=0.054  Score=40.34  Aligned_cols=43  Identities=19%  Similarity=0.271  Sum_probs=30.3

Q ss_pred             HHHHHhc--CCCCcEEEEEEcCCCccHHH--HHHHHhccccccccCceEEEEEcCC
Q 035574            4 LLDLLIE--GPTQLSVVAILDSIGLDKTA--FTAEAYNSSYMKHYFDYLAWIPAPY   55 (156)
Q Consensus         4 l~~~L~~--~~~~~~vi~I~G~gGvGKTt--La~~vy~~~~v~~~F~~~~wv~vs~   55 (156)
                      |+++|.+  ...+-++|+|-||+-||||.  .|..||.+         .-|+-+|.
T Consensus        41 LVDFmaEl~K~~Gh~lIGiRGmPRVGKTEsivAasVcAn---------KrW~f~SS   87 (192)
T PF11868_consen   41 LVDFMAELFKEEGHKLIGIRGMPRVGKTESIVAASVCAN---------KRWLFLSS   87 (192)
T ss_pred             HHHHHHHHHHhcCceEEeecCCCccCchhHHHHHhhhcC---------ceEEEeeH
Confidence            3444433  34568999999999999997  56777774         34776654


No 405
>PRK15467 ethanolamine utilization protein EutP; Provisional
Probab=94.12  E-value=0.086  Score=38.33  Aligned_cols=24  Identities=17%  Similarity=0.259  Sum_probs=21.0

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      +.|.++|.+|+|||||...++...
T Consensus         2 ~~i~~iG~~~~GKstl~~~l~~~~   25 (158)
T PRK15467          2 KRIAFVGAVGAGKTTLFNALQGNY   25 (158)
T ss_pred             cEEEEECCCCCCHHHHHHHHcCCC
Confidence            468999999999999999988754


No 406
>CHL00181 cbbX CbbX; Provisional
Probab=94.12  E-value=0.042  Score=44.29  Aligned_cols=21  Identities=19%  Similarity=0.189  Sum_probs=18.7

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .+-++|.+|+||||+|+.++.
T Consensus        61 ~ill~G~pGtGKT~lAr~la~   81 (287)
T CHL00181         61 HMSFTGSPGTGKTTVALKMAD   81 (287)
T ss_pred             eEEEECCCCCCHHHHHHHHHH
Confidence            467899999999999999966


No 407
>PF13614 AAA_31:  AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D.
Probab=94.11  E-value=0.13  Score=36.68  Aligned_cols=39  Identities=15%  Similarity=0.156  Sum_probs=26.5

Q ss_pred             EEEEEEc-CCCccHHHHHHHHhccccccccCceEEEEEcCCC
Q 035574           16 SVVAILD-SIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYH   56 (156)
Q Consensus        16 ~vi~I~G-~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~   56 (156)
                      ++|+++| .||+|||++|..+..  .....-..++.|.....
T Consensus         1 k~i~v~s~~~g~G~t~~a~~lA~--~la~~~~~Vllid~~~~   40 (157)
T PF13614_consen    1 KVIAVWSPKGGVGKTTLALNLAA--ALARKGKKVLLIDFDFF   40 (157)
T ss_dssp             EEEEEEESSTTSSHHHHHHHHHH--HHHHTTT-EEEEE--SS
T ss_pred             CEEEEECCCCCCCHHHHHHHHHH--HHHhcCCCeEEEECCCC
Confidence            6899999 689999999998877  44433323666765443


No 408
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=94.10  E-value=0.058  Score=39.30  Aligned_cols=22  Identities=23%  Similarity=0.285  Sum_probs=19.0

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -|.++|.+|+|||||+..+.+.
T Consensus         6 ki~ivG~~~vGKTsli~~~~~~   27 (180)
T cd04127           6 KFLALGDSGVGKTSFLYQYTDN   27 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            4679999999999999998664


No 409
>cd04103 Centaurin_gamma Centaurin gamma.  The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains.  Centaurin gamma contains an additional GTPase domain near its N-terminus.  The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism.  Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP.  Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments.  A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues. 
Probab=94.09  E-value=0.051  Score=39.47  Aligned_cols=20  Identities=15%  Similarity=0.267  Sum_probs=17.2

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |.++|.+|+|||||...+..
T Consensus         3 i~vvG~~gvGKTsli~~~~~   22 (158)
T cd04103           3 LGIVGNLQSGKSALVHRYLT   22 (158)
T ss_pred             EEEECCCCCcHHHHHHHHHh
Confidence            68999999999999987643


No 410
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=94.09  E-value=0.069  Score=44.73  Aligned_cols=23  Identities=30%  Similarity=0.326  Sum_probs=20.8

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.++.++|..|+||||++.++..
T Consensus       137 g~ii~lvGptGvGKTTtiakLA~  159 (374)
T PRK14722        137 GGVFALMGPTGVGKTTTTAKLAA  159 (374)
T ss_pred             CcEEEEECCCCCCHHHHHHHHHH
Confidence            46899999999999999998876


No 411
>TIGR01425 SRP54_euk signal recognition particle protein SRP54. This model represents examples from the eukaryotic cytosol of the signal recognition particle protein component, SRP54. This GTP-binding protein is a component of the eukaryotic signal recognition particle, along with several other protein subunits and a 7S RNA. Some species, including Arabidopsis, have several closely related forms. The extreme C-terminal region is glycine-rich and lower in complexity, poorly conserved between species, and excluded from this model.
Probab=94.08  E-value=0.057  Score=46.03  Aligned_cols=24  Identities=17%  Similarity=0.151  Sum_probs=20.7

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+|.++|..|+||||++..+..
T Consensus        99 ~~~vi~lvG~~GvGKTTtaaKLA~  122 (429)
T TIGR01425        99 KQNVIMFVGLQGSGKTTTCTKLAY  122 (429)
T ss_pred             CCeEEEEECCCCCCHHHHHHHHHH
Confidence            368999999999999998887754


No 412
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=94.08  E-value=0.051  Score=42.39  Aligned_cols=24  Identities=17%  Similarity=0.147  Sum_probs=21.2

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.++.-
T Consensus        31 Ge~~~l~G~nGsGKSTLl~~l~Gl   54 (255)
T PRK11300         31 QEIVSLIGPNGAGKTTVFNCLTGF   54 (255)
T ss_pred             CeEEEEECCCCCCHHHHHHHHhCC
Confidence            468899999999999999998763


No 413
>cd01870 RhoA_like RhoA-like subfamily.  The RhoA subfamily consists of RhoA, RhoB, and RhoC.  RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility.  RhoA can bind to multiple effector proteins, thereby triggering different downstream responses.  In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis.  RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation.  RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  RhoA and RhoC are observed only in geranyl
Probab=94.08  E-value=0.06  Score=38.98  Aligned_cols=24  Identities=13%  Similarity=0.041  Sum_probs=20.3

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      .-|.|+|-.|+|||||...+.++.
T Consensus         2 ~ki~iiG~~~~GKTsl~~~~~~~~   25 (175)
T cd01870           2 KKLVIVGDGACGKTCLLIVFSKDQ   25 (175)
T ss_pred             cEEEEECCCCCCHHHHHHHHhcCC
Confidence            347899999999999999887743


No 414
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]
Probab=94.08  E-value=0.04  Score=40.70  Aligned_cols=21  Identities=10%  Similarity=0.188  Sum_probs=18.6

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -|-|.|.+|+|||||+..+..
T Consensus         9 NILvtGTPG~GKstl~~~lae   29 (176)
T KOG3347|consen    9 NILVTGTPGTGKSTLAERLAE   29 (176)
T ss_pred             CEEEeCCCCCCchhHHHHHHH
Confidence            367899999999999999875


No 415
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=94.07  E-value=0.049  Score=41.21  Aligned_cols=23  Identities=22%  Similarity=0.147  Sum_probs=21.0

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||.+.+..
T Consensus        26 G~~~~l~G~nGsGKSTLl~~l~G   48 (213)
T cd03262          26 GEVVVIIGPSGSGKSTLLRCINL   48 (213)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhC
Confidence            45889999999999999999987


No 416
>PRK09183 transposase/IS protein; Provisional
Probab=94.06  E-value=0.043  Score=43.50  Aligned_cols=22  Identities=18%  Similarity=0.234  Sum_probs=19.5

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..+.|+|..|+|||+||..+..
T Consensus       103 ~~v~l~Gp~GtGKThLa~al~~  124 (259)
T PRK09183        103 ENIVLLGPSGVGKTHLAIALGY  124 (259)
T ss_pred             CeEEEEeCCCCCHHHHHHHHHH
Confidence            4577999999999999999966


No 417
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division.  Among the Ras superfamily, Ran is a unique small G protein.  It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily.  Ran may therefore interact with a wide range of proteins in various intracellular locations.  Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors.  Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins.  The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is
Probab=94.06  E-value=0.052  Score=39.51  Aligned_cols=21  Identities=19%  Similarity=0.308  Sum_probs=18.3

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -|.++|..|+|||||...+.+
T Consensus         2 ki~vvG~~~vGKTsli~~~~~   22 (166)
T cd00877           2 KLVLVGDGGTGKTTFVKRHLT   22 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHHh
Confidence            368999999999999998764


No 418
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in R. etli Sym plasmid. This operon is involved in the plasmid replication and partition.
Probab=94.06  E-value=0.047  Score=36.56  Aligned_cols=21  Identities=24%  Similarity=0.305  Sum_probs=16.4

Q ss_pred             EEEEEc-CCCccHHHHHHHHhc
Q 035574           17 VVAILD-SIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G-~gGvGKTtLa~~vy~   37 (156)
                      ++++.| -||+||||++.++..
T Consensus         1 ~i~~~~~kgG~Gkst~~~~la~   22 (104)
T cd02042           1 VIAVANQKGGVGKTTTAVNLAA   22 (104)
T ss_pred             CEEEEeCCCCcCHHHHHHHHHH
Confidence            356776 689999999888755


No 419
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.
Probab=94.06  E-value=0.052  Score=41.53  Aligned_cols=24  Identities=21%  Similarity=0.272  Sum_probs=21.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||.+.+...
T Consensus        34 Ge~~~l~G~nGsGKSTLl~~i~G~   57 (224)
T TIGR02324        34 GECVALSGPSGAGKSTLLKSLYAN   57 (224)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            468899999999999999999873


No 420
>cd04117 Rab15 Rab15 subfamily.  Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to
Probab=94.06  E-value=0.066  Score=38.62  Aligned_cols=21  Identities=14%  Similarity=0.322  Sum_probs=18.1

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.++|.+|+|||||...+.+.
T Consensus         3 i~vvG~~~~GKTsli~~~~~~   23 (161)
T cd04117           3 LLLIGDSGVGKTCLLCRFTDN   23 (161)
T ss_pred             EEEECcCCCCHHHHHHHHhcC
Confidence            679999999999999877653


No 421
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=94.06  E-value=0.029  Score=38.24  Aligned_cols=20  Identities=15%  Similarity=0.328  Sum_probs=17.4

Q ss_pred             EEcCCCccHHHHHHHHhccc
Q 035574           20 ILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        20 I~G~gGvGKTtLa~~vy~~~   39 (156)
                      |+|..|+|||||+..+....
T Consensus         1 iiG~~~~GKStl~~~l~~~~   20 (157)
T cd00882           1 VVGDSGVGKTSLLNRLLGGE   20 (157)
T ss_pred             CCCcCCCcHHHHHHHHHhCC
Confidence            57999999999999998744


No 422
>CHL00072 chlL photochlorophyllide reductase subunit L
Probab=94.06  E-value=0.045  Score=44.08  Aligned_cols=20  Identities=15%  Similarity=0.218  Sum_probs=17.0

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |++.|-||+||||++..+..
T Consensus         3 ia~~gKGGVGKTTta~nLA~   22 (290)
T CHL00072          3 LAVYGKGGIGKSTTSCNISI   22 (290)
T ss_pred             EEEECCCCCcHHHHHHHHHH
Confidence            78999999999998776544


No 423
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed
Probab=94.06  E-value=0.071  Score=45.43  Aligned_cols=38  Identities=18%  Similarity=0.277  Sum_probs=27.5

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhccccccccCc--eEEEEEc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFD--YLAWIPA   53 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~--~~~wv~v   53 (156)
                      ....+-|+|..|+|||+|++.+.+  ++..++.  ...+++.
T Consensus       147 ~~~~l~l~G~~G~GKThL~~ai~~--~~~~~~~~~~v~yi~~  186 (450)
T PRK00149        147 AYNPLFIYGGVGLGKTHLLHAIGN--YILEKNPNAKVVYVTS  186 (450)
T ss_pred             cCCeEEEECCCCCCHHHHHHHHHH--HHHHhCCCCeEEEEEH
Confidence            346688999999999999999998  4444432  2445543


No 424
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2.  Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhi
Probab=94.06  E-value=0.052  Score=39.26  Aligned_cols=23  Identities=9%  Similarity=0.166  Sum_probs=19.8

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      --|.++|.+|+|||||+..+.+.
T Consensus         4 ~ki~vvG~~~~GKSsl~~~~~~~   26 (167)
T cd01867           4 FKLLLIGDSGVGKSCLLLRFSED   26 (167)
T ss_pred             eEEEEECCCCCCHHHHHHHHhhC
Confidence            45789999999999999998764


No 425
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=94.05  E-value=0.051  Score=38.71  Aligned_cols=21  Identities=10%  Similarity=0.178  Sum_probs=18.9

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.++|.+|+|||||...+.+.
T Consensus         3 v~~vG~~~~GKTsl~~~~~~~   23 (162)
T cd04106           3 VIVVGNGNVGKSSMIQRFVKG   23 (162)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            789999999999999998764


No 426
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=94.05  E-value=0.052  Score=41.90  Aligned_cols=24  Identities=25%  Similarity=0.221  Sum_probs=21.0

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .-.+++|+|..|.|||||++.+..
T Consensus        27 ~Ge~~~i~G~nGsGKSTLl~~l~G   50 (237)
T cd03252          27 PGEVVGIVGRSGSGKSTLTKLIQR   50 (237)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhc
Confidence            346889999999999999999875


No 427
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily.  IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits.  As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states.  Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments.  This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.
Probab=94.05  E-value=0.053  Score=38.78  Aligned_cols=22  Identities=18%  Similarity=0.338  Sum_probs=19.8

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      +|.|+|..|+|||||...+...
T Consensus         2 ~i~iiG~~~~GKtsli~~l~~~   23 (168)
T cd01887           2 VVTVMGHVDHGKTTLLDKIRKT   23 (168)
T ss_pred             EEEEEecCCCCHHHHHHHHHhc
Confidence            6899999999999999998764


No 428
>PF00154 RecA:  recA bacterial DNA recombination protein;  InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response []. In homologous recombination, the protein functions as a DNA-dependent ATPase, promoting synapsis, heteroduplex formation and strand exchange between homologous DNAs []. RecA also acts as a protease cofactor that promotes autodigestion of the lexA product and phage repressors. The proteolytic inactivation of the lexA repressor by an activated form of recA may cause a derepression of the 20 or so genes involved in the SOS response, which regulates DNA repair, induced mutagenesis, delayed cell division and prophage induction in response to DNA damage [].  RecA is a protein of about 350 amino-acid residues. Its sequence is very well conserved [, , ] among eubacterial species. It is also found in the chloroplast of plants []. RecA-like proteins are found in archaea and diverse eukaryotic organisms, like fission yeast, mouse or human. In the filament visualised by X-ray crystallography, beta-strand 3, the loop C-terminal to beta-strand 2, and alpha-helix D of the core domain form one surface that packs against alpha-helix A and beta-strand 0 (the N-terminal domain) of an adjacent monomer during polymerisation []. The core ATP-binding site domain is well conserved, with 14 invariant residues. It contains the nucleotide binding loop between beta-strand 1 and alpha-helix C. The Escherichia coli sequence GPESSGKT matches the consensus sequence of amino acids (G/A)XXXXGK(T/S) for the Walker A box (also referred to as the P-loop) found in a number of nucleoside triphosphate (NTP)-binding proteins. Another nucleotide binding motif, the Walker B box is found at beta-strand 4 in the RecA structure. The Walker B box is characterised by four hydrophobic amino acids followed by an acidic residue (usually aspartate). Nucleotide specificity and additional ATP binding interactions are contributed by the amino acid residues at beta-strand 2 and the loop C-terminal to that strand, all of which are greater than 90% conserved among bacterial RecA proteins.; GO: 0003697 single-stranded DNA binding, 0005524 ATP binding, 0006281 DNA repair; PDB: 2IN0_A 1MO3_A 3IFJ_A 2IN8_A 2IMZ_B 1G18_A 1MO4_A 3IGD_A 2L8L_A 2IN9_A ....
Probab=94.05  E-value=0.1  Score=42.81  Aligned_cols=47  Identities=21%  Similarity=0.175  Sum_probs=33.6

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHH
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQ   61 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~   61 (156)
                      +.-+++-|+|..++||||||-++..  ..+..-...+||...+.++...
T Consensus        51 p~G~ivEi~G~~ssGKttLaL~~ia--~~q~~g~~~a~ID~e~~ld~~~   97 (322)
T PF00154_consen   51 PRGRIVEIYGPESSGKTTLALHAIA--EAQKQGGICAFIDAEHALDPEY   97 (322)
T ss_dssp             ETTSEEEEEESTTSSHHHHHHHHHH--HHHHTT-EEEEEESSS---HHH
T ss_pred             ccCceEEEeCCCCCchhhhHHHHHH--hhhcccceeEEecCcccchhhH
Confidence            3457999999999999999999877  3433445589998887777643


No 429
>PRK10536 hypothetical protein; Provisional
Probab=94.05  E-value=0.12  Score=41.20  Aligned_cols=32  Identities=16%  Similarity=0.155  Sum_probs=23.6

Q ss_pred             EEEEEEcCCCccHHHHHHHHhccccccccCce
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSSYMKHYFDY   47 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~   47 (156)
                      ..+.+.|..|.|||+||..+..+.-....|+.
T Consensus        75 ~lV~i~G~aGTGKT~La~a~a~~~l~~~~~~k  106 (262)
T PRK10536         75 QLIFATGEAGCGKTWISAAKAAEALIHKDVDR  106 (262)
T ss_pred             CeEEEECCCCCCHHHHHHHHHHHHHhcCCeeE
Confidence            48899999999999999987664322334543


No 430
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=94.05  E-value=0.05  Score=42.09  Aligned_cols=24  Identities=21%  Similarity=0.165  Sum_probs=21.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+...
T Consensus        27 Ge~~~l~G~nGsGKSTLl~~l~G~   50 (240)
T PRK09493         27 GEVVVIIGPSGSGKSTLLRCINKL   50 (240)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            468899999999999999998763


No 431
>PRK00089 era GTPase Era; Reviewed
Probab=94.03  E-value=0.057  Score=43.05  Aligned_cols=25  Identities=16%  Similarity=0.203  Sum_probs=21.8

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      ....|+|+|.+|+|||||...+...
T Consensus         4 ~~g~V~iiG~pn~GKSTLin~L~g~   28 (292)
T PRK00089          4 KSGFVAIVGRPNVGKSTLLNALVGQ   28 (292)
T ss_pred             eeEEEEEECCCCCCHHHHHHHHhCC
Confidence            4678999999999999999998653


No 432
>cd04144 Ras2 Ras2 subfamily.  The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis.  In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family.  Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=94.03  E-value=0.052  Score=40.39  Aligned_cols=21  Identities=29%  Similarity=0.371  Sum_probs=18.2

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.|+|-+|+|||||+..+.++
T Consensus         2 i~ivG~~~vGKTsli~~l~~~   22 (190)
T cd04144           2 LVVLGDGGVGKTALTIQLCLN   22 (190)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            678999999999999987653


No 433
>PRK14242 phosphate transporter ATP-binding protein; Provisional
Probab=94.03  E-value=0.053  Score=42.32  Aligned_cols=23  Identities=22%  Similarity=0.257  Sum_probs=20.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||.+.+..
T Consensus        32 Ge~~~i~G~nGsGKSTLl~~l~G   54 (253)
T PRK14242         32 NQVTALIGPSGCGKSTFLRCLNR   54 (253)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHh
Confidence            35789999999999999999874


No 434
>cd04128 Spg1 Spg1p.  Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase.  Spg1p is an essential gene that localizes to the spindle pole bodies.  When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p.  Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p.  The existence of a SIN-related pathway in plants has been proposed.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP.  Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are
Probab=94.03  E-value=0.066  Score=39.81  Aligned_cols=21  Identities=14%  Similarity=0.313  Sum_probs=18.0

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      +.++|..|+|||+|+..+.++
T Consensus         3 i~vlG~~~vGKTsLi~~~~~~   23 (182)
T cd04128           3 IGLLGDAQIGKTSLMVKYVEG   23 (182)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            678999999999999887554


No 435
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=94.02  E-value=0.054  Score=40.66  Aligned_cols=23  Identities=17%  Similarity=0.186  Sum_probs=20.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.++.|+|..|.|||||.+.+..
T Consensus        33 Ge~~~l~G~nGsGKSTLl~~l~G   55 (192)
T cd03232          33 GTLTALMGESGAGKTTLLDVLAG   55 (192)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhC
Confidence            46889999999999999999986


No 436
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=94.02  E-value=0.053  Score=41.23  Aligned_cols=24  Identities=21%  Similarity=0.069  Sum_probs=21.3

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -..++|+|..|.|||||.+.+..-
T Consensus        31 Ge~~~i~G~nGsGKSTLl~~l~Gl   54 (218)
T cd03266          31 GEVTGLLGPNGAGKTTTLRMLAGL   54 (218)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            467899999999999999999773


No 437
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=94.02  E-value=0.053  Score=42.87  Aligned_cols=23  Identities=26%  Similarity=0.199  Sum_probs=20.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -..++|+|..|+|||||.+.+..
T Consensus        29 GEfvsilGpSGcGKSTLLriiAG   51 (248)
T COG1116          29 GEFVAILGPSGCGKSTLLRLIAG   51 (248)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhC
Confidence            46789999999999999998865


No 438
>PRK07933 thymidylate kinase; Validated
Probab=94.02  E-value=0.051  Score=41.78  Aligned_cols=21  Identities=24%  Similarity=0.226  Sum_probs=19.7

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .|+|.|+-|+||||+++.+.+
T Consensus         2 ~IviEG~dGsGKST~~~~L~~   22 (213)
T PRK07933          2 LIAIEGVDGAGKRTLTEALRA   22 (213)
T ss_pred             EEEEEcCCCCCHHHHHHHHHH
Confidence            589999999999999999988


No 439
>PRK06921 hypothetical protein; Provisional
Probab=94.01  E-value=0.072  Score=42.46  Aligned_cols=38  Identities=21%  Similarity=0.187  Sum_probs=27.9

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcccccccc-CceEEEEEc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNSSYMKHY-FDYLAWIPA   53 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~-F~~~~wv~v   53 (156)
                      ...-+-++|..|+|||.|+..+.+  .+... -...+|++.
T Consensus       116 ~~~~l~l~G~~G~GKThLa~aia~--~l~~~~g~~v~y~~~  154 (266)
T PRK06921        116 RKNSIALLGQPGSGKTHLLTAAAN--ELMRKKGVPVLYFPF  154 (266)
T ss_pred             CCCeEEEECCCCCcHHHHHHHHHH--HHhhhcCceEEEEEH
Confidence            356789999999999999999988  44433 233566664


No 440
>PRK07429 phosphoribulokinase; Provisional
Probab=94.00  E-value=0.062  Score=44.18  Aligned_cols=25  Identities=16%  Similarity=0.236  Sum_probs=22.3

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...-+|+|.|..|.||||+++.+..
T Consensus         6 ~~~~IIgI~G~SGSGKSTla~~L~~   30 (327)
T PRK07429          6 DRPVLLGVAGDSGCGKTTFLRGLAD   30 (327)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHh
Confidence            4567999999999999999999876


No 441
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=94.00  E-value=0.05  Score=41.25  Aligned_cols=21  Identities=19%  Similarity=0.170  Sum_probs=19.1

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ++.|+|..|.|||||++.++.
T Consensus        24 ~~~i~G~nGsGKStll~al~~   44 (197)
T cd03278          24 LTAIVGPNGSGKSNIIDAIRW   44 (197)
T ss_pred             cEEEECCCCCCHHHHHHHHHH
Confidence            789999999999999998863


No 442
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.
Probab=93.99  E-value=0.054  Score=42.16  Aligned_cols=24  Identities=17%  Similarity=0.242  Sum_probs=21.0

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .-.+++|+|..|.|||||++.+..
T Consensus        26 ~Ge~~~i~G~nGsGKSTLl~~l~G   49 (247)
T TIGR00972        26 KNQVTALIGPSGCGKSTLLRSLNR   49 (247)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhc
Confidence            346899999999999999999865


No 443
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional
Probab=93.99  E-value=0.054  Score=42.24  Aligned_cols=22  Identities=32%  Similarity=0.318  Sum_probs=19.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHh
Q 035574           15 LSVVAILDSIGLDKTAFTAEAY   36 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy   36 (156)
                      -.+++|+|..|.|||||++.+.
T Consensus        29 Ge~~~i~G~nGsGKSTLl~~i~   50 (250)
T PRK14245         29 KSVVAFIGPSGCGKSTFLRLFN   50 (250)
T ss_pred             CCEEEEECCCCCCHHHHHHHHh
Confidence            4678999999999999999985


No 444
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional
Probab=93.99  E-value=0.053  Score=42.21  Aligned_cols=23  Identities=13%  Similarity=0.190  Sum_probs=20.7

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||++.+..
T Consensus        29 Ge~~~i~G~nGsGKSTLl~~i~G   51 (250)
T PRK14247         29 NTITALMGPSGSGKSTLLRVFNR   51 (250)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhc
Confidence            46889999999999999999876


No 445
>cd04125 RabA_like RabA-like subfamily.  RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells.  The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression.  The function of RabA remains unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=93.98  E-value=0.055  Score=40.01  Aligned_cols=21  Identities=19%  Similarity=0.357  Sum_probs=18.8

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.++|.+|+|||||+..+.+.
T Consensus         3 i~v~G~~~vGKSsli~~~~~~   23 (188)
T cd04125           3 VVIIGDYGVGKSSLLKRFTED   23 (188)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            689999999999999998764


No 446
>PRK15453 phosphoribulokinase; Provisional
Probab=93.98  E-value=0.061  Score=43.49  Aligned_cols=24  Identities=17%  Similarity=0.210  Sum_probs=20.8

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+|+|.|-+|.||||+++.+.+
T Consensus         4 k~piI~ItG~SGsGKTTva~~l~~   27 (290)
T PRK15453          4 KHPIIAVTGSSGAGTTTVKRAFEK   27 (290)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHHH
Confidence            356899999999999999998764


No 447
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=93.97  E-value=0.054  Score=41.11  Aligned_cols=25  Identities=12%  Similarity=0.007  Sum_probs=21.9

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .-.+++|+|..|.|||||++.+...
T Consensus        27 ~Ge~~~i~G~nGsGKSTLl~~l~G~   51 (207)
T PRK13539         27 AGEALVLTGPNGSGKTTLLRLIAGL   51 (207)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCC
Confidence            3468899999999999999999874


No 448
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=93.96  E-value=0.055  Score=42.09  Aligned_cols=24  Identities=29%  Similarity=0.158  Sum_probs=20.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+...
T Consensus        29 Ge~~~i~G~nGsGKSTLl~~l~G~   52 (250)
T PRK11264         29 GEVVAIIGPSGSGKTTLLRCINLL   52 (250)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcC
Confidence            357899999999999999998763


No 449
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases. Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Probab=93.96  E-value=0.045  Score=39.64  Aligned_cols=21  Identities=10%  Similarity=0.143  Sum_probs=18.0

Q ss_pred             EEEEcCCCccHHHHHHHHhcc
Q 035574           18 VAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~~   38 (156)
                      |.|+|-+|+|||||...+...
T Consensus         1 i~i~G~~~vGKTsli~~~~~~   21 (174)
T smart00174        1 LVVVGDGAVGKTCLLISYTTN   21 (174)
T ss_pred             CEEECCCCCCHHHHHHHHHhC
Confidence            468999999999999987654


No 450
>cd04132 Rho4_like Rho4-like subfamily.  Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis.  Rho4 also plays a role in cell morphogenesis.  Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules.  The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP.  In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=93.94  E-value=0.064  Score=39.44  Aligned_cols=23  Identities=13%  Similarity=0.133  Sum_probs=19.6

Q ss_pred             EEEEEcCCCccHHHHHHHHhccc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      -|.|+|..|+|||||...+.++.
T Consensus         2 ki~vvG~~~vGKTsli~~l~~~~   24 (187)
T cd04132           2 KIVVVGDGGCGKTCLLIVYSQGK   24 (187)
T ss_pred             eEEEECCCCCCHHHHHHHHHhCc
Confidence            36899999999999999887653


No 451
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein. This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.
Probab=93.93  E-value=0.056  Score=41.12  Aligned_cols=24  Identities=21%  Similarity=0.185  Sum_probs=21.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|.|..|.|||||++.++..
T Consensus        24 Ge~~~i~G~nGsGKSTLl~~l~G~   47 (213)
T TIGR01277        24 GEIVAIMGPSGAGKSTLLNLIAGF   47 (213)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhcC
Confidence            467899999999999999999874


No 452
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=93.92  E-value=0.058  Score=40.65  Aligned_cols=25  Identities=16%  Similarity=0.048  Sum_probs=22.0

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .-.+++|+|..|.|||||.+.+...
T Consensus        26 ~Ge~~~l~G~nGsGKSTLl~~i~G~   50 (200)
T PRK13540         26 AGGLLHLKGSNGAGKTTLLKLIAGL   50 (200)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcC
Confidence            3468899999999999999999873


No 453
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA. This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.
Probab=93.91  E-value=0.059  Score=40.51  Aligned_cols=25  Identities=12%  Similarity=0.068  Sum_probs=21.9

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .-.+++|+|..|.|||||.+.+...
T Consensus        25 ~Ge~~~i~G~nGsGKSTLl~~l~G~   49 (198)
T TIGR01189        25 AGEALQVTGPNGIGKTTLLRILAGL   49 (198)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhCC
Confidence            3468899999999999999999874


No 454
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional
Probab=93.91  E-value=0.057  Score=41.95  Aligned_cols=24  Identities=13%  Similarity=0.124  Sum_probs=21.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+..-
T Consensus        29 Ge~~~i~G~nGsGKSTLl~~l~Gl   52 (241)
T PRK14250         29 GAIYTIVGPSGAGKSTLIKLINRL   52 (241)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            357899999999999999998763


No 455
>PF13245 AAA_19:  Part of AAA domain
Probab=93.90  E-value=0.12  Score=33.40  Aligned_cols=23  Identities=17%  Similarity=0.154  Sum_probs=16.5

Q ss_pred             cEEEEEEcCCCccHHHH-HHHHhc
Q 035574           15 LSVVAILDSIGLDKTAF-TAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtL-a~~vy~   37 (156)
                      -++..|.|.+|.|||++ +..+..
T Consensus        10 ~~~~vv~g~pGtGKT~~~~~~i~~   33 (76)
T PF13245_consen   10 SPLFVVQGPPGTGKTTTLAARIAE   33 (76)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHHH
Confidence            45677899999999954 444433


No 456
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]
Probab=93.90  E-value=0.05  Score=47.51  Aligned_cols=23  Identities=9%  Similarity=0.109  Sum_probs=20.7

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|||..|.||||||+.+..
T Consensus       317 GE~lglVGeSGsGKSTlar~i~g  339 (539)
T COG1123         317 GETLGLVGESGSGKSTLARILAG  339 (539)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhC
Confidence            35789999999999999999876


No 457
>PLN03046 D-glycerate 3-kinase; Provisional
Probab=93.90  E-value=0.22  Score=42.55  Aligned_cols=24  Identities=17%  Similarity=0.076  Sum_probs=21.6

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..-+|+|.|..|.|||||++.+..
T Consensus       211 ~PlIIGIsG~qGSGKSTLa~~L~~  234 (460)
T PLN03046        211 PPLVIGFSAPQGCGKTTLVFALDY  234 (460)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHH
Confidence            567999999999999999999855


No 458
>PRK13976 thymidylate kinase; Provisional
Probab=93.90  E-value=0.14  Score=39.35  Aligned_cols=21  Identities=14%  Similarity=0.009  Sum_probs=19.5

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .|+|-|.-|+||||+++.+++
T Consensus         2 fIv~EGiDGsGKsTq~~~L~~   22 (209)
T PRK13976          2 FITFEGIDGSGKTTQSRLLAE   22 (209)
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            478999999999999999988


No 459
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=93.89  E-value=0.06  Score=39.66  Aligned_cols=24  Identities=17%  Similarity=0.146  Sum_probs=21.3

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.++.|+|..|.|||||.+.+...
T Consensus        26 Ge~~~i~G~nGsGKStLl~~l~G~   49 (173)
T cd03230          26 GEIYGLLGPNGAGKTTLIKIILGL   49 (173)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            468899999999999999999773


No 460
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional
Probab=93.88  E-value=0.058  Score=42.32  Aligned_cols=23  Identities=26%  Similarity=0.281  Sum_probs=20.3

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||++.+..
T Consensus        38 Ge~~~l~G~nGsGKSTLl~~l~G   60 (259)
T PRK14274         38 NEVTAIIGPSGCGKSTFIKTLNL   60 (259)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHh
Confidence            45789999999999999999864


No 461
>TIGR00017 cmk cytidylate kinase. This family consists of cytidylate kinase, which catalyzes the phosphorylation of cytidine 5-monophosphate (dCMP) to cytidine 5 -diphosphate (dCDP) in the presence of ATP or GTP. UMP and dCMP can also act as acceptors.
Probab=93.88  E-value=0.06  Score=41.64  Aligned_cols=22  Identities=18%  Similarity=0.241  Sum_probs=20.1

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .+|+|.|..|.||||+++.+..
T Consensus         3 ~~i~i~G~~GsGKst~~~~la~   24 (217)
T TIGR00017         3 MIIAIDGPSGAGKSTVAKAVAE   24 (217)
T ss_pred             eEEEEECCCCCCHHHHHHHHHH
Confidence            4789999999999999999976


No 462
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional
Probab=93.88  E-value=0.057  Score=42.30  Aligned_cols=25  Identities=24%  Similarity=0.207  Sum_probs=21.6

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .-.+++|+|..|.|||||++.+...
T Consensus        30 ~Ge~~~l~G~nGsGKSTLl~~i~G~   54 (257)
T PRK10619         30 AGDVISIIGSSGSGKSTFLRCINFL   54 (257)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCC
Confidence            3468899999999999999998774


No 463
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=93.88  E-value=0.063  Score=39.58  Aligned_cols=23  Identities=17%  Similarity=0.193  Sum_probs=20.7

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.++.|+|..|.|||||.+.+..
T Consensus        28 Ge~~~i~G~nGsGKStLl~~l~G   50 (173)
T cd03246          28 GESLAIIGPSGSGKSTLARLILG   50 (173)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHh
Confidence            45789999999999999999876


No 464
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=93.87  E-value=0.059  Score=39.97  Aligned_cols=24  Identities=21%  Similarity=0.202  Sum_probs=21.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.++.|+|..|.|||||.+.++..
T Consensus        25 G~~~~l~G~nGsGKStLl~~i~G~   48 (180)
T cd03214          25 GEIVGILGPNGAGKSTLLKTLAGL   48 (180)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            468899999999999999999883


No 465
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily.  BipA is a protein belonging to the ribosome-binding family of GTPases and is widely distributed in bacteria and plants.  BipA was originally described as a protein that is induced in Salmonella typhimurium after exposure to bactericidal/permeability-inducing protein (a cationic antimicrobial protein produced by neutrophils), and has since been identified in E. coli as well.  The properties thus far described for BipA are related to its role in the process of pathogenesis by enteropathogenic E. coli.  It appears to be involved in the regulation of several processes important for infection, including rearrangements of the cytoskeleton of the host, bacterial resistance to host defense peptides, flagellum-mediated cell motility, and expression of K5 capsular genes.  It has been proposed that BipA may utilize a novel mechanism to regulate the expression of target genes.  In addition, BipA from enteropathogenic E. co
Probab=93.87  E-value=0.061  Score=40.15  Aligned_cols=23  Identities=17%  Similarity=0.309  Sum_probs=20.7

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .|-|.|+|-.|+|||||+..+.+
T Consensus         2 ~r~i~ivG~~~~GKTsL~~~l~~   24 (194)
T cd01891           2 IRNIAIIAHVDHGKTTLVDALLK   24 (194)
T ss_pred             ccEEEEEecCCCCHHHHHHHHHH
Confidence            57899999999999999998875


No 466
>PTZ00112 origin recognition complex 1 protein; Provisional
Probab=93.86  E-value=0.22  Score=46.36  Aligned_cols=58  Identities=14%  Similarity=0.076  Sum_probs=38.1

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhccccc---cccCc-e-EEEEEcCCCCCHHHHHHHHHHHh
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYM---KHYFD-Y-LAWIPAPYHYDPDQILDIVAVIL   70 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v---~~~F~-~-~~wv~vs~~~~~~~l~~~il~~l   70 (156)
                      ....++-|.|.+|.|||+.++.|.+..+-   ....+ + .++|....-.+...+...|++++
T Consensus       779 gpnnvLYIyG~PGTGKTATVK~VLrELqeeaeqk~lp~f~vVYINCm~Lstp~sIYqvI~qqL  841 (1164)
T PTZ00112        779 GSNQILYISGMPGTGKTATVYSVIQLLQHKTKQKLLPSFNVFEINGMNVVHPNAAYQVLYKQL  841 (1164)
T ss_pred             CCCceEEEECCCCCCHHHHHHHHHHHHHHHHhhccCCCceEEEEeCCccCCHHHHHHHHHHHH
Confidence            33467889999999999999999873211   11222 1 45665555556666666666666


No 467
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=93.86  E-value=0.059  Score=41.78  Aligned_cols=24  Identities=17%  Similarity=0.068  Sum_probs=21.2

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+...
T Consensus        47 Ge~~~i~G~NGsGKSTLl~~i~Gl   70 (236)
T cd03267          47 GEIVGFIGPNGAGKTTTLKILSGL   70 (236)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            468899999999999999999863


No 468
>PRK12422 chromosomal replication initiation protein; Provisional
Probab=93.86  E-value=0.12  Score=44.27  Aligned_cols=23  Identities=17%  Similarity=0.260  Sum_probs=20.9

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ...+-|+|..|+|||+|++.+.+
T Consensus       141 ~npl~L~G~~G~GKTHLl~Ai~~  163 (445)
T PRK12422        141 FNPIYLFGPEGSGKTHLMQAAVH  163 (445)
T ss_pred             CceEEEEcCCCCCHHHHHHHHHH
Confidence            45688999999999999999998


No 469
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional
Probab=93.85  E-value=0.056  Score=44.22  Aligned_cols=24  Identities=21%  Similarity=0.163  Sum_probs=21.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+..-
T Consensus        33 Ge~~~lvG~sGsGKSTL~~~l~Gl   56 (326)
T PRK11022         33 GEVVGIVGESGSGKSVSSLAIMGL   56 (326)
T ss_pred             CCEEEEECCCCChHHHHHHHHHcC
Confidence            368999999999999999998773


No 470
>PRK14241 phosphate transporter ATP-binding protein; Provisional
Probab=93.85  E-value=0.059  Score=42.25  Aligned_cols=23  Identities=22%  Similarity=0.213  Sum_probs=20.8

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||.+.+..
T Consensus        30 Ge~~~i~G~nGsGKSTLl~~laG   52 (258)
T PRK14241         30 RSVTAFIGPSGCGKSTVLRTLNR   52 (258)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhc
Confidence            46889999999999999999876


No 471
>PTZ00133 ADP-ribosylation factor; Provisional
Probab=93.85  E-value=0.057  Score=40.09  Aligned_cols=23  Identities=9%  Similarity=-0.057  Sum_probs=19.3

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .-|.++|.+|+|||+|+..+...
T Consensus        18 ~kv~lvG~~~vGKTsli~~~~~~   40 (182)
T PTZ00133         18 VRILMVGLDAAGKTTILYKLKLG   40 (182)
T ss_pred             cEEEEEcCCCCCHHHHHHHHhcC
Confidence            34788999999999999998553


No 472
>cd04148 RGK RGK subfamily.  The RGK (Rem, Rem2, Rad, Gem/Kir) subfamily of Ras GTPases are expressed in a tissue-specific manner and are dynamically regulated by transcriptional and posttranscriptional mechanisms in response to environmental cues.   RGK proteins bind to the beta subunit of L-type calcium channels, causing functional down-regulation of these voltage-dependent calcium channels, and either termination of calcium-dependent secretion or modulation of electrical conduction and contractile function.  Inhibition of L-type calcium channels by Rem2 may provide a mechanism for modulating calcium-triggered exocytosis in hormone-secreting cells, and has been proposed to influence the secretion of insulin in pancreatic beta cells.  RGK proteins also interact with and inhibit the Rho/Rho kinase pathway to modulate remodeling of the cytoskeleton.  Two characteristics of RGK proteins cited in the literature are N-terminal and C-terminal extensions beyond the GTPase domain typical of Ra
Probab=93.85  E-value=0.069  Score=41.05  Aligned_cols=20  Identities=25%  Similarity=0.436  Sum_probs=18.1

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |.++|-+|+|||||+..+..
T Consensus         3 I~lvG~~gvGKTsLi~~~~~   22 (221)
T cd04148           3 VVMLGSPGVGKSSLASQFTS   22 (221)
T ss_pred             EEEECCCCCcHHHHHHHHhc
Confidence            78999999999999999854


No 473
>PRK14730 coaE dephospho-CoA kinase; Provisional
Probab=93.85  E-value=0.059  Score=40.87  Aligned_cols=22  Identities=9%  Similarity=0.071  Sum_probs=19.6

Q ss_pred             EEEEEEcCCCccHHHHHHHHhc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..|+|.|..|.||||+++.+.+
T Consensus         2 ~~i~itG~~gsGKst~~~~l~~   23 (195)
T PRK14730          2 RRIGLTGGIASGKSTVGNYLAQ   23 (195)
T ss_pred             cEEEEECCCCCCHHHHHHHHHH
Confidence            3689999999999999998865


No 474
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=93.84  E-value=0.07  Score=39.30  Aligned_cols=27  Identities=11%  Similarity=0.104  Sum_probs=22.7

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhccc
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      .+...|.|+|..|+|||||...+..+.
T Consensus        16 ~~~~~i~ivG~~~~GKStlin~l~~~~   42 (179)
T TIGR03598        16 DDGPEIAFAGRSNVGKSSLINALTNRK   42 (179)
T ss_pred             CCCCEEEEEcCCCCCHHHHHHHHhCCC
Confidence            445678999999999999999988753


No 475
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily. Members of this family are phage (or prophage-region) homologs of the bacterial homohexameric replicative helicase DnaB. Some phage may rely on host DnaB, while others encode their own verions. This model describes the largest phage-specific clade among the close homologs of DnaB, but there are, or course, other DnaB homologs from phage that fall outside the scope of this model.
Probab=93.84  E-value=0.28  Score=41.41  Aligned_cols=56  Identities=7%  Similarity=0.047  Sum_probs=38.2

Q ss_pred             CCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEEcCCCCCHHHHHHHHHHHhC
Q 035574           13 TQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIPAPYHYDPDQILDIVAVILL   71 (156)
Q Consensus        13 ~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~vs~~~~~~~l~~~il~~l~   71 (156)
                      ..-.++.|-|.+|+|||++|..+..+...+..+ .++|++  -+.+..++...++....
T Consensus       192 ~~g~liviag~pg~GKT~~al~ia~~~a~~~g~-~v~~fS--lEm~~~~l~~Rl~~~~~  247 (421)
T TIGR03600       192 VKGDLIVIGARPSMGKTTLALNIAENVALREGK-PVLFFS--LEMSAEQLGERLLASKS  247 (421)
T ss_pred             CCCceEEEEeCCCCCHHHHHHHHHHHHHHhCCC-cEEEEE--CCCCHHHHHHHHHHHHc
Confidence            345688889999999999999987533223333 345554  44577888877776543


No 476
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=93.83  E-value=0.055  Score=42.67  Aligned_cols=24  Identities=13%  Similarity=0.077  Sum_probs=21.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+..-
T Consensus        37 Ge~~~i~G~nGsGKSTLl~~l~Gl   60 (265)
T PRK10575         37 GKVTGLIGHNGSGKSTLLKMLGRH   60 (265)
T ss_pred             CCEEEEECCCCCCHHHHHHHHcCC
Confidence            358899999999999999998763


No 477
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=93.83  E-value=0.06  Score=42.55  Aligned_cols=24  Identities=17%  Similarity=0.105  Sum_probs=21.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||.+.+..-
T Consensus        38 Ge~~~I~G~NGsGKSTLlk~l~Gl   61 (257)
T PRK11247         38 GQFVAVVGRSGCGKSTLLRLLAGL   61 (257)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcC
Confidence            357899999999999999999763


No 478
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=93.82  E-value=0.059  Score=39.84  Aligned_cols=24  Identities=17%  Similarity=0.140  Sum_probs=21.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.++.|.|..|.|||||++.+...
T Consensus        28 Ge~~~i~G~nGsGKStLl~~l~G~   51 (178)
T cd03247          28 GEKIALLGRSGSGKSTLLQLLTGD   51 (178)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcc
Confidence            357899999999999999998774


No 479
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=93.82  E-value=0.06  Score=41.54  Aligned_cols=25  Identities=20%  Similarity=0.121  Sum_probs=21.8

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhcc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      .-.+++|+|..|.|||||++.+..-
T Consensus        28 ~Ge~~~l~G~nGsGKSTLl~~i~G~   52 (238)
T cd03249          28 PGKTVALVGSSGCGKSTVVSLLERF   52 (238)
T ss_pred             CCCEEEEEeCCCCCHHHHHHHHhcc
Confidence            3468899999999999999998763


No 480
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=93.81  E-value=0.06  Score=42.30  Aligned_cols=24  Identities=13%  Similarity=0.202  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.++.-
T Consensus        30 Ge~~~I~G~NGsGKSTLl~~i~Gl   53 (251)
T PRK09544         30 GKILTLLGPNGAGKSTLVRVVLGL   53 (251)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            467899999999999999999873


No 481
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=93.80  E-value=0.063  Score=39.91  Aligned_cols=24  Identities=17%  Similarity=0.268  Sum_probs=21.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.++.|+|..|.|||||.+.+..-
T Consensus        26 G~~~~i~G~nGsGKSTLl~~l~G~   49 (182)
T cd03215          26 GEIVGIAGLVGNGQTELAEALFGL   49 (182)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            357899999999999999998763


No 482
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=93.79  E-value=0.064  Score=38.54  Aligned_cols=24  Identities=8%  Similarity=0.076  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.++.|+|..|.|||||++.+...
T Consensus        26 Ge~~~i~G~nGsGKStLl~~l~G~   49 (144)
T cd03221          26 GDRIGLVGRNGAGKSTLLKLIAGE   49 (144)
T ss_pred             CCEEEEECCCCCCHHHHHHHHcCC
Confidence            467899999999999999999774


No 483
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]
Probab=93.79  E-value=0.15  Score=44.14  Aligned_cols=39  Identities=18%  Similarity=0.239  Sum_probs=30.8

Q ss_pred             CCCcEEEEEEcCCCccHHH-HHHHHhccccccccCceEEEEE
Q 035574           12 PTQLSVVAILDSIGLDKTA-FTAEAYNSSYMKHYFDYLAWIP   52 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTt-La~~vy~~~~v~~~F~~~~wv~   52 (156)
                      ...+.||++||-.||||+| ||+..|-  -.++.|...+=.|
T Consensus       375 ~krPYVi~fvGVNGVGKSTNLAKIayW--LlqNkfrVLIAAC  414 (587)
T KOG0781|consen  375 RKRPYVISFVGVNGVGKSTNLAKIAYW--LLQNKFRVLIAAC  414 (587)
T ss_pred             cCCCeEEEEEeecCccccchHHHHHHH--HHhCCceEEEEec
Confidence            4578999999999999988 8888887  6667786544444


No 484
>PF03215 Rad17:  Rad17 cell cycle checkpoint protein
Probab=93.79  E-value=0.12  Score=45.23  Aligned_cols=47  Identities=23%  Similarity=0.315  Sum_probs=34.7

Q ss_pred             HHHHHHHhc---CCCCcEEEEEEcCCCccHHHHHHHHhccccccccCceEEEEE
Q 035574            2 EELLDLLIE---GPTQLSVVAILDSIGLDKTAFTAEAYNSSYMKHYFDYLAWIP   52 (156)
Q Consensus         2 ~~l~~~L~~---~~~~~~vi~I~G~gGvGKTtLa~~vy~~~~v~~~F~~~~wv~   52 (156)
                      +++-.||..   +....+++-+.|.+|.||||.++.+++..    .|+.+-|..
T Consensus        29 ~eV~~wl~~~~~~~~~~~iLlLtGP~G~GKtttv~~La~el----g~~v~Ew~n   78 (519)
T PF03215_consen   29 EEVRSWLEEMFSGSSPKRILLLTGPSGCGKTTTVKVLAKEL----GFEVQEWIN   78 (519)
T ss_pred             HHHHHHHHHHhccCCCcceEEEECCCCCCHHHHHHHHHHHh----CCeeEEecC
Confidence            467778755   33446799999999999999999988732    356666753


No 485
>PRK14239 phosphate transporter ATP-binding protein; Provisional
Probab=93.78  E-value=0.061  Score=41.88  Aligned_cols=23  Identities=13%  Similarity=0.224  Sum_probs=20.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||.+.+..
T Consensus        31 Ge~~~i~G~nGsGKSTLl~~l~G   53 (252)
T PRK14239         31 NEITALIGPSGSGKSTLLRSINR   53 (252)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhc
Confidence            35799999999999999999964


No 486
>PF06309 Torsin:  Torsin;  InterPro: IPR010448 This family consists of several eukaryotic torsin proteins. Torsion dystonia is an autosomal dominant movement disorder characterised by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of AAA ATPase, central region containing proteins () proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor
Probab=93.78  E-value=0.14  Score=36.50  Aligned_cols=26  Identities=15%  Similarity=0.117  Sum_probs=21.2

Q ss_pred             CCCcEEEEEEcCCCccHHHHHHHHhc
Q 035574           12 PTQLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        12 ~~~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +...-|++.+|..|+|||.+++.+.+
T Consensus        50 p~KpLVlSfHG~tGtGKn~v~~liA~   75 (127)
T PF06309_consen   50 PRKPLVLSFHGWTGTGKNFVSRLIAE   75 (127)
T ss_pred             CCCCEEEEeecCCCCcHHHHHHHHHH
Confidence            56678999999999999997666544


No 487
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=93.78  E-value=0.055  Score=44.75  Aligned_cols=38  Identities=11%  Similarity=0.093  Sum_probs=27.9

Q ss_pred             EEEEEEcCCCccHHHHHHHHhcccccc--ccCceEEEEEc
Q 035574           16 SVVAILDSIGLDKTAFTAEAYNSSYMK--HYFDYLAWIPA   53 (156)
Q Consensus        16 ~vi~I~G~gGvGKTtLa~~vy~~~~v~--~~F~~~~wv~v   53 (156)
                      |+|-++|.+|.|||+|.+.+++...++  +.|....-+.+
T Consensus       178 RliLlhGPPGTGKTSLCKaLaQkLSIR~~~~y~~~~liEi  217 (423)
T KOG0744|consen  178 RLILLHGPPGTGKTSLCKALAQKLSIRTNDRYYKGQLIEI  217 (423)
T ss_pred             eEEEEeCCCCCChhHHHHHHHHhheeeecCccccceEEEE
Confidence            677889999999999999999865554  34444444443


No 488
>cd01874 Cdc42 Cdc42 subfamily.  Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases.  These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway.  Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth.  In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus.  Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand.  In addi
Probab=93.78  E-value=0.073  Score=39.19  Aligned_cols=22  Identities=9%  Similarity=0.084  Sum_probs=18.9

Q ss_pred             EEEEEcCCCccHHHHHHHHhcc
Q 035574           17 VVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -+.++|-+|+|||+|+..+.++
T Consensus         3 ki~vvG~~~vGKTsl~~~~~~~   24 (175)
T cd01874           3 KCVVVGDGAVGKTCLLISYTTN   24 (175)
T ss_pred             EEEEECCCCCCHHHHHHHHHcC
Confidence            4789999999999999988654


No 489
>PRK06526 transposase; Provisional
Probab=93.78  E-value=0.052  Score=43.01  Aligned_cols=23  Identities=22%  Similarity=0.083  Sum_probs=20.0

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..-+-++|.+|+|||+||..+..
T Consensus        98 ~~nlll~Gp~GtGKThLa~al~~  120 (254)
T PRK06526         98 KENVVFLGPPGTGKTHLAIGLGI  120 (254)
T ss_pred             CceEEEEeCCCCchHHHHHHHHH
Confidence            34578999999999999999876


No 490
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional
Probab=93.76  E-value=0.062  Score=42.21  Aligned_cols=23  Identities=17%  Similarity=0.185  Sum_probs=20.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||++.+..
T Consensus        39 Ge~~~i~G~nGsGKSTLl~~l~G   61 (260)
T PRK10744         39 NQVTAFIGPSGCGKSTLLRTFNR   61 (260)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhc
Confidence            46789999999999999999875


No 491
>PRK14238 phosphate transporter ATP-binding protein; Provisional
Probab=93.76  E-value=0.062  Score=42.59  Aligned_cols=23  Identities=22%  Similarity=0.302  Sum_probs=20.7

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      -.+++|+|..|.|||||++.+..
T Consensus        50 Ge~~~I~G~nGsGKSTLl~~i~G   72 (271)
T PRK14238         50 NEVTAIIGPSGCGKSTYIKTLNR   72 (271)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHh
Confidence            46889999999999999999875


No 492
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=93.75  E-value=0.063  Score=42.00  Aligned_cols=23  Identities=17%  Similarity=0.004  Sum_probs=20.5

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      ..+..|+|..|.|||||+..++.
T Consensus        25 ~~~~~IvG~NGsGKStll~Ai~~   47 (251)
T cd03273          25 PQFNAITGLNGSGKSNILDAICF   47 (251)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHH
Confidence            56789999999999999999874


No 493
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional
Probab=93.75  E-value=0.062  Score=41.62  Aligned_cols=24  Identities=21%  Similarity=0.115  Sum_probs=21.1

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||.+.+...
T Consensus        29 Ge~~~l~G~nGsGKSTLl~~l~G~   52 (241)
T PRK10895         29 GEIVGLLGPNGAGKTTTFYMVVGI   52 (241)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            468899999999999999998763


No 494
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=93.75  E-value=0.063  Score=39.42  Aligned_cols=24  Identities=13%  Similarity=0.022  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -..+.|+|..|.|||||++.+...
T Consensus        27 Ge~~~i~G~nGsGKSTLl~~l~G~   50 (166)
T cd03223          27 GDRLLITGPSGTGKSSLFRALAGL   50 (166)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcC
Confidence            457899999999999999999874


No 495
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=93.73  E-value=0.069  Score=40.97  Aligned_cols=24  Identities=33%  Similarity=0.286  Sum_probs=21.4

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNS   38 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~   38 (156)
                      -.+++|+|..|.|||||++.+..-
T Consensus        33 Ge~~~l~G~nGsGKSTLlk~l~G~   56 (226)
T cd03234          33 GQVMAILGSSGSGKTTLLDAISGR   56 (226)
T ss_pred             CeEEEEECCCCCCHHHHHHHHhCc
Confidence            468899999999999999999773


No 496
>cd01892 Miro2 Miro2 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the putative GTPase domain in the C terminus of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=93.73  E-value=0.089  Score=38.42  Aligned_cols=25  Identities=20%  Similarity=0.223  Sum_probs=20.8

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhccc
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSS   39 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~   39 (156)
                      ..-+.++|-+|+|||+|...+....
T Consensus         4 ~~kv~~vG~~~vGKTsli~~~~~~~   28 (169)
T cd01892           4 VFLCFVLGAKGSGKSALLRAFLGRS   28 (169)
T ss_pred             EEEEEEECCCCCcHHHHHHHHhCCC
Confidence            4457889999999999999987753


No 497
>cd04151 Arl1 Arl1 subfamily.  Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network.  Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting.  In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors.  Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding.  Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2.  Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi.  In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=93.73  E-value=0.059  Score=38.55  Aligned_cols=20  Identities=20%  Similarity=0.031  Sum_probs=17.8

Q ss_pred             EEEEcCCCccHHHHHHHHhc
Q 035574           18 VAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        18 i~I~G~gGvGKTtLa~~vy~   37 (156)
                      |.++|.+|+|||||+..+..
T Consensus         2 v~lvG~~~~GKTsl~~~l~~   21 (158)
T cd04151           2 ILILGLDNAGKTTILYRLQL   21 (158)
T ss_pred             EEEECCCCCCHHHHHHHHcc
Confidence            67899999999999999844


No 498
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=93.73  E-value=0.063  Score=41.22  Aligned_cols=24  Identities=21%  Similarity=0.271  Sum_probs=21.2

Q ss_pred             CcEEEEEEcCCCccHHHHHHHHhc
Q 035574           14 QLSVVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        14 ~~~vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      .-.+++|+|..|.|||||++.+..
T Consensus        25 ~Ge~~~l~G~nGsGKSTLl~~l~G   48 (230)
T TIGR03410        25 KGEVTCVLGRNGVGKTTLLKTLMG   48 (230)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhC
Confidence            346899999999999999999876


No 499
>PF07724 AAA_2:  AAA domain (Cdc48 subfamily);  InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of ATPase AAA-2 domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. Some of these ATPases function as a chaperone subunit of a proteasome-like degradation complex. This ATPase family includes some proteins not detected by IPR003959 from INTERPRO.; GO: 0005524 ATP binding; PDB: 1R6B_X 1KSF_X 3PXI_C 1KYI_T 1G3I_S 1OFH_B 1OFI_A 1G41_A 1IM2_A 1HQY_E ....
Probab=93.72  E-value=0.14  Score=38.07  Aligned_cols=39  Identities=15%  Similarity=0.018  Sum_probs=26.6

Q ss_pred             cEEEEEEcCCCccHHHHHHHHhcccccc-ccCceEEEEEcCC
Q 035574           15 LSVVAILDSIGLDKTAFTAEAYNSSYMK-HYFDYLAWIPAPY   55 (156)
Q Consensus        15 ~~vi~I~G~gGvGKTtLa~~vy~~~~v~-~~F~~~~wv~vs~   55 (156)
                      ..++-+.|..|+|||.||+.+.+  .+. ......+-+.+++
T Consensus         3 ~~~~ll~GpsGvGKT~la~~la~--~l~~~~~~~~~~~d~s~   42 (171)
T PF07724_consen    3 KSNFLLAGPSGVGKTELAKALAE--LLFVGSERPLIRIDMSE   42 (171)
T ss_dssp             SEEEEEESSTTSSHHHHHHHHHH--HHT-SSCCEEEEEEGGG
T ss_pred             EEEEEEECCCCCCHHHHHHHHHH--HhccCCccchHHHhhhc
Confidence            45778899999999999998877  333 3333444444443


No 500
>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional
Probab=93.72  E-value=0.062  Score=42.01  Aligned_cols=21  Identities=14%  Similarity=0.066  Sum_probs=19.0

Q ss_pred             EEEEEcCCCccHHHHHHHHhc
Q 035574           17 VVAILDSIGLDKTAFTAEAYN   37 (156)
Q Consensus        17 vi~I~G~gGvGKTtLa~~vy~   37 (156)
                      +|+|+||.|+||+|.|+.+-.
T Consensus         2 iI~i~G~~gsGKstva~~~~~   22 (227)
T PHA02575          2 LIAISGKKRSGKDTVADFIIE   22 (227)
T ss_pred             EEEEeCCCCCCHHHHHHHHHh
Confidence            689999999999999998844


Done!