BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035634
(323 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus
GN=Atp10d PE=2 SV=2
Length = 1416
Score = 33.9 bits (76), Expect = 1.5, Method: Composition-based stats.
Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 7/69 (10%)
Query: 98 FSYFFFTLIFSFLCTSTVAFIVSCIYTGNDINVKKAFSIIPKVWKQVLFTLLISLFIVFF 157
SYFFF L F LC V+C N + + + P + + T ++L F
Sbjct: 1261 LSYFFFALAFGALC-------VTCNPPSNPYGIMRKHMLDPVFYLVCVLTTFVALLPRFL 1313
Query: 158 YDVVFGSLL 166
Y V+ GS+
Sbjct: 1314 YRVLQGSVF 1322
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.332 0.145 0.422
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 102,301,769
Number of Sequences: 539616
Number of extensions: 3899271
Number of successful extensions: 13289
Number of sequences better than 100.0: 46
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 44
Number of HSP's that attempted gapping in prelim test: 13267
Number of HSP's gapped (non-prelim): 69
length of query: 323
length of database: 191,569,459
effective HSP length: 117
effective length of query: 206
effective length of database: 128,434,387
effective search space: 26457483722
effective search space used: 26457483722
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 61 (28.1 bits)