BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035634
         (323 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus
            GN=Atp10d PE=2 SV=2
          Length = 1416

 Score = 33.9 bits (76), Expect = 1.5,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 7/69 (10%)

Query: 98   FSYFFFTLIFSFLCTSTVAFIVSCIYTGNDINVKKAFSIIPKVWKQVLFTLLISLFIVFF 157
             SYFFF L F  LC       V+C    N   + +   + P  +   + T  ++L   F 
Sbjct: 1261 LSYFFFALAFGALC-------VTCNPPSNPYGIMRKHMLDPVFYLVCVLTTFVALLPRFL 1313

Query: 158  YDVVFGSLL 166
            Y V+ GS+ 
Sbjct: 1314 YRVLQGSVF 1322


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.332    0.145    0.422 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 102,301,769
Number of Sequences: 539616
Number of extensions: 3899271
Number of successful extensions: 13289
Number of sequences better than 100.0: 46
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 44
Number of HSP's that attempted gapping in prelim test: 13267
Number of HSP's gapped (non-prelim): 69
length of query: 323
length of database: 191,569,459
effective HSP length: 117
effective length of query: 206
effective length of database: 128,434,387
effective search space: 26457483722
effective search space used: 26457483722
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 61 (28.1 bits)