Query 035637 Match_columns 126 No_of_seqs 127 out of 405 Neff 4.1 Searched_HMMs 46136 Date Fri Mar 29 04:50:09 2013 Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035637.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035637hhsearch_cdd -cpu 12 -v 0 No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PF02727 Cu_amine_oxidN2: Copp 99.4 2.2E-14 4.7E-19 99.2 1.1 46 78-124 1-46 (86) 2 PRK11504 tynA tyramine oxidase 99.2 3.6E-11 7.9E-16 109.1 6.1 51 72-124 8-58 (647) 3 PRK14696 tynA tyramine oxidase 99.1 8.2E-11 1.8E-15 107.9 5.7 50 73-124 83-132 (721) 4 PLN02566 amine oxidase (copper 99.1 1.7E-10 3.8E-15 104.7 6.0 47 77-124 21-67 (646) 5 COG3733 TynA Cu2+-containing a 99.0 6.2E-10 1.4E-14 100.2 5.9 50 74-125 26-75 (654) 6 KOG1186 Copper amine oxidase [ 98.5 2.9E-07 6.2E-12 84.2 6.4 60 64-123 14-73 (670) 7 PF07172 GRP: Glycine rich pro 55.8 6.3 0.00014 28.2 1.1 21 1-24 1-21 (95) 8 PF06698 DUF1192: Protein of u 40.7 48 0.001 22.0 3.5 23 75-97 13-35 (59) 9 cd08764 Cyt_b561_CG1275_like N 40.5 25 0.00054 28.5 2.5 33 5-37 177-209 (214) 10 PF00701 DHDPS: Dihydrodipicol 33.6 42 0.00092 26.9 2.8 24 75-98 265-288 (289) 11 PF11148 DUF2922: Protein of u 31.6 70 0.0015 20.9 3.1 27 76-102 19-45 (69) 12 cd02062 Nitro_FMN_reductase Pr 27.8 1.7E+02 0.0037 19.5 4.7 32 81-112 13-44 (122) 13 PF04270 Strep_his_triad: Stre 26.5 39 0.00085 22.1 1.2 19 79-97 34-52 (53) 14 TIGR03249 KdgD 5-dehydro-4-deo 24.2 94 0.002 25.3 3.3 25 74-98 271-295 (296) 15 PF07315 DUF1462: Protein of u 24.1 1.2E+02 0.0025 22.2 3.4 27 92-121 26-52 (93) 16 KOG2096 WD40 repeat protein [G 22.7 99 0.0021 27.7 3.3 30 1-30 1-30 (420) 17 COG4837 Uncharacterized protei 20.5 2.3E+02 0.0051 21.0 4.4 27 92-121 33-59 (106) No 1 >PF02727 Cu_amine_oxidN2: Copper amine oxidase, N2 domain; InterPro: IPR015800 Amine oxidases (AO) are enzymes that catalyse the oxidation of a wide range of biogenic amines including many neurotransmitters, histamine and xenobiotic amines. There are two classes of amine oxidases: flavin-containing (1.4.3.4 from EC) and copper-containing (1.4.3.6 from EC). Copper-containing AO act as a disulphide-linked homodimer. They catalyse the oxidation of primary amines to aldehydes, with the subsequent release of ammonia and hydrogen peroxide, which requires one copper ion per subunit and topaquinone as cofactor []:RCH2NH2 + H2O + O2 = RCHO + NH3 + H2O2 Copper-containing amine oxidases are found in bacteria, fungi, plants and animals. In prokaryotes, the enzyme enables various amine substrates to be used as sources of carbon and nitrogen [, ]. In eukaryotes they have a broader range of functions, including cell differentiation and growth, wound healing, detoxification and cell signalling []. The copper amine oxidases occur as mushroom-shaped homodimers of 70-95 kDa, each monomer containing a copper ion and a covalently bound redox cofactor, topaquinone (TPQ). TPQ is formed by post-translational modification of a conserved tyrosine residue. The copper ion is coordinated with three histidine residues and two water molecules in a distorted square pyramidal geometry, and has a dual function in catalysis and TPQ biogenesis. The catalytic domain is the largest of the 3-4 domains found in copper amine oxidases, and consists of a beta sandwich of 18 strands in two sheets. The active site is buried and requires a conformational change to allow the substrate access. The two N-terminal domains share a common structural fold, its core consisting of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the stalk, of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other [, ]. This entry represents one (N2) of the two N-terminal domains (N2/N3) that share a similar structure.; GO: 0005507 copper ion binding, 0008131 primary amine oxidase activity, 0048038 quinone binding, 0009308 amine metabolic process, 0055114 oxidation-reduction process; PDB: 1W2Z_A 1KSI_B 1US1_A 2C11_B 3ALA_E 2Y73_B 2C10_B 1PU4_B 2Y74_B 3SX1_A .... Probab=99.44 E-value=2.2e-14 Score=99.22 Aligned_cols=46 Identities=35% Similarity=0.472 Sum_probs=39.0 Q ss_pred CCCCCCCHHHHHHHHHHHHhcCCCCCCCCeeEEEEecCCCCChhhhh Q 035637 78 HPLDPLTVKEINRVRTILTSHELFKNSFPYAFHSITLTQKITCPELE 124 (126) Q Consensus 78 HPLDPLT~~EI~~A~~ILr~~~~~~~~~~~rF~~V~L~EP~K~evl~ 124 (126) |||||||++||++|++||++++... +.+++|.+|+|+||+|++|+. T Consensus 1 HPLdpLt~~Ei~~a~~il~~~~~~~-~~~~~F~~I~L~EP~K~~vl~ 46 (86) T PF02727_consen 1 HPLDPLTAEEIQAAAAILRDAHPLA-GEKNRFRSIELQEPPKAEVLA 46 (86) T ss_dssp HCCHHHHHHHHHHHHHHHHHHTGTT-TTSEEEEEEEEE---HHHHHH T ss_pred CCCCCCCHHHHHHHHHHHHhccccC-CCCeEEEEEEeCCCCHHHHhc Confidence 9999999999999999999998332 579999999999999999985 No 2 >PRK11504 tynA tyramine oxidase; Provisional Probab=99.17 E-value=3.6e-11 Score=109.11 Aligned_cols=51 Identities=33% Similarity=0.445 Sum_probs=45.5 Q ss_pred CCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCCCCCeeEEEEecCCCCChhhhh Q 035637 72 ASDTPHHPLDPLTVKEINRVRTILTSHELFKNSFPYAFHSITLTQKITCPELE 124 (126) Q Consensus 72 ~~~~~~HPLDPLT~~EI~~A~~ILr~~~~~~~~~~~rF~~V~L~EP~K~evl~ 124 (126) ...++.|||||||++||++|++|||+++++ +..++|++|+|+||+|++|++ T Consensus 8 ~~~~~~HPLdpLt~~Ei~~a~~iv~~~~~~--~~~~~F~~i~L~EP~K~~v~~ 58 (647) T PRK11504 8 TAAAVSHPLDPLTAAEIEAAVAILRAEGLL--GESTRFVSIELAEPPKAEVLA 58 (647) T ss_pred cCCCCCCCCCCCCHHHHHHHHHHHHhcccc--CCceEEEEeeccCCCHHHHHh Confidence 345566999999999999999999999876 468999999999999999986 No 3 >PRK14696 tynA tyramine oxidase; Provisional Probab=99.11 E-value=8.2e-11 Score=107.90 Aligned_cols=50 Identities=24% Similarity=0.310 Sum_probs=43.8 Q ss_pred CCCCCCCCCCCCHHHHHHHHHHHHhcCCCCCCCCeeEEEEecCCCCChhhhh Q 035637 73 SDTPHHPLDPLTVKEINRVRTILTSHELFKNSFPYAFHSITLTQKITCPELE 124 (126) Q Consensus 73 ~~~~~HPLDPLT~~EI~~A~~ILr~~~~~~~~~~~rF~~V~L~EP~K~evl~ 124 (126) .+.+.|||||||++||++|++||+++++. +.+++|++|+|+||+|++|++ T Consensus 83 ~~~~~HPLdpLt~~Ei~~a~~iv~~~~~~--~~~~~F~~i~L~EP~K~~v~~ 132 (721) T PRK14696 83 VEKRPHPLNALTADEIKQAVEIVKASADF--KPNTRFTEISLKEPDKEAVWA 132 (721) T ss_pred ecCCCCCCCCCCHHHHHHHHHHHHhcccc--CCceEEEEEEecCCCcHHHHH Confidence 34456999999999999999999999754 357999999999999999875 No 4 >PLN02566 amine oxidase (copper-containing) Probab=99.07 E-value=1.7e-10 Score=104.74 Aligned_cols=47 Identities=34% Similarity=0.482 Sum_probs=41.6 Q ss_pred CCCCCCCCHHHHHHHHHHHHhcCCCCCCCCeeEEEEecCCCCChhhhh Q 035637 77 HHPLDPLTVKEINRVRTILTSHELFKNSFPYAFHSITLTQKITCPELE 124 (126) Q Consensus 77 ~HPLDPLT~~EI~~A~~ILr~~~~~~~~~~~rF~~V~L~EP~K~evl~ 124 (126) .|||||||++||++|++||+++++.. ...++|++|+|+||+|++|+. T Consensus 21 ~HPLdpLs~~Ei~~a~~iv~~~~~~~-~~~~~F~~i~L~EP~K~~v~~ 67 (646) T PLN02566 21 YHPLDPLNPQEINKIRLIVQKSHLGN-LPNLTFHFLDLEEPEKRDVLK 67 (646) T ss_pred CCCCCCCCHHHHHHHHHHHHhhccCC-CCceEEEEEEccCCChHHHHh Confidence 49999999999999999999998521 247999999999999999875 No 5 >COG3733 TynA Cu2+-containing amine oxidase [Secondary metabolites biosynthesis, transport, and catabolism] Probab=98.98 E-value=6.2e-10 Score=100.17 Aligned_cols=50 Identities=32% Similarity=0.447 Sum_probs=45.4 Q ss_pred CCCCCCCCCCCHHHHHHHHHHHHhcCCCCCCCCeeEEEEecCCCCChhhhhc Q 035637 74 DTPHHPLDPLTVKEINRVRTILTSHELFKNSFPYAFHSITLTQKITCPELEQ 125 (126) Q Consensus 74 ~~~~HPLDPLT~~EI~~A~~ILr~~~~~~~~~~~rF~~V~L~EP~K~evl~~ 125 (126) +...|||||||++||..|++|||+...+ ++.++|..|+|.||+|++|++- T Consensus 26 k~~shPLdpLt~~Eik~aVEivr~e~~~--~~~~~F~~VtL~eP~K~~v~~f 75 (654) T COG3733 26 KERSHPLDPLTADEIKQAVEIVRAEADF--KKNFAFTEVTLLEPDKQEVLAF 75 (654) T ss_pred cccCCCCCccCHHHHHHHHHHHHhhccc--CCceeeEEEEecCCchHHHHHH Confidence 3356999999999999999999999987 4789999999999999999874 No 6 >KOG1186 consensus Copper amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Probab=98.47 E-value=2.9e-07 Score=84.23 Aligned_cols=60 Identities=25% Similarity=0.320 Sum_probs=54.6 Q ss_pred CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCCCCCeeEEEEecCCCCChhhh Q 035637 64 STSHHHDHASDTPHHPLDPLTVKEINRVRTILTSHELFKNSFPYAFHSITLTQKITCPEL 123 (126) Q Consensus 64 ~~~~~~~~~~~~~~HPLDPLT~~EI~~A~~ILr~~~~~~~~~~~rF~~V~L~EP~K~evl 123 (126) ..++.++++.+.+.|||||||+.||++++.||+..++++......|++|.|.||.|+-++ T Consensus 14 ~~~~~~~~s~~~p~hPlDPLte~EL~kvr~iL~~~d~~s~~~~~~~~av~l~eP~K~~vl 73 (670) T KOG1186|consen 14 LGPGLVSASQERPSHPLDPLTELELPKVAAILAHLDPGSPHPAFEAVAVVLFEPQKQPVL 73 (670) T ss_pred cccccccccCCCCCCCcCccchhhhhHHHHHHhhcccCCCCCceEEEEEEecCCCcCccc Confidence 568889999999999999999999999999999998876557889999999999998776 No 7 >PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress []. Probab=55.83 E-value=6.3 Score=28.16 Aligned_cols=21 Identities=33% Similarity=0.453 Sum_probs=11.4 Q ss_pred CcchhhHHHHHHHHhhhhhheeec Q 035637 1 MESRHYIRFLFFFVGIATLLAITW 24 (126) Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~ 24 (126) |-||.+ +||.+-+++||||++ T Consensus 1 MaSK~~---llL~l~LA~lLlisS 21 (95) T PF07172_consen 1 MASKAF---LLLGLLLAALLLISS 21 (95) T ss_pred CchhHH---HHHHHHHHHHHHHHh Confidence 566663 344444556666643 No 8 >PF06698 DUF1192: Protein of unknown function (DUF1192); InterPro: IPR009579 This family consists of several short, hypothetical, bacterial proteins of around 60 residues in length. The function of this family is unknown. Probab=40.69 E-value=48 Score=22.03 Aligned_cols=23 Identities=22% Similarity=0.286 Sum_probs=18.1 Q ss_pred CCCCCCCCCCHHHHHHHHHHHHh Q 035637 75 TPHHPLDPLTVKEINRVRTILTS 97 (126) Q Consensus 75 ~~~HPLDPLT~~EI~~A~~ILr~ 97 (126) ....+|++||.+|+..=.++|++ T Consensus 13 ~ig~dLs~lSv~EL~~RIa~L~a 35 (59) T PF06698_consen 13 EIGEDLSLLSVEELEERIALLEA 35 (59) T ss_pred ccCCCchhcCHHHHHHHHHHHHH Confidence 44578999999999977776664 No 9 >cd08764 Cyt_b561_CG1275_like Non-vertebrate eumetazoan cytochrome b(561). Cytochrome b(561), as found in non-vertebrate eumetazoans, similar to the Drosophila melanogaster CG1275 gene product. This protein might act as a ferric-chelate reductase, catalyzing the reduction of Fe(3+) to Fe(2+), such as associated with the transport of iron from the endosome to the cytoplasm. It is assumed that this protein uses ascorbate as the electron donor. Belongs to the cytochrome b(561) family, which are secretory vesicle-specific electron transport proteins. Cytochromes b(561) are integral membrane proteins that bind two heme groups non-covalently, and may have six alpha-helical trans-membrane segments. Probab=40.46 E-value=25 Score=28.53 Aligned_cols=33 Identities=12% Similarity=0.193 Sum_probs=27.4 Q ss_pred hhHHHHHHHHhhhhhheeecCCCCCCCCCCCCc Q 035637 5 HYIRFLFFFVGIATLLAITWNNLPYAPPDATED 37 (126) Q Consensus 5 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 37 (126) |.+.++.+++|+.++.+++++.++++|++.-+. T Consensus 177 N~~gl~~~~fg~~V~~~~~~~~~kr~~~~~~~~ 209 (214) T cd08764 177 NFIGIVLVIFGGLVVYLVTEPDYKRIELPEEEE 209 (214) T ss_pred HHHHHHHHHHHHHHHHhccCcccCCCCCchhhh Confidence 567888899999999999999999997765443 No 10 >PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants. The enzyme catalyses the condensation of L-aspartate-beta- semialdehyde and pyruvate to dihydropicolinic acid via a ping-pong mechanism in which pyruvate binds to the enzyme by forming a Schiff-base with a lysine residue []. Three other proteins are structurally related to DHDPS and probably also act via a similar catalytic mechanism. These are Escherichia coli N-acetylneuraminate lyase (4.1.3.3 from EC) (gene nanA), which catalyzes the condensation of N-acetyl-D-mannosamine and pyruvate to form N-acetylneuraminate; Rhizobium meliloti (Sinorhizobium meliloti) protein mosA [], which is involved in the biosynthesis of the rhizopine 3-o-methyl-scyllo-inosamine; and E. coli hypothetical protein yjhH. The sequences of DHDPS from different sources are well-conserved. The structure takes the form of a homotetramer, in which 2 monomers are related by an approximate 2-fold symmetry []. Each monomer comprises 2 domains: an 8-fold alpha-/beta-barrel, and a C-terminal alpha-helical domain. The fold resembles that of N-acetylneuraminate lyase. The active site lysine is located in the barrel domain, and has access via 2 channels on the C-terminal side of the barrel.; GO: 0016829 lyase activity, 0008152 metabolic process; PDB: 3B4U_B 3S8H_A 3QZE_B 1XXX_F 3L21_F 3IRD_A 3A5F_B 3G0S_B 3DAQ_C 3UQN_A .... Probab=33.60 E-value=42 Score=26.95 Aligned_cols=24 Identities=29% Similarity=0.439 Sum_probs=18.3 Q ss_pred CCCCCCCCCCHHHHHHHHHHHHhc Q 035637 75 TPHHPLDPLTVKEINRVRTILTSH 98 (126) Q Consensus 75 ~~~HPLDPLT~~EI~~A~~ILr~~ 98 (126) .++.||.+|+++|.++..+++++. T Consensus 265 ~~R~Pl~~l~~~~~~~l~~~l~~~ 288 (289) T PF00701_consen 265 PVRPPLLPLSDEEKEELKEILKEA 288 (289) T ss_dssp B--TTS-SS-HHHHHHHHHHHHHT T ss_pred CCCCCCCCCCHHHHHHHHHHHHhC Confidence 378999999999999999999875 No 11 >PF11148 DUF2922: Protein of unknown function (DUF2922); InterPro: IPR021321 This bacterial family of proteins has no known function. Probab=31.56 E-value=70 Score=20.90 Aligned_cols=27 Identities=19% Similarity=0.337 Sum_probs=22.6 Q ss_pred CCCCCCCCCHHHHHHHHHHHHhcCCCC Q 035637 76 PHHPLDPLTVKEINRVRTILTSHELFK 102 (126) Q Consensus 76 ~~HPLDPLT~~EI~~A~~ILr~~~~~~ 102 (126) ..+|-|.|+.+||+.+.+.+-+...|. T Consensus 19 i~~pk~~lt~~~V~~~m~~ii~~~vf~ 45 (69) T PF11148_consen 19 IPNPKEDLTEAEVKAAMQAIIAKKVFA 45 (69) T ss_pred cCCCCCCCCHHHHHHHHHHHHHhCCee Confidence 468999999999999988888776654 No 12 >cd02062 Nitro_FMN_reductase Proteins of this family catalyze the reduction of flavin or nitrocompounds using NAD(P)H as electron donor in a obligatory two-electron transfer, utilizing FMN or FAD as cofactor. They are often found to be homodimers. Enzymes of this family are described as NAD(P)H:FMN oxidoreductases, oxygen-insensitive nitroreductase, flavin reductase P, dihydropteridine reductase, NADH oxidase or NADH dehydrogenase. Probab=27.77 E-value=1.7e+02 Score=19.45 Aligned_cols=32 Identities=13% Similarity=0.213 Sum_probs=22.4 Q ss_pred CCCCHHHHHHHHHHHHhcCCCCCCCCeeEEEE Q 035637 81 DPLTVKEINRVRTILTSHELFKNSFPYAFHSI 112 (126) Q Consensus 81 DPLT~~EI~~A~~ILr~~~~~~~~~~~rF~~V 112 (126) +|+++++|+......+.+........++|..| T Consensus 13 ~~i~~~~l~~l~~~~~~aPs~~n~qp~~~~~v 44 (122) T cd02062 13 EPVPEEVLEKILEAARYAPSGGNLQPWRFVVV 44 (122) T ss_pred CCCCHHHHHHHHHHHHhCCCcCCCCCEEEEEE Confidence 38899999999888887654322246677665 No 13 >PF04270 Strep_his_triad: Streptococcal histidine triad protein ; InterPro: IPR006270 This entry represents a repeated sequence region that includes a His-X-X-His-X-His (histidine triad) motif, which is found in family of Streptococcal proteins. Members of the family are suggested to cleave human complement component 3, and family member PhpA has been shown in vaccine studies to be a protective antigen in mice []. ; PDB: 2CS7_C. Probab=26.53 E-value=39 Score=22.06 Aligned_cols=19 Identities=21% Similarity=0.424 Sum_probs=15.0 Q ss_pred CCCCCCHHHHHHHHHHHHh Q 035637 79 PLDPLTVKEINRVRTILTS 97 (126) Q Consensus 79 PLDPLT~~EI~~A~~ILr~ 97 (126) |...||+.|+.+|.+.++. T Consensus 34 ~k~dLs~~E~~aA~~~~~~ 52 (53) T PF04270_consen 34 PKSDLSASELKAAQAYLAG 52 (53) T ss_dssp EGGGS-HHHHHHHHHHHH- T ss_pred chhhCCHHHHHHHHHHHhc Confidence 6788999999999988764 No 14 >TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-dehydro-4-deoxyglucarate dehydratase not only catalyzes the dehydration of the substrate (diol to ketone + water), but causes the decarboxylation of the intermediate product to yield 2-oxoglutarate semialdehyde (2,5-dioxopentanoate). The gene for the enzyme is usually observed in the vicinity of transporters and dehydratases handling D-galactarate and D-gluconate as well as aldehyde dehydrogenases which convert the product to alpha-ketoglutarate. Probab=24.24 E-value=94 Score=25.34 Aligned_cols=25 Identities=28% Similarity=0.381 Sum_probs=21.3 Q ss_pred CCCCCCCCCCCHHHHHHHHHHHHhc Q 035637 74 DTPHHPLDPLTVKEINRVRTILTSH 98 (126) Q Consensus 74 ~~~~HPLDPLT~~EI~~A~~ILr~~ 98 (126) ..+++|+.+|+++|..+..+++++. T Consensus 271 g~~R~Pl~~l~~~~~~~i~~~l~~~ 295 (296) T TIGR03249 271 GPVRPPLTDLTKEEYAQLEVILKKA 295 (296) T ss_pred CCCCCCCCCCCHHHHHHHHHHHHhc Confidence 3468999999999999999888764 No 15 >PF07315 DUF1462: Protein of unknown function (DUF1462); InterPro: IPR009190 There are currently no experimental data for members of this group of bacterial proteins or their homologues. A crystal structure of Q7A6J8 from SWISSPROT revealed a thioredoxin-like fold, its core consisting of three layers alpha/beta/alpha.; PDB: 1XG8_A. Probab=24.12 E-value=1.2e+02 Score=22.19 Aligned_cols=27 Identities=15% Similarity=0.208 Sum_probs=15.9 Q ss_pred HHHHHhcCCCCCCCCeeEEEEecCCCCChh Q 035637 92 RTILTSHELFKNSFPYAFHSITLTQKITCP 121 (126) Q Consensus 92 ~~ILr~~~~~~~~~~~rF~~V~L~EP~K~e 121 (126) .+.|++.++ ..++.|.||...+|+..+ T Consensus 26 ~aal~RKyp---~~~f~~~YiDi~~p~~~~ 52 (93) T PF07315_consen 26 EAALKRKYP---DQPFEFTYIDIENPPEND 52 (93) T ss_dssp HHHHHHH-T---TS-EEEEEEETTT----H T ss_pred HHHHhCcCC---CCceEEEEEecCCCCccH Confidence 444666666 468999999999999863 No 16 >KOG2096 consensus WD40 repeat protein [General function prediction only] Probab=22.67 E-value=99 Score=27.70 Aligned_cols=30 Identities=13% Similarity=0.142 Sum_probs=25.3 Q ss_pred CcchhhHHHHHHHHhhhhhheeecCCCCCC Q 035637 1 MESRHYIRFLFFFVGIATLLAITWNNLPYA 30 (126) Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 30 (126) |.+-++..|+-+++|++++..+...-+.+- T Consensus 1 mdsv~l~~l~~~l~g~~~a~g~~~~y~~k~ 30 (420) T KOG2096|consen 1 IDSVSLPILIGGLVGFVTVMGVAIIYVAKK 30 (420) T ss_pred CCcchHHHHHHHHHHHHHHHHHHhhheecc Confidence 677889999999999999999988777544 No 17 >COG4837 Uncharacterized protein conserved in bacteria [Function unknown] Probab=20.54 E-value=2.3e+02 Score=20.99 Aligned_cols=27 Identities=15% Similarity=0.187 Sum_probs=20.7 Q ss_pred HHHHHhcCCCCCCCCeeEEEEecCCCCChh Q 035637 92 RTILTSHELFKNSFPYAFHSITLTQKITCP 121 (126) Q Consensus 92 ~~ILr~~~~~~~~~~~rF~~V~L~EP~K~e 121 (126) .+.|++.++ +.+++|.||...+|+-.+ T Consensus 33 eaalkRKyp---~~~F~~~YiDI~n~~~e~ 59 (106) T COG4837 33 EAALKRKYP---NQPFKYTYIDITNPPLED 59 (106) T ss_pred HHHHhccCC---CCCcEEEEEEcCCCccHH Confidence 455777777 568999999998887654 Done!