Citrus Sinensis ID: 035641

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----

MEKKLVTLFGAAKKAADAAAATNRSEPEVQRCADALKHLQAFPVTYDLLVSTQVGKSLRHLKKHPCEKVQNAASELLHIWKQKIVLGKETNGNKRNGSKLSVDEKFQKQTSDSNAVKSGCSTAKEKKATASIRKPSHADQAKDSMRDKIRKDLEKALSRVASEAADDEEITDRVKARDPKQVAASVERVMFEKLRPMGVAEKRKHRSIMFNMSDEKNPDLRRRVLIGEVTPERLATMTPEELASDERRQENEEIKAKFMFKCEVPEKKKGTTDQFKCSGCGKSNCSYHQMQTRSADEPMTTYVTCAECNKRWKC

cHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHcccccEEcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccEEcccccccccEEEcEEccccccccCEEEEcccccccccc

**KKLVTLFG********************RCADALKHLQAFPVTYDLLVSTQVGKSLRHLKKHPCEKVQNAASELLHIWKQKIVL***************************************************ADQAKDSMRDKIRKDLEKALSRVASEAADDEEITDRVKARDPKQVAASVERVMFEKLRPMGVAEKRKHRSIMFNMSDEKNPDLRRRVLIGEVTPERLATMTPEELASDERRQENEEI***FMFKC**************CSGCGKSNCSYHQMQTRSADEPMTTYVTCAECNKRWKC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription elongation factor A protein 1	Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.	probable	P10711
Transcription elongation factor A protein 1	Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.	probable	P23193
Putative transcription elongation factor S-II	Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.	probable	P52652

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PQV, chain S
Confidence level:very confident
Coverage over the Query: 135-166,178-314
View the alignment between query and template
View the model in PyMOL