BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035663
         (297 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3Q7R|A Chain A, 1.6a Resolution Structure Of The Chxr Receiver Domain From
           Chlamydia Trachomatis
 pdb|3Q7R|B Chain B, 1.6a Resolution Structure Of The Chxr Receiver Domain From
           Chlamydia Trachomatis
 pdb|3Q7S|A Chain A, 2.1a Resolution Structure Of The Chxr Receiver Domain
           Containing I3c From Chlamydia Trachomatis
 pdb|3Q7S|B Chain B, 2.1a Resolution Structure Of The Chxr Receiver Domain
           Containing I3c From Chlamydia Trachomatis
 pdb|3Q7T|A Chain A, 2.15a Resolution Structure (I41 Form) Of The Chxr Receiver
           Domain From Chlamydia Trachomatis
 pdb|3Q7T|B Chain B, 2.15a Resolution Structure (I41 Form) Of The Chxr Receiver
           Domain From Chlamydia Trachomatis
          Length = 121

 Score = 29.3 bits (64), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 239 PHEYCCNARYNYLVELNSDLFIVSRFLIPHK-SYPCELTCAFIVCKLDLETEK 290
           P EY C     Y  EL++DL +    L+P +   P  L  +F++  LD   E+
Sbjct: 34  PEEYRCTIGQQYKQELSADLVVCEYSLLPREIRSPKSLEGSFVLVLLDFFDEE 86


>pdb|1KQF|B Chain B, Formate Dehydrogenase N From E. Coli
 pdb|1KQG|B Chain B, Formate Dehydrogenase N From E. Coli
          Length = 294

 Score = 28.5 bits (62), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 15/32 (46%)

Query: 20 IQKLIDSDDILNCAVCAAVCSSWQSVVKDLYH 51
          + KLID    + C  C   CS W  +  ++ H
Sbjct: 30 VAKLIDVSTCIGCKACQVACSEWNDIRDEVGH 61


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.139    0.465 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,254,995
Number of Sequences: 62578
Number of extensions: 349501
Number of successful extensions: 841
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 839
Number of HSP's gapped (non-prelim): 3
length of query: 297
length of database: 14,973,337
effective HSP length: 98
effective length of query: 199
effective length of database: 8,840,693
effective search space: 1759297907
effective search space used: 1759297907
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)