BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035684
         (38 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3THT|A Chain A, Crystal Structure And Rna Binding Properties Of The
           RrmALKB DOMAINS In Human Abh8, An Enzyme Catalyzing Trna
           Hypermodification, Northeast Structural Genomics
           Consortium Target Hr5601b
 pdb|3THT|B Chain B, Crystal Structure And Rna Binding Properties Of The
           RrmALKB DOMAINS In Human Abh8, An Enzyme Catalyzing Trna
           Hypermodification, Northeast Structural Genomics
           Consortium Target Hr5601b
 pdb|3THT|C Chain C, Crystal Structure And Rna Binding Properties Of The
           RrmALKB DOMAINS In Human Abh8, An Enzyme Catalyzing Trna
           Hypermodification, Northeast Structural Genomics
           Consortium Target Hr5601b
 pdb|3THT|D Chain D, Crystal Structure And Rna Binding Properties Of The
           RrmALKB DOMAINS In Human Abh8, An Enzyme Catalyzing Trna
           Hypermodification, Northeast Structural Genomics
           Consortium Target Hr5601b
          Length = 345

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 24/37 (64%)

Query: 2   VNDTVIRRASRRVSFTFRKVREGPCRCKFPQYCDSQK 38
           V D  + +   R SFTFRKVR+ PC C +P  CDSQ+
Sbjct: 293 VGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQR 329


>pdb|3THP|A Chain A, Crystal Structure And Rna Binding Properties Of The
           RrmALKB DOMAINS In Human Abh8, An Enzyme Catalyzing Trna
           Hypermodification, Northeast Structural Genomics
           Consortium Target Hr5601b
          Length = 345

 Score = 49.3 bits (116), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 24/37 (64%)

Query: 2   VNDTVIRRASRRVSFTFRKVREGPCRCKFPQYCDSQK 38
           V D  + +   R SFTFRKVR+ PC C +P  CDSQ+
Sbjct: 293 VGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQR 329


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.331    0.138    0.448 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 932,413
Number of Sequences: 62578
Number of extensions: 15794
Number of successful extensions: 25
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 23
Number of HSP's gapped (non-prelim): 2
length of query: 38
length of database: 14,973,337
effective HSP length: 12
effective length of query: 26
effective length of database: 14,222,401
effective search space: 369782426
effective search space used: 369782426
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 45 (21.9 bits)