Query         035689
Match_columns 95
No_of_seqs    112 out of 594
Neff          6.6 
Searched_HMMs 46136
Date          Fri Mar 29 05:22:37 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035689.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035689hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02629 powdery mildew resist  99.9 1.9E-28 4.2E-33  189.4   6.8   86    1-95    167-252 (387)
  2 PF13839 PC-Esterase:  GDSL/SGN  99.2 9.5E-12   2E-16   89.1   4.6   70    1-95     67-140 (263)
  3 cd01842 SGNH_hydrolase_like_5   56.4       6 0.00013   28.4   1.1   10   46-55     52-61  (183)
  4 PF00919 UPF0004:  Uncharacteri  49.8     9.7 0.00021   24.2   1.2   11   43-53     35-45  (98)
  5 PF12367 PFO_beta_C:  Pyruvate   36.6      20 0.00043   21.5   1.0   32   50-93      7-38  (67)
  6 PRK08955 glyceraldehyde-3-phos  29.9      33 0.00072   26.5   1.5   15   41-55     85-99  (334)
  7 PF14453 ThiS-like:  ThiS-like   29.2      43 0.00093   19.5   1.6   11   42-52     26-36  (57)
  8 PF11810 DUF3332:  Domain of un  26.5      24 0.00052   25.0   0.2   14   44-57     61-74  (176)
  9 PF03720 UDPG_MGDP_dh_C:  UDP-g  25.4      38 0.00083   21.2   1.0   20   39-58     61-80  (106)
 10 KOG4530 Predicted flavoprotein  23.7      35 0.00076   24.5   0.6   28   28-55     70-97  (199)
 11 PRK15425 gapA glyceraldehyde-3  21.7      56  0.0012   25.3   1.5   12   44-55     89-100 (331)
 12 PF00056 Ldh_1_N:  lactate/mala  21.7      65  0.0014   21.3   1.6   18   39-56     64-81  (141)
 13 PF13454 NAD_binding_9:  FAD-NA  20.3      63  0.0014   21.5   1.3   11   44-54    145-155 (156)
 14 PRK09739 hypothetical protein;  20.3      54  0.0012   22.7   1.0   24   37-60     72-95  (199)

No 1  
>PLN02629 powdery mildew resistance 5
Probab=99.95  E-value=1.9e-28  Score=189.45  Aligned_cols=86  Identities=20%  Similarity=0.242  Sum_probs=77.6

Q ss_pred             CccEEEEEecccccccccccCCCcceeEEEecCCCchHhhhcCCCcEEEEccCcccccCCCCCCCCCCceeeccCccccC
Q 035689            1 TGTPVQSRWLANANGGELEALGYKEGYRVDVDVPDSTWAKAASFHDILIFNTGHWWWAPAKFDPVKSPMLFFEKDKPVIP   80 (95)
Q Consensus         1 ~n~TV~~yWspfLV~~~~~~~~~~~~~~l~LD~~d~~W~~~w~~~DvlVfntghWw~~~~k~~~~~~~~~~~~~g~~v~~   80 (95)
                      +||||+||||||||+++++    .+.+.|+||+++++ +++|+++|||||||||||++++    ..+++.|++.|..+++
T Consensus       167 yN~TV~~ywspfLV~~~~~----~~~~~l~LD~id~~-a~~w~~~DvlVfntghWw~~~~----~~~~~~~~~~g~~~~~  237 (387)
T PLN02629        167 YGVSISFYKAPYLVDIDAV----QGKRVLKLEEISGN-ANAWRDADVLIFNTGHWWSHQG----SLQGWDYIESGGTYYQ  237 (387)
T ss_pred             CCEEEEEEecceEEeeecC----CCceeEEecCcchh-hhhhccCCEEEEeCccccCCCC----eeEEeeeeccCCcccc
Confidence            6999999999999998753    24578999999986 9999999999999999997776    4678899999999999


Q ss_pred             CCChHHHHHHHHhcC
Q 035689           81 PVQPNVGLDMVLKHM   95 (95)
Q Consensus        81 ~~~~~~a~r~alrt~   95 (95)
                      +|++.+|||+||+||
T Consensus       238 ~~~~~~A~r~al~T~  252 (387)
T PLN02629        238 DMDRLVALEKALRTW  252 (387)
T ss_pred             CccHHHHHHHHHHHH
Confidence            999999999999997


No 2  
>PF13839 PC-Esterase:  GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p
Probab=99.24  E-value=9.5e-12  Score=89.07  Aligned_cols=70  Identities=17%  Similarity=0.265  Sum_probs=54.1

Q ss_pred             CccEEEEEecccccccccccCCCcceeEEEecCCCchHhhhcC----CCcEEEEccCcccccCCCCCCCCCCceeeccCc
Q 035689            1 TGTPVQSRWLANANGGELEALGYKEGYRVDVDVPDSTWAKAAS----FHDILIFNTGHWWWAPAKFDPVKSPMLFFEKDK   76 (95)
Q Consensus         1 ~n~TV~~yWspfLV~~~~~~~~~~~~~~l~LD~~d~~W~~~w~----~~DvlVfntghWw~~~~k~~~~~~~~~~~~~g~   76 (95)
                      +|+||+|+|+|||++.              +|.+++.+++.|.    ..||||||+|+||.+..         .++..|+
T Consensus        67 ~~~~~~f~~~p~l~~~--------------l~~~~~~~~~~~~~~~~~pdvvV~nsG~W~~~~~---------~~~~~~~  123 (263)
T PF13839_consen   67 YNVTLSFYWDPFLVDQ--------------LDSIDEEIANNWPTSGARPDVVVINSGLWYLRRS---------GFIEWGD  123 (263)
T ss_pred             CCeEEEEecccccccc--------------ccccchhhhccccccccCCCEEEEEcchhhhhcc---------hhcccCC
Confidence            5899999999999975              5566645566666    89999999999997654         3444444


Q ss_pred             cccCCCChHHHHHHHHhcC
Q 035689           77 PVIPPVQPNVGLDMVLKHM   95 (95)
Q Consensus        77 ~v~~~~~~~~a~r~alrt~   95 (95)
                      .  .+++...+|+..|+++
T Consensus       124 ~--~~~~~~~~y~~~l~~~  140 (263)
T PF13839_consen  124 N--KEINPLEAYRNRLRTL  140 (263)
T ss_pred             C--cCcchHHHHHHHHHHH
Confidence            4  7778889999998864


No 3  
>cd01842 SGNH_hydrolase_like_5 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=56.35  E-value=6  Score=28.39  Aligned_cols=10  Identities=40%  Similarity=1.016  Sum_probs=9.9

Q ss_pred             cEEEEccCcc
Q 035689           46 DILIFNTGHW   55 (95)
Q Consensus        46 DvlVfntghW   55 (95)
                      ||+|||+|-|
T Consensus        52 DVIi~Ns~LW   61 (183)
T cd01842          52 DLVIMNSCLW   61 (183)
T ss_pred             eEEEEeccee
Confidence            9999999999


No 4  
>PF00919 UPF0004:  Uncharacterized protein family UPF0004;  InterPro: IPR013848  The methylthiotransferase (MTTase) or miaB-like family is named after the (dimethylallyl)adenosine tRNA MTTase miaB protein, which catalyses a C-H to C-S bond conversion in the methylthiolation of tRNA. A related bacterial enzyme rimO performs a similar methylthiolation, but on a protein substrate. RimO acts on the ribosomal protein S12 and forms a separate MTTase subfamily. The miaB-subfamily includes mammalian CDK5 regulatory subunit-associated proteins and similar proteins in other eukaryotes. Two other subfamilies, yqeV and CDKAL1, are named after a Bacillus subtilis and a human protein, respectively. While yqeV-like proteins are found in bacteria, CDKAL1 subfamily members occur in eukaryotes and in archaebacteria. The likely MTTases from these 4 subfamilies contain an N-terminal MTTase domain, a central radical generating fold and a C-terminal TRAM domain (see PDOC50926 from PROSITEDOC). The core forms a radical SAM fold (or AdoMet radical), containing a cysteine motif CxxxCxxC that binds a [4Fe-4S] cluster [, , ]. A reducing equivalent from the [4Fe-4S]+ cluster is used to cleave S-adenosylmethionine (SAM) to generate methionine and a 5'-deoxyadenosyl radical. The latter is thought to produce a reactive substrate radical that is amenable to sulphur insertion [, ]. The N-terminal MTTase domain contains 3 cysteines that bind a second [4Fe-4S] cluster, in addition to the radical-generating [4Fe-4S] cluster, which could be involved in the thiolation reaction. The C-terminal TRAM domain is not shared with other radical SAM proteins outside the MTTase family. The TRAM domain can bind to RNA substrate and seems to be important for substrate recognition. The tertiary structure of the central radical SAM fold has six beta/alpha motifs resembling a three-quarter TIM barrel core (see PDOC00155 from PROSITEDOC) []. The N-terminal MTTase domain might form an additional [beta/alpha]2 TIM barrel unit []. ; GO: 0003824 catalytic activity, 0051539 4 iron, 4 sulfur cluster binding, 0009451 RNA modification
Probab=49.81  E-value=9.7  Score=24.17  Aligned_cols=11  Identities=36%  Similarity=0.468  Sum_probs=9.3

Q ss_pred             CCCcEEEEccC
Q 035689           43 SFHDILIFNTG   53 (95)
Q Consensus        43 ~~~DvlVfntg   53 (95)
                      ..||++|+||=
T Consensus        35 e~AD~iiiNTC   45 (98)
T PF00919_consen   35 EEADVIIINTC   45 (98)
T ss_pred             ccCCEEEEEcC
Confidence            57899999983


No 5  
>PF12367 PFO_beta_C:  Pyruvate ferredoxin oxidoreductase beta subunit C terminal
Probab=36.62  E-value=20  Score=21.49  Aligned_cols=32  Identities=13%  Similarity=0.314  Sum_probs=19.7

Q ss_pred             EccCcccccCCCCCCCCCCceeeccCccccCCCChHHHHHHHHh
Q 035689           50 FNTGHWWWAPAKFDPVKSPMLFFEKDKPVIPPVQPNVGLDMVLK   93 (95)
Q Consensus        50 fntghWw~~~~k~~~~~~~~~~~~~g~~v~~~~~~~~a~r~alr   93 (95)
                      +||+.|+ +..         +|.-+.  -...-+...|+++|+.
T Consensus         7 ~nT~~wY-~~r---------vy~l~e--~~Dp~d~~~A~~~a~e   38 (67)
T PF12367_consen    7 INTYDWY-KER---------VYKLDE--DHDPSDREAAMEKARE   38 (67)
T ss_pred             cchHHHH-HHh---------eEECCC--CCCchhHHHHHHHHHh
Confidence            4888888 433         444311  2344577888888875


No 6  
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated
Probab=29.92  E-value=33  Score=26.53  Aligned_cols=15  Identities=27%  Similarity=0.142  Sum_probs=13.0

Q ss_pred             hcCCCcEEEEccCcc
Q 035689           41 AASFHDILIFNTGHW   55 (95)
Q Consensus        41 ~w~~~DvlVfntghW   55 (95)
                      .|.++||++|+||.-
T Consensus        85 ~w~gvDiVle~tG~~   99 (334)
T PRK08955         85 DWSGCDVVIEASGVM   99 (334)
T ss_pred             CccCCCEEEEccchh
Confidence            356999999999996


No 7  
>PF14453 ThiS-like:  ThiS-like ubiquitin 
Probab=29.21  E-value=43  Score=19.51  Aligned_cols=11  Identities=36%  Similarity=0.422  Sum_probs=9.6

Q ss_pred             cCCCcEEEEcc
Q 035689           42 ASFHDILIFNT   52 (95)
Q Consensus        42 w~~~DvlVfnt   52 (95)
                      -+++||+|+|.
T Consensus        26 k~~~DI~I~NG   36 (57)
T PF14453_consen   26 KPDADIVILNG   36 (57)
T ss_pred             CCCCCEEEEcC
Confidence            46899999999


No 8  
>PF11810 DUF3332:  Domain of unknown function (DUF3332);  InterPro: IPR021768  This family of proteins are functionally uncharacterised. This family is only found in bacteria. 
Probab=26.45  E-value=24  Score=24.99  Aligned_cols=14  Identities=36%  Similarity=0.911  Sum_probs=12.5

Q ss_pred             CCcEEEEccCcccc
Q 035689           44 FHDILIFNTGHWWW   57 (95)
Q Consensus        44 ~~DvlVfntghWw~   57 (95)
                      -+|++||||--.|.
T Consensus        61 ~aD~lVfNsIEFWT   74 (176)
T PF11810_consen   61 LADLLVFNSIEFWT   74 (176)
T ss_pred             hhhheeeeeeeeec
Confidence            37999999999994


No 9  
>PF03720 UDPG_MGDP_dh_C:  UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain;  InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]. The enzymes have a wide range of functions. In plants UDP-glucose dehydrogenase, 1.1.1.22 from EC, is an important enzyme in the synthesis of hemicellulose and pectin [], which are the components of newly formed cell walls; while in zebrafish UDP-glucose dehydrogenase is required for cardiac valve formation []. In Xanthomonas campestris, a plant pathogen, UDP-glucose dehydrogenase is required for virulence [].  GDP-mannose dehydrogenase, 1.1.1.132 from EC, catalyses the formation of GDP-mannuronic acid, which is the monomeric unit from which the exopolysaccharide alginate is formed. Alginate is secreted by a number of bacteria, which include Pseudomonas aeruginosa and Azotobacter vinelandii. In P. aeruginosa, alginate is believed to play an important role in the bacteria's resistance to antibiotics and the host immune response [], while in A. vinelandii it is essential for the encystment process []. This entry represents the C-terminal substrate-binding domain of these enzymes. Structural studies indicate that this domain forms an incomplete dinucleotide binding fold [, ].; GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, 0051287 NAD binding, 0055114 oxidation-reduction process; PDB: 3GG2_D 1DLI_A 1DLJ_A 2Y0E_D 2Y0D_B 2Y0C_D 1MV8_B 1MUU_A 1MFZ_C 3TDK_B ....
Probab=25.43  E-value=38  Score=21.25  Aligned_cols=20  Identities=20%  Similarity=0.154  Sum_probs=13.5

Q ss_pred             hhhcCCCcEEEEccCccccc
Q 035689           39 AKAASFHDILIFNTGHWWWA   58 (95)
Q Consensus        39 ~~~w~~~DvlVfntghWw~~   58 (95)
                      ....+++|++|+.|.|==++
T Consensus        61 ~~~~~~~D~vvl~t~h~~f~   80 (106)
T PF03720_consen   61 EEALKGADAVVLATDHDEFR   80 (106)
T ss_dssp             HHHHTTESEEEESS--GGGG
T ss_pred             HHHhcCCCEEEEEecCHHHh
Confidence            45567999999999875433


No 10 
>KOG4530 consensus Predicted flavoprotein [General function prediction only]
Probab=23.71  E-value=35  Score=24.46  Aligned_cols=28  Identities=14%  Similarity=0.208  Sum_probs=21.8

Q ss_pred             EEEecCCCchHhhhcCCCcEEEEccCcc
Q 035689           28 RVDVDVPDSTWAKAASFHDILIFNTGHW   55 (95)
Q Consensus        28 ~l~LD~~d~~W~~~w~~~DvlVfntghW   55 (95)
                      ..+-+..-+.|++.+.++|.+||-|=+-
T Consensus        70 d~y~~~~t~aw~~ki~~aD~ivFvtPqY   97 (199)
T KOG4530|consen   70 DEYYPPVTEAWRQKILEADSIVFVTPQY   97 (199)
T ss_pred             cccCcHHHHHHHHHHhhcceEEEecccc
Confidence            3445555678999999999999988654


No 11 
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional
Probab=21.73  E-value=56  Score=25.31  Aligned_cols=12  Identities=25%  Similarity=0.229  Sum_probs=11.4

Q ss_pred             CCcEEEEccCcc
Q 035689           44 FHDILIFNTGHW   55 (95)
Q Consensus        44 ~~DvlVfntghW   55 (95)
                      ++||++++||..
T Consensus        89 gvDiVle~tG~f  100 (331)
T PRK15425         89 GVDVVAEATGLF  100 (331)
T ss_pred             CCCEEEEecchh
Confidence            899999999986


No 12 
>PF00056 Ldh_1_N:  lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase;  InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis []. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate []. The enzyme participates in the citric acid cycle.  This entry represents the N-terminal, and is thought to be a Rossmann NAD-binding fold.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1IB6_B 3HHP_C 1IE3_A 2PWZ_A 1EMD_A 2CMD_A 1EZ4_D 9LDT_B 9LDB_B 2D4A_C ....
Probab=21.69  E-value=65  Score=21.35  Aligned_cols=18  Identities=22%  Similarity=0.163  Sum_probs=14.6

Q ss_pred             hhhcCCCcEEEEccCccc
Q 035689           39 AKAASFHDILIFNTGHWW   56 (95)
Q Consensus        39 ~~~w~~~DvlVfntghWw   56 (95)
                      -+..+++||+|+.+|---
T Consensus        64 ~~~~~~aDivvitag~~~   81 (141)
T PF00056_consen   64 YEALKDADIVVITAGVPR   81 (141)
T ss_dssp             GGGGTTESEEEETTSTSS
T ss_pred             ccccccccEEEEeccccc
Confidence            456789999999999753


No 13 
>PF13454 NAD_binding_9:  FAD-NAD(P)-binding
Probab=20.29  E-value=63  Score=21.45  Aligned_cols=11  Identities=36%  Similarity=0.655  Sum_probs=10.2

Q ss_pred             CCcEEEEccCc
Q 035689           44 FHDILIFNTGH   54 (95)
Q Consensus        44 ~~DvlVfntgh   54 (95)
                      .+|.+|+.+||
T Consensus       145 ~~d~VvLa~Gh  155 (156)
T PF13454_consen  145 RADAVVLATGH  155 (156)
T ss_pred             EeCEEEECCCC
Confidence            68999999998


No 14 
>PRK09739 hypothetical protein; Provisional
Probab=20.28  E-value=54  Score=22.73  Aligned_cols=24  Identities=25%  Similarity=0.504  Sum_probs=19.9

Q ss_pred             hHhhhcCCCcEEEEccCcccccCC
Q 035689           37 TWAKAASFHDILIFNTGHWWWAPA   60 (95)
Q Consensus        37 ~W~~~w~~~DvlVfntghWw~~~~   60 (95)
                      .+.+++..+|.+||.+=-||+...
T Consensus        72 ~~~~~l~~AD~iV~~~P~y~~~~P   95 (199)
T PRK09739         72 QLYSELLEHDALVFVFPLWWYSFP   95 (199)
T ss_pred             HHHHHHHhCCEEEEECchhhhcch
Confidence            357889999999999999987544


Done!