BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035692
         (154 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1DZ3|A Chain A, Domain-Swapping In The Sporulation Response Regulator
          Spo0a
          Length = 130

 Score = 30.0 bits (66), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 7  SRPILMVFGYAYPAYECFKAVEKNKPEI 34
          S+P + V G AY   +C + +E+ +P+I
Sbjct: 24 SQPDMEVIGTAYNGQDCLQMLEEKRPDI 51


>pdb|1QMP|A Chain A, Phosphorylated Aspartate In The Crystal Structure Of The
          Sporulation Response Regulator, Spo0a
 pdb|1QMP|B Chain B, Phosphorylated Aspartate In The Crystal Structure Of The
          Sporulation Response Regulator, Spo0a
 pdb|1QMP|C Chain C, Phosphorylated Aspartate In The Crystal Structure Of The
          Sporulation Response Regulator, Spo0a
 pdb|1QMP|D Chain D, Phosphorylated Aspartate In The Crystal Structure Of The
          Sporulation Response Regulator, Spo0a
          Length = 130

 Score = 30.0 bits (66), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 7  SRPILMVFGYAYPAYECFKAVEKNKPEI 34
          S+P + V G AY   +C + +E+ +P+I
Sbjct: 24 SQPDMEVIGTAYNGQDCLQMLEEKRPDI 51


>pdb|2DH4|A Chain A, Geranylgeranyl Pyrophosphate Synthase
 pdb|2DH4|B Chain B, Geranylgeranyl Pyrophosphate Synthase
 pdb|2E8T|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium, Fspp And Ipp
 pdb|2E8T|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium, Fspp And Ipp
 pdb|2E8U|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Ipp (P21)
 pdb|2E8U|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Ipp (P21)
 pdb|2E8V|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Product Ggpp (P21)
 pdb|2E8V|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Product Ggpp (P21)
 pdb|2E8W|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Ipp
 pdb|2E8W|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Ipp
 pdb|2E8X|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Gpp
 pdb|2E8X|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Gpp
 pdb|2E90|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium, Pyrophosphate And Fpp
 pdb|2E90|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium, Pyrophosphate And Fpp
 pdb|2E91|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-91
 pdb|2E91|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-91
 pdb|2E92|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-261
 pdb|2E92|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-261
 pdb|2E93|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Bph-629
 pdb|2E93|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Bph-629
 pdb|2E94|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-364
 pdb|2E94|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-364
 pdb|2E95|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-675
 pdb|2E95|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-675
 pdb|2Z7H|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Inhibitor Bph-210
 pdb|2Z7H|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Inhibitor Bph-210
 pdb|2Z4V|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Ggpp (Inhibitory Site)
 pdb|2Z4V|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Ggpp (Inhibitory Site)
 pdb|2Z4W|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-749
 pdb|2Z4W|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-749
 pdb|2Z4X|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-252 (P21)
 pdb|2Z4X|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-252 (P21)
 pdb|2Z4Y|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-252
 pdb|2Z4Y|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-252
 pdb|2Z4Z|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-Sc01
 pdb|2Z4Z|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-Sc01
 pdb|2Z50|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Bph-28
 pdb|2Z50|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Bph-28
 pdb|2Z52|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-23
 pdb|2Z52|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium And Bph-23
 pdb|2Z78|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Bph-806
 pdb|2Z78|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Bph-806
 pdb|2Z7I|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Inhibitor Bph-742
 pdb|2Z7I|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Inhibitor Bph-742
 pdb|2ZEU|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Bph-715
 pdb|2ZEU|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Bph-715
 pdb|2ZEV|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium, Ipp And Bph-715
 pdb|2ZEV|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
           Complex With Magnesium, Ipp And Bph-715
          Length = 340

 Score = 28.1 bits (61), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 68  SEAKLAFFIY--LWYPKTKGTTYVYNVLLRPYIAK-HEKEIDLNLLKL 112
           +E KL+F I   L + KTKG T  +N +LR  + +  +K+I L L+++
Sbjct: 235 TEGKLSFPIVHALNFTKTKGQTEQHNEILRILLLRTSDKDIKLKLIQI 282


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.141    0.453 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,557,106
Number of Sequences: 62578
Number of extensions: 172179
Number of successful extensions: 383
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 381
Number of HSP's gapped (non-prelim): 3
length of query: 154
length of database: 14,973,337
effective HSP length: 90
effective length of query: 64
effective length of database: 9,341,317
effective search space: 597844288
effective search space used: 597844288
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 47 (22.7 bits)