BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035696
         (405 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1G5I|A Chain A, Crystal Structure Of The Accessory Subunit Of Murine
           Mitochondrial Polymerase Gamma
 pdb|1G5I|B Chain B, Crystal Structure Of The Accessory Subunit Of Murine
           Mitochondrial Polymerase Gamma
 pdb|1G5I|C Chain C, Crystal Structure Of The Accessory Subunit Of Murine
           Mitochondrial Polymerase Gamma
 pdb|1G5I|D Chain D, Crystal Structure Of The Accessory Subunit Of Murine
           Mitochondrial Polymerase Gamma
          Length = 454

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 3/32 (9%)

Query: 334 SKRESRERKFLKRHPFASCVARFAVQLEVGEG 365
           ++++S +RK LK HP   C+A   V L+VG+G
Sbjct: 320 ARKKSLQRKVLKLHP---CLAPIKVALDVGKG 348


>pdb|1G5H|A Chain A, Crystal Structure Of The Accessory Subunit Of Murine
           Mitochondrial Polymerase Gamma
 pdb|1G5H|B Chain B, Crystal Structure Of The Accessory Subunit Of Murine
           Mitochondrial Polymerase Gamma
 pdb|1G5H|C Chain C, Crystal Structure Of The Accessory Subunit Of Murine
           Mitochondrial Polymerase Gamma
 pdb|1G5H|D Chain D, Crystal Structure Of The Accessory Subunit Of Murine
           Mitochondrial Polymerase Gamma
          Length = 454

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 3/32 (9%)

Query: 334 SKRESRERKFLKRHPFASCVARFAVQLEVGEG 365
           ++++S +RK LK HP   C+A   V L+VG+G
Sbjct: 320 ARKKSLQRKVLKLHP---CLAPIKVALDVGKG 348


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.131    0.351 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,801,218
Number of Sequences: 62578
Number of extensions: 350978
Number of successful extensions: 1038
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 1034
Number of HSP's gapped (non-prelim): 10
length of query: 405
length of database: 14,973,337
effective HSP length: 101
effective length of query: 304
effective length of database: 8,652,959
effective search space: 2630499536
effective search space used: 2630499536
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)