BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035696
(405 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1G5I|A Chain A, Crystal Structure Of The Accessory Subunit Of Murine
Mitochondrial Polymerase Gamma
pdb|1G5I|B Chain B, Crystal Structure Of The Accessory Subunit Of Murine
Mitochondrial Polymerase Gamma
pdb|1G5I|C Chain C, Crystal Structure Of The Accessory Subunit Of Murine
Mitochondrial Polymerase Gamma
pdb|1G5I|D Chain D, Crystal Structure Of The Accessory Subunit Of Murine
Mitochondrial Polymerase Gamma
Length = 454
Score = 29.6 bits (65), Expect = 2.9, Method: Compositional matrix adjust.
Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 3/32 (9%)
Query: 334 SKRESRERKFLKRHPFASCVARFAVQLEVGEG 365
++++S +RK LK HP C+A V L+VG+G
Sbjct: 320 ARKKSLQRKVLKLHP---CLAPIKVALDVGKG 348
>pdb|1G5H|A Chain A, Crystal Structure Of The Accessory Subunit Of Murine
Mitochondrial Polymerase Gamma
pdb|1G5H|B Chain B, Crystal Structure Of The Accessory Subunit Of Murine
Mitochondrial Polymerase Gamma
pdb|1G5H|C Chain C, Crystal Structure Of The Accessory Subunit Of Murine
Mitochondrial Polymerase Gamma
pdb|1G5H|D Chain D, Crystal Structure Of The Accessory Subunit Of Murine
Mitochondrial Polymerase Gamma
Length = 454
Score = 29.6 bits (65), Expect = 3.3, Method: Compositional matrix adjust.
Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 3/32 (9%)
Query: 334 SKRESRERKFLKRHPFASCVARFAVQLEVGEG 365
++++S +RK LK HP C+A V L+VG+G
Sbjct: 320 ARKKSLQRKVLKLHP---CLAPIKVALDVGKG 348
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.315 0.131 0.351
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,801,218
Number of Sequences: 62578
Number of extensions: 350978
Number of successful extensions: 1038
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 1034
Number of HSP's gapped (non-prelim): 10
length of query: 405
length of database: 14,973,337
effective HSP length: 101
effective length of query: 304
effective length of database: 8,652,959
effective search space: 2630499536
effective search space used: 2630499536
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)