Citrus Sinensis ID: 035703


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MSTANPPVVASTAATTTTGVGLGYGIAIAVSILVLISTIMLASYACIRVKANANRGGGSGGDYIGREYENARTNDYGPCSICLCDYKPKDSVRCIPDCHHCFHADCVDEWLRMSATCPLCRSSPATPLAEVVPLASHAR
cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHEEEccccccccccccccccccccccccccccccEEcccccccccEEccccccccccccccHHHHHcccccccccccccccccccccccccccc
*****************TGVGLGYGIAIAVSILVLISTIMLASYACIRVKANANRGGGSGGDYIGREYENARTNDYGPCSICLCDYKPKDSVRCIPDCHHCFHADCVDEWLRMSATCPLCRSSPAT*************
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTANPPVVASTAATTTTGVGLGYGIAIAVSILVLISTIMLASYACIRVKANANRGGGSGGDYIGREYENARTNDYGPCSICLCDYKPKDSVRCIPDCHHCFHADCVDEWLRMSATCPLCRSSPATPLAEVVPLASHAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative RING-H2 finger protein ATL69 probableQ9FL42

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AP4, chain A
Confidence level:very confident
Coverage over the Query: 74-134
View the alignment between query and template
View the model in PyMOL
Template: 2L2T, chain A
Confidence level:probable
Coverage over the Query: 24-52
View the alignment between query and template
View the model in PyMOL