Citrus Sinensis ID: 035710

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420
MKLARFCTSPTDRLKQNEIVVTQMYRASATTSASVKLNSKLSWNSLAYDSAAKLGNNWMEIQGSNNWEGLLDPLDQNLRSELLRYGQFVEATYRCFDFDPSSPTYATCKYPRNSFLTRLGIAETGYRMTKHLRATCGVHLPRWLDRAPSWMSTQSSWIGYVAVCQDKKEIARLGRRDVVIAYRGTATCLEWLENLRATLTACWPPDDVATSVHLRPSTPMVQTGFFSLYTSSTDTCPSLQEMVREEIKRVLDLYGDEPLSITITGHSLGAALATLTAYDINSTFNNAPMVTVISFGGPRVGNRSFRCQLEKSGTKILRIVNSDDLITKVPGFVIDDYDVANKQAVNVAALPSWLQKRVQNTHWVYADVGKELRLSSRDSPFLSKVNVATCHDLSTYLHLVKGFVSSTCPFKATARKLGSI
ccccccccccccccccccccHHHHcccccccccHHHccccccccccccccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHcccccccccccEEEEccccccccccccccccccccccEEEEEEEEcccHHHEEccccEEEEEEEccccHHHHHHccccEEECcccccccccccccccccccccccHHHHHcccccccccHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHHccccEEEEEEcccccccccccccccccccccEEEEcccccccEEEcccccccEEEEcccccccccccccccccccccccccHHHHHHHHccccccccccEEEccccccc
*****************EI*********************************KLGNNWMEIQGSNNWEGLLDPLDQNLRSELLRYGQFVEATYRCFDFDPSSPTYATCKYPRNSFLTRLGIAETGYRMTKHLRATCGVHLPRWLDRAPSWMSTQSSWIGYVAVCQDKKEIARLGRRDVVIAYRGTATCLEWLENLRATLTACWPPDDVATSVHLRPSTPMVQTGFFSLYTSSTDTCPSLQEMVREEIKRVLDLYGDEPLSITITGHSLGAALATLTAYDINSTFNNAPMVTVISFGGPRVGNRSFRCQLEKSGTKILRIVNSDDLITKVPGFVIDDYDVANKQAVNVAALPSWLQKRVQNTHWVYADVGKELRLSSRDSPFLSKVNVATCHDLSTYLHLVKGFVSSTCPFKATARKL***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLARFCTSPTDRLKQNEIVVTQMYRASATTSASVKLNSKLSWNSLAYDSAAKLGNNWMEIQGSNNWEGLLDPLDQNLRSELLRYGQFVEATYRCFDFDPSSPTYATCKYPRNSFLTRLGIAETGYRMTKHLRATCGVHLPRWLDRAPSWMSTQSSWIGYVAVCQDKKEIARLGRRDVVIAYRGTATCLEWLENLRATLTACWPPDDVATSVHLRPSTPMVQTGFFSLYTSSTDTCPSLQEMVREEIKRVLDLYGDEPLSITITGHSLGAALATLTAYDINSTFNNAPMVTVISFGGPRVGNRSFRCQLEKSGTKILRIVNSDDLITKVPGFVIDDYDVANKQAVNVAALPSWLQKRVQNTHWVYADVGKELRLSSRDSPFLSKVNVATCHDLSTYLHLVKGFVSSTCPFKATARKLGSI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phospholipase A(1) DAD1, chloroplastic Sn-1-specific phospholipase that releases free fatty acids from phospholipids. Low activity on galactolipids and triacylglycerols. Catalyzes the initial step of jasmonic acid biosynthesis. Not essential for jasmonate biosynthesis after wounding or upon pathogen infection.probableQ948R1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.1.-Carboxylic ester hydrolases.probable
3.1.1.32Phospholipase A(1).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YIJ, chain A
Confidence level:very confident
Coverage over the Query: 54-331,363-419
View the alignment between query and template
View the model in PyMOL
Template: 1TGL, chain A
Confidence level:very confident
Coverage over the Query: 71-131,150-205,216-378
View the alignment between query and template
View the model in PyMOL