Query         035742
Match_columns 214
No_of_seqs    316 out of 2131
Neff          9.3 
Searched_HMMs 46136
Date          Fri Mar 29 05:59:24 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035742.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035742hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00113 leucine-rich repeat r  99.8 2.2E-18 4.7E-23  161.5  10.0  126    1-137    31-157 (968)
  2 PLN03150 hypothetical protein;  99.7 7.8E-18 1.7E-22  150.5   8.5  129    2-138   375-508 (623)
  3 PLN00113 leucine-rich repeat r  99.3 3.7E-12 7.9E-17  119.7   5.6   91   47-138   475-565 (968)
  4 PLN03150 hypothetical protein;  99.1 1.4E-10 3.1E-15  104.1   5.5   91   46-137   441-532 (623)
  5 KOG0617 Ras suppressor protein  99.0 2.2E-11 4.9E-16   90.4  -0.5   84   47-134    33-116 (264)
  6 KOG0617 Ras suppressor protein  99.0   4E-11 8.6E-16   89.1  -0.5  105   46-153    55-160 (264)
  7 PF13855 LRR_8:  Leucine rich r  99.0 3.6E-10 7.8E-15   70.6   2.9   60   48-108     2-61  (61)
  8 PF13855 LRR_8:  Leucine rich r  98.9 2.5E-10 5.5E-15   71.3   1.4   61   72-132     1-61  (61)
  9 KOG4237 Extracellular matrix p  98.8   2E-09 4.3E-14   89.2   2.9  107   29-137    36-157 (498)
 10 PF08263 LRRNT_2:  Leucine rich  98.8 2.7E-09 5.8E-14   61.8   2.3   37    1-44      5-43  (43)
 11 KOG4194 Membrane glycoprotein   98.8 1.1E-09 2.5E-14   94.6  -0.5   90   48-138   294-383 (873)
 12 KOG0472 Leucine-rich repeat pr  98.7 2.1E-09 4.6E-14   89.3   0.2  105   47-154   435-539 (565)
 13 PF14580 LRR_9:  Leucine-rich r  98.7 2.3E-08   5E-13   75.6   4.7   82   48-133    43-126 (175)
 14 PF14580 LRR_9:  Leucine-rich r  98.6 1.6E-08 3.5E-13   76.4   2.9   81   48-134    20-102 (175)
 15 KOG0444 Cytoskeletal regulator  98.6 1.1E-08 2.3E-13   89.6   1.5   93   48-143    79-173 (1255)
 16 KOG0472 Leucine-rich repeat pr  98.6 5.1E-09 1.1E-13   87.1  -0.7   96   35-133   431-541 (565)
 17 KOG0618 Serine/threonine phosp  98.6 6.9E-09 1.5E-13   93.7  -1.0   86   46-135   382-467 (1081)
 18 KOG4194 Membrane glycoprotein   98.5 1.4E-08 3.1E-13   88.0   0.1   87   47-134   269-355 (873)
 19 KOG0444 Cytoskeletal regulator  98.5   4E-08 8.6E-13   86.1   1.5   83   47-133   103-186 (1255)
 20 KOG0532 Leucine-rich repeat (L  98.3 6.7E-08 1.5E-12   83.6  -0.9   87   52-143   103-189 (722)
 21 PRK15387 E3 ubiquitin-protein   98.3 3.1E-07 6.8E-12   83.8   3.2   61   73-138   403-463 (788)
 22 KOG4579 Leucine-rich repeat (L  98.3 1.4E-07 2.9E-12   67.9   0.3   84   46-133    52-136 (177)
 23 KOG4237 Extracellular matrix p  98.3 2.5E-07 5.4E-12   76.9   0.9   86   47-133   274-359 (498)
 24 KOG0618 Serine/threonine phosp  98.3 1.4E-07 3.1E-12   85.4  -0.5  100   48-151    46-145 (1081)
 25 PF12799 LRR_4:  Leucine Rich r  98.2   1E-06 2.2E-11   51.1   2.9   36   73-109     2-37  (44)
 26 KOG1259 Nischarin, modulator o  98.2 3.8E-07 8.3E-12   73.7  -0.2   57   49-109   286-342 (490)
 27 PF12799 LRR_4:  Leucine Rich r  98.1 8.8E-07 1.9E-11   51.3   1.3   39   96-135     1-39  (44)
 28 PRK15370 E3 ubiquitin-protein   98.1 3.1E-06 6.7E-11   77.5   5.3   79   47-135   325-403 (754)
 29 PRK15387 E3 ubiquitin-protein   98.1 5.2E-06 1.1E-10   76.0   5.2   13   48-60    343-355 (788)
 30 COG4886 Leucine-rich repeat (L  98.0 2.8E-06 6.1E-11   72.3   3.0   88   47-138   116-204 (394)
 31 PRK15370 E3 ubiquitin-protein   98.0 5.5E-06 1.2E-10   75.9   4.9   35   97-134   263-297 (754)
 32 COG4886 Leucine-rich repeat (L  98.0 2.3E-06 4.9E-11   72.9   1.9   97   48-148   141-237 (394)
 33 cd00116 LRR_RI Leucine-rich re  98.0 2.4E-06 5.2E-11   70.3   1.1   38   72-109   137-178 (319)
 34 KOG1259 Nischarin, modulator o  98.0 2.9E-06 6.3E-11   68.7   1.3   90   38-133   293-387 (490)
 35 PLN03210 Resistant to P. syrin  97.9 1.3E-05 2.9E-10   77.1   5.5   81   48-131   612-692 (1153)
 36 PLN03210 Resistant to P. syrin  97.9 1.6E-05 3.4E-10   76.6   5.9   95   38-137   627-721 (1153)
 37 KOG0532 Leucine-rich repeat (L  97.9 2.4E-06 5.2E-11   74.2  -0.3   36   98-134   213-248 (722)
 38 cd00116 LRR_RI Leucine-rich re  97.9 2.8E-06   6E-11   69.9  -0.3   88   46-134    80-179 (319)
 39 KOG4579 Leucine-rich repeat (L  97.8 9.3E-07   2E-11   63.7  -2.9   94   42-138    22-118 (177)
 40 KOG4658 Apoptotic ATPase [Sign  97.8 9.5E-06 2.1E-10   75.5   2.5   89   47-137   545-635 (889)
 41 KOG4658 Apoptotic ATPase [Sign  97.5 4.7E-05   1E-09   71.0   2.1   85   45-131   569-653 (889)
 42 KOG0531 Protein phosphatase 1,  97.5 7.1E-05 1.5E-09   64.4   2.6   85   47-137    95-179 (414)
 43 KOG1859 Leucine-rich repeat pr  97.3 2.6E-05 5.7E-10   69.8  -2.0   80   47-133   187-267 (1096)
 44 KOG1644 U2-associated snRNP A'  97.2 0.00032 6.8E-09   53.8   3.3   82   48-133    43-126 (233)
 45 KOG1859 Leucine-rich repeat pr  97.2 2.7E-05 5.8E-10   69.8  -3.5   83   48-135   165-247 (1096)
 46 KOG2739 Leucine-rich acidic nu  97.0 0.00044 9.5E-09   54.9   2.2   83   47-134    43-130 (260)
 47 KOG0531 Protein phosphatase 1,  97.0 0.00025 5.4E-09   61.0   0.7   82   48-134    73-154 (414)
 48 KOG3207 Beta-tubulin folding c  96.9 0.00025 5.5E-09   60.1   0.4   88   46-133   171-259 (505)
 49 KOG0473 Leucine-rich repeat pr  96.8 4.2E-05 9.2E-10   59.9  -4.7   84   46-133    41-124 (326)
 50 KOG1187 Serine/threonine prote  96.6  0.0034 7.3E-08   53.1   4.7   75  138-213   268-350 (361)
 51 KOG3207 Beta-tubulin folding c  96.5 0.00064 1.4E-08   57.7  -0.2   84   48-133   223-314 (505)
 52 KOG2982 Uncharacterized conser  96.4 0.00096 2.1E-08   54.3   0.2   84   48-132    72-158 (418)
 53 PF00560 LRR_1:  Leucine Rich R  96.3  0.0014 3.1E-08   31.7   0.5   18   98-116     2-19  (22)
 54 KOG2123 Uncharacterized conser  96.2 0.00036 7.9E-09   56.2  -3.1   86   43-134    15-102 (388)
 55 PF00560 LRR_1:  Leucine Rich R  96.1   0.002 4.3E-08   31.2   0.5   18   74-92      2-19  (22)
 56 KOG1644 U2-associated snRNP A'  96.0  0.0045 9.7E-08   47.7   2.3   79   50-133    22-101 (233)
 57 KOG3665 ZYG-1-like serine/thre  95.7   0.006 1.3E-07   55.8   2.0   91   40-134   166-264 (699)
 58 KOG2123 Uncharacterized conser  95.3  0.0019 4.1E-08   52.1  -2.2   81   42-126    36-123 (388)
 59 KOG1909 Ran GTPase-activating   94.9  0.0082 1.8E-07   49.8   0.5   37   96-132   270-310 (382)
 60 KOG2739 Leucine-rich acidic nu  94.9   0.012 2.6E-07   46.8   1.3   66   66-133    37-104 (260)
 61 KOG3665 ZYG-1-like serine/thre  94.9  0.0094   2E-07   54.6   0.7   85   46-133   147-233 (699)
 62 PF13504 LRR_7:  Leucine rich r  94.2   0.024 5.2E-07   25.5   0.9   11   98-108     3-13  (17)
 63 PRK15386 type III secretion pr  93.8     0.1 2.2E-06   44.9   4.6   60   47-115    52-113 (426)
 64 smart00370 LRR Leucine-rich re  92.4    0.15 3.3E-06   25.3   2.3   14   72-85      2-15  (26)
 65 smart00369 LRR_TYP Leucine-ric  92.4    0.15 3.3E-06   25.3   2.3   14   72-85      2-15  (26)
 66 PF13306 LRR_5:  Leucine rich r  92.2    0.21 4.6E-06   35.0   3.8   79   48-130    13-91  (129)
 67 KOG1909 Ran GTPase-activating   91.4     0.1 2.2E-06   43.5   1.4   86   47-133   157-254 (382)
 68 KOG2982 Uncharacterized conser  91.1    0.12 2.5E-06   42.5   1.5   70   37-108    85-158 (418)
 69 COG5238 RNA1 Ran GTPase-activa  91.0   0.085 1.8E-06   42.8   0.6   84   47-131    30-131 (388)
 70 PRK15386 type III secretion pr  89.7    0.26 5.6E-06   42.4   2.5   61   67-134    47-109 (426)
 71 cd05048 PTKc_Ror Catalytic Dom  88.9     0.5 1.1E-05   37.8   3.6   31  181-214   252-282 (283)
 72 KOG0473 Leucine-rich repeat pr  88.5   0.022 4.7E-07   45.1  -4.3   73   62-136    32-104 (326)
 73 PF13306 LRR_5:  Leucine rich r  88.3    0.44 9.5E-06   33.4   2.6   77   48-129    36-112 (129)
 74 cd05094 PTKc_TrkC Catalytic do  87.2       1 2.2E-05   36.2   4.5   25  189-213   256-280 (291)
 75 cd05050 PTKc_Musk Catalytic do  86.9    0.98 2.1E-05   36.2   4.2   28  187-214   261-288 (288)
 76 cd05038 PTKc_Jak_rpt2 Catalyti  86.9    0.49 1.1E-05   37.7   2.4   28  187-214   255-282 (284)
 77 PF13516 LRR_6:  Leucine Rich r  86.8    0.17 3.7E-06   24.6  -0.2   13   73-85      3-15  (24)
 78 PHA02988 hypothetical protein;  86.2     1.5 3.2E-05   35.4   4.8   29  182-213   249-277 (283)
 79 cd08229 STKc_Nek7 Catalytic do  85.3     1.9 4.2E-05   33.9   5.1   29  182-213   235-263 (267)
 80 cd05049 PTKc_Trk Catalytic dom  85.1     1.3 2.8E-05   35.2   4.0   30  182-214   251-280 (280)
 81 smart00364 LRR_BAC Leucine-ric  84.3    0.62 1.3E-05   23.4   1.1   17   97-114     3-19  (26)
 82 cd05058 PTKc_Met_Ron Catalytic  84.2     2.2 4.8E-05   33.5   4.9   25  189-213   233-257 (262)
 83 PF07714 Pkinase_Tyr:  Protein   84.0     0.7 1.5E-05   36.7   1.9   28  182-212   232-259 (259)
 84 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  83.9     1.3 2.8E-05   35.4   3.5   26  188-213   256-281 (284)
 85 cd05091 PTKc_Ror2 Catalytic do  83.8     1.5 3.2E-05   35.1   3.8   25  189-213   257-281 (283)
 86 cd05112 PTKc_Itk Catalytic dom  83.5    0.97 2.1E-05   35.4   2.6   27  187-213   230-256 (256)
 87 cd05116 PTKc_Syk Catalytic dom  83.3     1.5 3.2E-05   34.6   3.5   29  182-213   225-253 (257)
 88 cd05063 PTKc_EphR_A2 Catalytic  83.1       1 2.3E-05   35.6   2.6   27  188-214   240-266 (268)
 89 cd05051 PTKc_DDR Catalytic dom  83.1     1.1 2.3E-05   36.1   2.7   29  186-214   268-296 (296)
 90 cd05061 PTKc_InsR Catalytic do  82.8     1.3 2.8E-05   35.6   3.1   27  188-214   251-277 (288)
 91 cd05095 PTKc_DDR2 Catalytic do  82.8     1.2 2.7E-05   35.9   3.0   27  188-214   270-296 (296)
 92 cd05062 PTKc_IGF-1R Catalytic   82.6     1.6 3.4E-05   34.8   3.5   27  188-214   251-277 (277)
 93 cd05113 PTKc_Btk_Bmx Catalytic  82.5     2.9 6.2E-05   32.9   5.0   26  188-213   231-256 (256)
 94 cd05093 PTKc_TrkB Catalytic do  82.5     1.3 2.9E-05   35.6   3.0   26  188-213   252-277 (288)
 95 cd05069 PTKc_Yes Catalytic dom  82.2     3.4 7.4E-05   32.5   5.3   30  181-213   229-258 (260)
 96 cd05097 PTKc_DDR_like Catalyti  82.1     1.2 2.6E-05   35.9   2.7   27  187-213   268-294 (295)
 97 cd05148 PTKc_Srm_Brk Catalytic  81.9     1.2 2.7E-05   35.0   2.6   26  188-213   234-259 (261)
 98 cd05033 PTKc_EphR Catalytic do  81.8     1.9 4.1E-05   34.1   3.7   27  188-214   238-264 (266)
 99 cd05052 PTKc_Abl Catalytic dom  81.7     1.3 2.9E-05   34.9   2.7   25  189-213   236-260 (263)
100 cd05045 PTKc_RET Catalytic dom  81.7     1.1 2.3E-05   36.1   2.2   26  188-213   259-284 (290)
101 cd05104 PTKc_Kit Catalytic dom  81.5       1 2.2E-05   38.1   2.1   26  189-214   348-373 (375)
102 cd05053 PTKc_FGFR Catalytic do  81.3     1.3 2.8E-05   35.6   2.6   27  187-213   263-289 (293)
103 cd05102 PTKc_VEGFR3 Catalytic   81.3     1.7 3.7E-05   35.8   3.4   26  188-213   307-332 (338)
104 cd05114 PTKc_Tec_Rlk Catalytic  81.3     1.4   3E-05   34.7   2.6   27  187-213   230-256 (256)
105 cd05075 PTKc_Axl Catalytic dom  81.3     2.1 4.5E-05   33.9   3.7   26  188-213   244-269 (272)
106 cd05092 PTKc_TrkA Catalytic do  81.1       2 4.4E-05   34.3   3.7   30  182-214   251-280 (280)
107 cd08528 STKc_Nek10 Catalytic d  81.0     1.6 3.5E-05   34.5   3.0   22  192-213   247-268 (269)
108 cd05084 PTKc_Fes Catalytic dom  80.5     1.4 3.1E-05   34.4   2.5   26  189-214   227-252 (252)
109 cd05068 PTKc_Frk_like Catalyti  80.3     1.4 3.1E-05   34.7   2.5   27  187-213   233-259 (261)
110 cd05085 PTKc_Fer Catalytic dom  79.9     1.8 3.9E-05   33.7   2.9   28  187-214   223-250 (250)
111 cd05078 PTK_Jak2_Jak3_rpt1 Pse  79.5     1.4 3.1E-05   34.7   2.2   26  188-213   233-258 (258)
112 cd05044 PTKc_c-ros Catalytic d  79.4     3.2   7E-05   32.7   4.3   30  181-213   239-268 (269)
113 smart00365 LRR_SD22 Leucine-ri  79.2     1.9   4E-05   21.7   1.8   12   73-84      3-14  (26)
114 cd05080 PTKc_Tyk2_rpt2 Catalyt  78.7     1.6 3.4E-05   34.9   2.3   26  188-213   254-279 (283)
115 cd05066 PTKc_EphR_A Catalytic   78.4     2.3 4.9E-05   33.7   3.1   27  188-214   239-265 (267)
116 cd05090 PTKc_Ror1 Catalytic do  78.3       3 6.6E-05   33.3   3.8   30  182-214   253-282 (283)
117 KOG0192 Tyrosine kinase specif  78.2     3.8 8.3E-05   34.8   4.5   71  132-213   230-301 (362)
118 cd05096 PTKc_DDR1 Catalytic do  77.7       2 4.3E-05   34.8   2.6   26  188-213   278-303 (304)
119 cd05064 PTKc_EphR_A10 Catalyti  76.9     3.3 7.2E-05   32.8   3.7   26  189-214   239-264 (266)
120 cd05060 PTKc_Syk_like Catalyti  76.9     1.9 4.2E-05   33.8   2.3   26  189-214   229-254 (257)
121 cd05032 PTKc_InsR_like Catalyt  76.6     3.7 8.1E-05   32.5   3.9   27  188-214   251-277 (277)
122 cd05035 PTKc_Axl_like Catalyti  76.5     3.4 7.4E-05   32.5   3.6   26  188-213   245-270 (273)
123 cd05041 PTKc_Fes_like Catalyti  76.2     2.2 4.8E-05   33.3   2.4   30  182-214   222-251 (251)
124 cd05072 PTKc_Lyn Catalytic dom  76.0     2.5 5.4E-05   33.2   2.7   27  188-214   234-260 (261)
125 cd05083 PTKc_Chk Catalytic dom  75.9     3.1 6.7E-05   32.6   3.2   26  189-214   228-253 (254)
126 cd05065 PTKc_EphR_B Catalytic   75.5     2.2 4.8E-05   33.8   2.3   27  188-214   241-267 (269)
127 cd05082 PTKc_Csk Catalytic dom  75.2     3.2 6.9E-05   32.5   3.1   24  190-213   231-254 (256)
128 cd05059 PTKc_Tec_like Catalyti  74.8     2.4 5.2E-05   33.3   2.3   27  187-213   230-256 (256)
129 cd05043 PTK_Ryk Pseudokinase d  74.8     2.5 5.4E-05   33.6   2.4   25  189-213   250-274 (280)
130 cd05070 PTKc_Fyn_Yrk Catalytic  74.6     2.8 6.1E-05   32.9   2.7   26  188-213   233-258 (260)
131 KOG3864 Uncharacterized conser  74.2    0.79 1.7E-05   35.5  -0.6   81   48-129   102-185 (221)
132 cd08529 STKc_FA2-like Catalyti  73.7     6.3 0.00014   30.6   4.5   22  190-211   232-253 (256)
133 cd00192 PTKc Catalytic domain   73.5     3.2 6.9E-05   32.3   2.7   26  188-213   237-262 (262)
134 cd05040 PTKc_Ack_like Catalyti  73.5     3.6 7.9E-05   32.1   3.0   25  189-213   232-256 (257)
135 cd05047 PTKc_Tie Catalytic dom  73.2     2.8   6E-05   33.3   2.3   27  187-213   240-266 (270)
136 COG5238 RNA1 Ran GTPase-activa  73.2     2.5 5.4E-05   34.6   2.0   43   67-109    87-133 (388)
137 cd05101 PTKc_FGFR2 Catalytic d  72.7     2.6 5.6E-05   34.1   2.1   25  189-213   270-294 (304)
138 cd05036 PTKc_ALK_LTK Catalytic  72.6     3.7   8E-05   32.7   2.9   25  189-213   252-276 (277)
139 cd08224 STKc_Nek6_Nek7 Catalyt  72.4     3.7 8.1E-05   32.2   2.9   25  189-213   239-263 (267)
140 cd05074 PTKc_Tyro3 Catalytic d  72.0     3.1 6.7E-05   32.9   2.3   28  186-213   243-270 (273)
141 cd05106 PTKc_CSF-1R Catalytic   71.9     2.6 5.7E-05   35.6   2.0   30  182-214   342-371 (374)
142 cd05039 PTKc_Csk_like Catalyti  71.7     3.4 7.3E-05   32.3   2.5   24  190-213   231-254 (256)
143 cd05098 PTKc_FGFR1 Catalytic d  71.4     3.4 7.3E-05   33.6   2.5   25  189-213   273-297 (307)
144 cd05111 PTK_HER3 Pseudokinase   71.3     3.9 8.4E-05   32.7   2.8   26  188-213   241-266 (279)
145 smart00368 LRR_RI Leucine rich  71.3     3.7 7.9E-05   20.8   1.7   13   73-85      3-15  (28)
146 smart00750 KIND kinase non-cat  71.3     6.9 0.00015   28.7   4.0   25  188-212   142-166 (176)
147 cd05054 PTKc_VEGFR Catalytic d  71.1     3.2 6.9E-05   34.5   2.3   28  186-213   304-331 (337)
148 cd05071 PTKc_Src Catalytic dom  70.8     6.7 0.00015   30.9   4.0   26  188-213   233-258 (262)
149 cd05055 PTKc_PDGFR Catalytic d  70.1     3.8 8.2E-05   33.3   2.5   26  189-214   275-300 (302)
150 cd05046 PTK_CCK4 Pseudokinase   70.0     4.5 9.7E-05   32.0   2.9   27  188-214   249-275 (275)
151 cd05079 PTKc_Jak1_rpt2 Catalyt  69.8     4.1 8.8E-05   32.6   2.6   26  188-213   256-281 (284)
152 KOG0581 Mitogen-activated prot  69.3     8.9 0.00019   32.4   4.4   39  167-210   296-334 (364)
153 KOG2120 SCF ubiquitin ligase,   69.1     2.6 5.6E-05   34.9   1.3   37   71-107   312-349 (419)
154 cd05103 PTKc_VEGFR2 Catalytic   68.8     3.7   8E-05   34.1   2.2   26  188-213   312-337 (343)
155 cd05076 PTK_Tyk2_rpt1 Pseudoki  68.2     4.4 9.5E-05   32.3   2.5   26  188-213   249-274 (274)
156 cd08228 STKc_Nek6 Catalytic do  68.2     4.9 0.00011   31.6   2.7   29  182-213   235-263 (267)
157 cd08218 STKc_Nek1 Catalytic do  68.2     5.7 0.00012   31.0   3.1   26  182-210   227-252 (256)
158 cd05099 PTKc_FGFR4 Catalytic d  68.1     4.1 8.8E-05   33.2   2.3   25  189-213   267-291 (314)
159 smart00219 TyrKc Tyrosine kina  68.1       7 0.00015   30.3   3.6   24  189-212   235-258 (258)
160 cd05115 PTKc_Zap-70 Catalytic   68.0     6.9 0.00015   30.8   3.6   29  182-213   225-253 (257)
161 cd06642 STKc_STK25-YSK1 Cataly  67.7      12 0.00026   29.6   4.9   23  189-211   231-253 (277)
162 cd08217 STKc_Nek2 Catalytic do  67.4     6.6 0.00014   30.6   3.3   23  189-211   240-262 (265)
163 cd06621 PKc_MAPKK_Pek1_like Ca  66.8     8.3 0.00018   30.8   3.8   23  188-210   243-265 (287)
164 cd05067 PTKc_Lck_Blk Catalytic  66.0     5.3 0.00012   31.3   2.5   26  188-213   233-258 (260)
165 cd05089 PTKc_Tie1 Catalytic do  64.9     5.3 0.00012   32.2   2.4   25  189-213   249-273 (297)
166 cd05034 PTKc_Src_like Catalyti  64.7     6.2 0.00013   30.9   2.7   26  188-213   234-259 (261)
167 cd05100 PTKc_FGFR3 Catalytic d  64.1       5 0.00011   33.1   2.1   26  188-213   266-291 (334)
168 cd06623 PKc_MAPKK_plant_like C  63.8      13 0.00028   29.0   4.3   28  181-211   229-256 (264)
169 cd05073 PTKc_Hck Catalytic dom  63.4     6.7 0.00015   30.8   2.7   25  189-213   234-258 (260)
170 cd05056 PTKc_FAK Catalytic dom  63.3     9.2  0.0002   30.1   3.5   29  182-213   235-263 (270)
171 cd05037 PTK_Jak_rpt1 Pseudokin  62.2     6.4 0.00014   30.7   2.3   26  188-213   234-259 (259)
172 cd05086 PTKc_Aatyk2 Catalytic   61.7     9.4  0.0002   30.2   3.2   19  194-213   249-267 (268)
173 cd06605 PKc_MAPKK Catalytic do  61.4      15 0.00034   28.6   4.4   27  182-211   231-257 (265)
174 cd05110 PTKc_HER4 Catalytic do  61.3       7 0.00015   31.6   2.4   27  187-213   240-266 (303)
175 cd05107 PTKc_PDGFR_beta Cataly  61.1       6 0.00013   33.9   2.1   29  182-213   369-397 (401)
176 cd05105 PTKc_PDGFR_alpha Catal  60.4     5.9 0.00013   34.0   1.9   27  187-213   369-395 (400)
177 cd08223 STKc_Nek4 Catalytic do  60.1      10 0.00022   29.5   3.1   22  189-210   232-253 (257)
178 KOG2345 Serine/threonine prote  60.0      13 0.00029   30.0   3.6   29  182-213   270-298 (302)
179 cd05088 PTKc_Tie2 Catalytic do  59.5     7.4 0.00016   31.5   2.3   26  188-213   253-278 (303)
180 cd05077 PTK_Jak1_rpt1 Pseudoki  59.1     7.5 0.00016   30.7   2.2   26  188-213   237-262 (262)
181 cd05087 PTKc_Aatyk1_Aatyk3 Cat  58.1      11 0.00024   29.7   3.1   28  182-213   241-268 (269)
182 cd08221 STKc_Nek9 Catalytic do  57.6      13 0.00027   29.0   3.3   28  182-212   227-254 (256)
183 cd06641 STKc_MST3 Catalytic do  57.3      21 0.00047   28.2   4.6   21  190-210   232-252 (277)
184 cd06628 STKc_MAPKKK_Byr2_like   55.7      22 0.00047   27.8   4.4   26  182-210   238-263 (267)
185 cd06609 STKc_MST3_like Catalyt  55.1      20 0.00044   28.2   4.2   19  192-210   232-250 (274)
186 cd08225 STKc_Nek5 Catalytic do  54.7      14  0.0003   28.7   3.0   18  193-210   236-253 (257)
187 cd05108 PTKc_EGFR Catalytic do  54.7      10 0.00022   30.9   2.3   26  188-213   241-266 (316)
188 KOG0198 MEKK and related serin  54.1      20 0.00043   29.9   3.9   33  172-210   243-275 (313)
189 cd05109 PTKc_HER2 Catalytic do  54.1      11 0.00023   29.9   2.4   26  188-213   241-266 (279)
190 KOG2120 SCF ubiquitin ligase,   54.0     1.1 2.5E-05   36.9  -3.2   55   74-128   187-242 (419)
191 smart00220 S_TKc Serine/Threon  53.9      11 0.00023   28.6   2.3   24  187-210   217-240 (244)
192 cd06624 STKc_ASK Catalytic dom  48.5      21 0.00045   28.1   3.2   20  191-210   245-264 (268)
193 cd08530 STKc_CNK2-like Catalyt  48.5      24 0.00051   27.3   3.5   23  188-210   230-252 (256)
194 TIGR00864 PCC polycystin catio  48.0      11 0.00025   39.9   1.9   32   53-85      1-32  (2740)
195 cd08219 STKc_Nek3 Catalytic do  47.7      20 0.00044   27.8   3.0   19  193-211   234-252 (255)
196 cd06640 STKc_MST4 Catalytic do  47.7      25 0.00053   27.8   3.5   23  188-210   230-252 (277)
197 cd06606 STKc_MAPKKK Catalytic   47.4      23 0.00049   27.2   3.2   26  182-210   231-256 (260)
198 KOG3763 mRNA export factor TAP  46.6      14 0.00029   33.1   1.9   11   96-106   244-254 (585)
199 PF00069 Pkinase:  Protein kina  45.7      16 0.00035   28.3   2.1   26  182-210   231-256 (260)
200 PLN00034 mitogen-activated pro  45.3      35 0.00076   28.3   4.2   26  182-210   302-327 (353)
201 cd07835 STKc_CDK1_like Catalyt  45.0      14  0.0003   29.3   1.7   23  188-210   257-279 (283)
202 PHA02882 putative serine/threo  44.9      35 0.00076   27.4   4.1   29  182-213   266-294 (294)
203 cd06620 PKc_MAPKK_Byr1_like Ca  44.7      14  0.0003   29.4   1.6   22  190-211   245-266 (284)
204 cd06646 STKc_MAP4K5 Catalytic   44.1      21 0.00045   28.0   2.5   27  182-211   239-265 (267)
205 cd08220 STKc_Nek8 Catalytic do  43.9      24 0.00052   27.3   2.9   19  192-210   234-252 (256)
206 cd07830 STKc_MAK_like Catalyti  43.7      21 0.00046   28.2   2.6   24  187-210   256-279 (283)
207 cd07846 STKc_CDKL2_3 Catalytic  43.3      17 0.00037   28.8   2.0   23  188-210   260-282 (286)
208 cd06608 STKc_myosinIII_like Ca  42.9      21 0.00045   27.9   2.4   19  192-210   253-271 (275)
209 cd05057 PTKc_EGFR_like Catalyt  42.7      22 0.00048   28.1   2.5   26  188-213   241-266 (279)
210 cd05118 STKc_CMGC Catalytic do  42.3      21 0.00046   28.1   2.3   24  187-210   256-279 (283)
211 cd06625 STKc_MEKK3_like Cataly  42.1      47   0.001   25.8   4.3   27  182-211   234-260 (263)
212 cd06638 STKc_myosinIIIA Cataly  42.0      23 0.00049   28.1   2.5   23  189-211   261-283 (286)
213 cd05042 PTKc_Aatyk Catalytic d  41.9      34 0.00074   26.8   3.5   19  194-213   250-268 (269)
214 cd07860 STKc_CDK2_3 Catalytic   41.8      26 0.00057   27.7   2.9   19  192-210   262-280 (284)
215 cd05122 PKc_STE Catalytic doma  41.6      22 0.00048   27.1   2.3   26  182-210   225-250 (253)
216 cd07838 STKc_CDK4_6_like Catal  40.6      30 0.00064   27.3   3.0   21  190-210   263-283 (287)
217 cd07840 STKc_CDK9_like Catalyt  40.0      22 0.00049   28.0   2.2   24  187-210   260-283 (287)
218 cd06610 STKc_OSR1_SPAK Catalyt  40.0      25 0.00055   27.3   2.5   26  182-210   238-263 (267)
219 PTZ00267 NIMA-related protein   39.6      43 0.00094   29.3   4.1   26  182-210   297-322 (478)
220 cd06629 STKc_MAPKKK_Bck1_like   39.5      23 0.00049   27.9   2.1   26  182-210   243-268 (272)
221 cd06631 STKc_YSK4 Catalytic do  39.3      33 0.00072   26.8   3.0   19  192-210   243-261 (265)
222 cd06635 STKc_TAO1 Catalytic do  38.9      58  0.0013   26.4   4.5   20  192-211   258-277 (317)
223 cd08227 PK_STRAD_alpha Pseudok  38.4      24 0.00051   28.9   2.1   25  183-210   282-306 (327)
224 cd06637 STKc_TNIK Catalytic do  38.2      25 0.00053   27.6   2.1   19  192-210   250-268 (272)
225 cd07833 STKc_CDKL Catalytic do  38.2      20 0.00042   28.4   1.6   23  188-210   262-284 (288)
226 cd05607 STKc_GRK7 Catalytic do  37.5      28  0.0006   27.7   2.4   27  182-211   224-250 (277)
227 cd07841 STKc_CDK7 Catalytic do  37.5      26 0.00055   28.0   2.2   23  189-211   260-282 (298)
228 cd08222 STKc_Nek11 Catalytic d  37.4      43 0.00092   26.0   3.4   18  193-210   239-256 (260)
229 cd05579 STKc_MAST_like Catalyt  37.4      21 0.00045   27.7   1.6   29  182-213   228-256 (265)
230 cd07861 STKc_CDK1_euk Catalyti  37.3      22 0.00048   28.1   1.8   18  193-210   264-281 (285)
231 cd00180 PKc Catalytic domain o  37.3      25 0.00054   25.7   1.9   28  185-212   188-215 (215)
232 cd06613 STKc_MAP4K3_like Catal  37.1      28 0.00062   27.0   2.3   22  189-210   238-259 (262)
233 cd06632 STKc_MEKK1_plant Catal  37.1      35 0.00076   26.3   2.8   18  193-210   237-254 (258)
234 cd07831 STKc_MOK Catalytic dom  36.8      27 0.00059   27.5   2.2   22  189-210   257-278 (282)
235 cd06651 STKc_MEKK3 Catalytic d  36.7      18  0.0004   28.3   1.2   18  193-210   243-260 (266)
236 KOG0194 Protein tyrosine kinas  36.7      38 0.00083   30.0   3.2   31  180-213   388-418 (474)
237 cd06612 STKc_MST1_2 Catalytic   36.4      22 0.00047   27.5   1.5   19  192-210   234-252 (256)
238 cd06617 PKc_MKK3_6 Catalytic d  36.1      63  0.0014   25.4   4.2   26  182-210   235-260 (283)
239 PTZ00283 serine/threonine prot  36.1      38 0.00083   29.9   3.2   26  182-210   271-296 (496)
240 cd05583 STKc_MSK_N N-terminal   35.8      28 0.00061   27.7   2.1   22  192-213   244-265 (288)
241 cd07842 STKc_CDK8_like Catalyt  35.3      27 0.00058   28.1   2.0   24  187-210   289-312 (316)
242 cd06607 STKc_TAO Catalytic dom  35.2      33 0.00072   27.7   2.5   20  192-211   248-267 (307)
243 cd08215 STKc_Nek Catalytic dom  34.9      45 0.00098   25.5   3.2   26  182-210   229-254 (258)
244 TIGR00864 PCC polycystin catio  34.6      29 0.00062   37.2   2.3   32   78-109     1-32  (2740)
245 cd07847 STKc_CDKL1_4 Catalytic  34.2      29 0.00064   27.4   2.0   22  189-210   261-282 (286)
246 cd06649 PKc_MEK2 Catalytic dom  34.1      40 0.00088   27.6   2.9   26  182-210   275-300 (331)
247 KOG1947 Leucine rich repeat pr  32.7      14 0.00031   31.8  -0.1   62   70-131   241-306 (482)
248 cd07864 STKc_CDK12 Catalytic d  32.7      34 0.00074   27.3   2.2   27  181-210   272-298 (302)
249 cd07832 STKc_CCRK Catalytic do  32.6      34 0.00073   27.0   2.1   23  188-210   259-281 (286)
250 KOG4308 LRR-containing protein  32.6     2.2 4.8E-05   37.6  -5.1   38   96-133   262-303 (478)
251 cd06622 PKc_MAPKK_PBS2_like Ca  31.7      59  0.0013   25.7   3.4   19  192-210   243-261 (286)
252 KOG3763 mRNA export factor TAP  31.5      28 0.00061   31.2   1.5   66   46-112   217-286 (585)
253 cd06615 PKc_MEK Catalytic doma  31.0      33 0.00072   27.7   1.9   23  189-211   265-287 (308)
254 cd06639 STKc_myosinIIIB Cataly  30.9      34 0.00073   27.2   1.8   23  188-210   264-286 (291)
255 cd06619 PKc_MKK5 Catalytic dom  30.8      32  0.0007   27.2   1.7   20  192-211   234-253 (279)
256 cd06627 STKc_Cdc7_like Catalyt  30.6      42 0.00091   25.7   2.3   20  191-210   231-250 (254)
257 cd06616 PKc_MKK4 Catalytic dom  30.4      35 0.00075   27.1   1.9   26  182-210   241-266 (288)
258 cd08216 PK_STRAD Pseudokinase   30.3      39 0.00085   27.2   2.2   22  189-210   273-294 (314)
259 cd06650 PKc_MEK1 Catalytic dom  29.6      57  0.0012   26.8   3.0   25  183-210   274-298 (333)
260 cd07843 STKc_CDC2L1 Catalytic   29.4      49  0.0011   26.3   2.6   25  183-210   265-289 (293)
261 cd07829 STKc_CDK_like Catalyti  29.2      45 0.00098   26.1   2.3   23  188-210   256-278 (282)
262 cd07839 STKc_CDK5 Catalytic do  29.1      47   0.001   26.2   2.4   19  192-210   262-280 (284)
263 cd06626 STKc_MEKK4 Catalytic d  29.0      44 0.00095   25.9   2.2   19  192-210   242-260 (264)
264 cd07848 STKc_CDKL5 Catalytic d  28.6      50  0.0011   26.2   2.5   24  184-210   260-283 (287)
265 PLN00009 cyclin-dependent kina  28.5      42  0.0009   26.7   2.0   21  190-210   263-283 (294)
266 cd06618 PKc_MKK7 Catalytic dom  28.4      37  0.0008   27.2   1.7   27  182-211   247-273 (296)
267 cd06917 STKc_NAK1_like Catalyt  27.9      51  0.0011   25.9   2.4   27  182-211   229-255 (277)
268 cd07865 STKc_CDK9 Catalytic do  27.8      42 0.00092   26.8   1.9   22  189-210   285-306 (310)
269 KOG0201 Serine/threonine prote  27.7      86  0.0019   27.5   3.7   61  139-210   202-262 (467)
270 cd07852 STKc_MAPK15 Catalytic   27.6      48   0.001   27.1   2.3   23  189-211   273-295 (337)
271 cd08226 PK_STRAD_beta Pseudoki  27.4      52  0.0011   26.8   2.5   24  187-210   284-307 (328)
272 cd07858 STKc_TEY_MAPK_plant Ca  27.1      41 0.00088   27.7   1.7   22  189-210   269-290 (337)
273 PF12661 hEGF:  Human growth fa  26.7     8.5 0.00018   15.9  -1.2    6   38-43      8-13  (13)
274 cd07862 STKc_CDK6 Catalytic do  26.5      45 0.00097   26.5   1.8   22  189-210   265-286 (290)
275 cd07837 STKc_CdkB_plant Cataly  26.4      48   0.001   26.3   2.0   19  192-210   272-290 (295)
276 cd06636 STKc_MAP4K4_6 Catalyti  26.3      47   0.001   26.2   2.0   26  182-210   253-278 (282)
277 cd06643 STKc_SLK Catalytic dom  26.3      58  0.0013   25.7   2.5   26  182-210   236-261 (282)
278 cd07849 STKc_ERK1_2_like Catal  26.1      44 0.00096   27.4   1.8   23  189-211   270-292 (336)
279 cd07855 STKc_ERK5 Catalytic do  25.8      55  0.0012   26.8   2.3   26  182-210   268-293 (334)
280 cd06654 STKc_PAK1 Catalytic do  25.7      57  0.0012   26.2   2.3   19  192-210   251-269 (296)
281 cd07844 STKc_PCTAIRE_like Cata  25.6      51  0.0011   26.2   2.0   23  188-210   265-287 (291)
282 PHA03209 serine/threonine kina  25.6      34 0.00073   28.5   1.0   18  193-210   333-350 (357)
283 KOG1989 ARK protein kinase fam  25.6   1E+02  0.0022   29.0   4.0   38  172-213   272-309 (738)
284 cd06634 STKc_TAO2 Catalytic do  25.5      75  0.0016   25.6   3.0   19  193-211   249-267 (308)
285 cd06645 STKc_MAP4K3 Catalytic   25.2      67  0.0014   25.0   2.6   25  183-210   240-264 (267)
286 cd06614 STKc_PAK Catalytic dom  25.0      56  0.0012   25.9   2.2   27  182-211   244-270 (286)
287 cd07859 STKc_TDY_MAPK_plant Ca  24.9      54  0.0012   26.7   2.1   20  191-210   270-289 (338)
288 cd06658 STKc_PAK5 Catalytic do  24.9      66  0.0014   25.8   2.6   18  194-211   255-272 (292)
289 KOG0193 Serine/threonine prote  24.6      92   0.002   28.5   3.5   30  181-213   622-651 (678)
290 smart00367 LRR_CC Leucine-rich  24.5      58  0.0013   15.7   1.4   11   72-82      2-12  (26)
291 cd07873 STKc_PCTAIRE1 Catalyti  23.9      58  0.0012   26.1   2.0   19  192-210   267-285 (301)
292 cd07834 STKc_MAPK Catalytic do  23.7      67  0.0015   26.1   2.4   19  193-211   271-289 (330)
293 cd07866 STKc_BUR1 Catalytic do  23.6      59  0.0013   25.9   2.1   23  188-210   285-307 (311)
294 cd07874 STKc_JNK3 Catalytic do  23.6      56  0.0012   27.0   2.0   22  189-210   289-310 (355)
295 cd07851 STKc_p38 Catalytic dom  23.5      55  0.0012   27.0   1.9   22  189-210   276-297 (343)
296 cd06656 STKc_PAK3 Catalytic do  23.4      57  0.0012   26.2   1.9   19  192-210   250-268 (297)
297 KOG0195 Integrin-linked kinase  23.1      71  0.0015   26.4   2.3   42  167-214   404-445 (448)
298 cd06611 STKc_SLK_like Catalyti  23.0      55  0.0012   25.8   1.7   18  193-210   244-261 (280)
299 cd06630 STKc_MEKK1 Catalytic d  23.0      86  0.0019   24.3   2.9   22  189-210   242-263 (268)
300 cd07870 STKc_PFTAIRE2 Catalyti  22.7      63  0.0014   25.7   2.0   21  190-210   267-287 (291)
301 cd06644 STKc_STK10_LOK Catalyt  22.6      66  0.0014   25.6   2.2   19  192-210   250-268 (292)
302 cd07863 STKc_CDK4 Catalytic do  22.1      64  0.0014   25.5   2.0   21  190-210   264-284 (288)
303 cd07850 STKc_JNK Catalytic dom  21.6      81  0.0018   26.1   2.6   22  189-210   289-310 (353)
304 cd07836 STKc_Pho85 Catalytic d  21.4      80  0.0017   24.8   2.4   18  193-210   263-280 (284)
305 KOG4721 Serine/threonine prote  21.2 1.3E+02  0.0027   27.8   3.6   65  139-214   302-367 (904)
306 cd06659 STKc_PAK6 Catalytic do  21.1   1E+02  0.0022   24.8   2.9   18  193-210   253-270 (297)
307 cd07857 STKc_MPK1 Catalytic do  21.1      77  0.0017   25.9   2.3   22  189-210   270-291 (332)
308 cd06648 STKc_PAK_II Catalytic   20.4      66  0.0014   25.6   1.7   26  182-210   243-268 (285)

No 1  
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional
Probab=99.76  E-value=2.2e-18  Score=161.47  Aligned_cols=126  Identities=32%  Similarity=0.614  Sum_probs=100.4

Q ss_pred             ChhhhhhhhcccCCCCCCCCCCcCCCCCCCCCCcCcccceeeeCCCCCeEEEEecCCCCccccCccccCCCCCCcEEeCc
Q 035742            1 ADALLKWKASLQSHNRSLLPSWTNATTNVSSKICPCAWFGISCSDAGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLS   80 (214)
Q Consensus         1 ~~~l~~~~~~~~~~~~~~~~~W~~~~~~~~~~~~~c~w~gv~c~~~~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~   80 (214)
                      ++||++||+++.+ +...+.+| ....+      +|.|.||+|+..++++.|+|++|.++|.++ ..|..+++|+.|+++
T Consensus        31 ~~~l~~~~~~~~~-~~~~~~~w-~~~~~------~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~-~~~~~l~~L~~L~Ls  101 (968)
T PLN00113         31 LELLLSFKSSIND-PLKYLSNW-NSSAD------VCLWQGITCNNSSRVVSIDLSGKNISGKIS-SAIFRLPYIQTINLS  101 (968)
T ss_pred             HHHHHHHHHhCCC-CcccCCCC-CCCCC------CCcCcceecCCCCcEEEEEecCCCccccCC-hHHhCCCCCCEEECC
Confidence            4689999999964 45667899 45666      999999999977899999999999999998 899999999999999


Q ss_pred             CCcCcCCChhhhh-CCcccceeeccccccccCCCccccccccchhhhcccccceeecc
Q 035742           81 LNGFLGTIPSQIG-NLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHFQFNQLKLLVL  137 (214)
Q Consensus        81 ~n~l~~~~p~~~~-~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l~~N~l~g~~p  137 (214)
                      +|.+.+.+|..+. .+++|++|++++|.++|.+|.  +.+++|++|++++|.+++.+|
T Consensus       102 ~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p  157 (968)
T PLN00113        102 NNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIP  157 (968)
T ss_pred             CCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCC
Confidence            9999988998765 788888888888777765553  334555555555555555444


No 2  
>PLN03150 hypothetical protein; Provisional
Probab=99.73  E-value=7.8e-18  Score=150.54  Aligned_cols=129  Identities=29%  Similarity=0.426  Sum_probs=110.7

Q ss_pred             hhhhhhhhcccCCCCCCCCCCcCCCCCCCCCCcCcccceeeeCCC-----CCeEEEEecCCCCccccCccccCCCCCCcE
Q 035742            2 DALLKWKASLQSHNRSLLPSWTNATTNVSSKICPCAWFGISCSDA-----GRVINISLRNTGLSGTLSDFSFSSFPQLVH   76 (214)
Q Consensus         2 ~~l~~~~~~~~~~~~~~~~~W~~~~~~~~~~~~~c~w~gv~c~~~-----~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~   76 (214)
                      +||+++|+++... .  ..+|.   .++|+ .+.|.|.||.|...     ..++.|+|++|.++|.+| ..+..+++|+.
T Consensus       375 ~aL~~~k~~~~~~-~--~~~W~---g~~C~-p~~~~w~Gv~C~~~~~~~~~~v~~L~L~~n~L~g~ip-~~i~~L~~L~~  446 (623)
T PLN03150        375 SALQTLKSSLGLP-L--RFGWN---GDPCV-PQQHPWSGADCQFDSTKGKWFIDGLGLDNQGLRGFIP-NDISKLRHLQS  446 (623)
T ss_pred             HHHHHHHHhcCCc-c--cCCCC---CCCCC-CcccccccceeeccCCCCceEEEEEECCCCCccccCC-HHHhCCCCCCE
Confidence            6899999988542 1  24793   34121 11247999999621     248999999999999999 99999999999


Q ss_pred             EeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhhcccccceeecch
Q 035742           77 LDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHFQFNQLKLLVLV  138 (214)
Q Consensus        77 L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l~~N~l~g~~p~  138 (214)
                      |+|++|.+.|.+|..++.+++|+.|++++|+++|.+|..++++++|+.|+|++|+++|.+|.
T Consensus       447 L~Ls~N~l~g~iP~~~~~l~~L~~LdLs~N~lsg~iP~~l~~L~~L~~L~Ls~N~l~g~iP~  508 (623)
T PLN03150        447 INLSGNSIRGNIPPSLGSITSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSLSGRVPA  508 (623)
T ss_pred             EECCCCcccCcCChHHhCCCCCCEEECCCCCCCCCCchHHhcCCCCCEEECcCCcccccCCh
Confidence            99999999999999999999999999999999999999999999999999999999999885


No 3  
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional
Probab=99.28  E-value=3.7e-12  Score=119.74  Aligned_cols=91  Identities=32%  Similarity=0.454  Sum_probs=63.2

Q ss_pred             CCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhh
Q 035742           47 GRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLH  126 (214)
Q Consensus        47 ~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~  126 (214)
                      .+|+.|++++|.+++.+| ..+..+++|+.|++++|.+.+.+|..+..+++|++|++++|.++|.+|..+..+++|+.|+
T Consensus       475 ~~L~~L~ls~n~l~~~~~-~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~  553 (968)
T PLN00113        475 KRLENLDLSRNQFSGAVP-RKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLD  553 (968)
T ss_pred             ccceEEECcCCccCCccC-hhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEE
Confidence            356777777777776666 6666677777777777777666776676777777777777777766676666667777777


Q ss_pred             cccccceeecch
Q 035742          127 FQFNQLKLLVLV  138 (214)
Q Consensus       127 l~~N~l~g~~p~  138 (214)
                      +++|+++|.+|.
T Consensus       554 Ls~N~l~~~~p~  565 (968)
T PLN00113        554 LSQNQLSGEIPK  565 (968)
T ss_pred             CCCCcccccCCh
Confidence            777777666664


No 4  
>PLN03150 hypothetical protein; Provisional
Probab=99.07  E-value=1.4e-10  Score=104.13  Aligned_cols=91  Identities=31%  Similarity=0.466  Sum_probs=81.8

Q ss_pred             CCCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCcccccc-ccchh
Q 035742           46 AGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLL-THLKV  124 (214)
Q Consensus        46 ~~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l-~~L~~  124 (214)
                      ..+|+.|+|++|.++|.+| ..+..+++|+.|+|++|+++|.+|..++++++|+.|++++|.++|.+|..++.+ .++..
T Consensus       441 L~~L~~L~Ls~N~l~g~iP-~~~~~l~~L~~LdLs~N~lsg~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~l~~~~~~~~~  519 (623)
T PLN03150        441 LRHLQSINLSGNSIRGNIP-PSLGSITSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSLSGRVPAALGGRLLHRAS  519 (623)
T ss_pred             CCCCCEEECCCCcccCcCC-hHHhCCCCCCEEECCCCCCCCCCchHHhcCCCCCEEECcCCcccccCChHHhhccccCce
Confidence            3589999999999999999 999999999999999999999999999999999999999999999999988764 46678


Q ss_pred             hhcccccceeecc
Q 035742          125 LHFQFNQLKLLVL  137 (214)
Q Consensus       125 L~l~~N~l~g~~p  137 (214)
                      +++.+|......|
T Consensus       520 l~~~~N~~lc~~p  532 (623)
T PLN03150        520 FNFTDNAGLCGIP  532 (623)
T ss_pred             EEecCCccccCCC
Confidence            8888887655444


No 5  
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]
Probab=99.05  E-value=2.2e-11  Score=90.43  Aligned_cols=84  Identities=25%  Similarity=0.441  Sum_probs=58.8

Q ss_pred             CCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhh
Q 035742           47 GRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLH  126 (214)
Q Consensus        47 ~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~  126 (214)
                      ++++.|.|++|.++ .+| +.+..+.+|+.|++++|++. .+|..+..++.|+.|+++-|++. .+|..|+.++.|+.||
T Consensus        33 s~ITrLtLSHNKl~-~vp-pnia~l~nlevln~~nnqie-~lp~~issl~klr~lnvgmnrl~-~lprgfgs~p~levld  108 (264)
T KOG0617|consen   33 SNITRLTLSHNKLT-VVP-PNIAELKNLEVLNLSNNQIE-ELPTSISSLPKLRILNVGMNRLN-ILPRGFGSFPALEVLD  108 (264)
T ss_pred             hhhhhhhcccCcee-ecC-CcHHHhhhhhhhhcccchhh-hcChhhhhchhhhheecchhhhh-cCccccCCCchhhhhh
Confidence            46677777777777 666 67777777777777777776 66777777777777777777766 6677777777776666


Q ss_pred             ccccccee
Q 035742          127 FQFNQLKL  134 (214)
Q Consensus       127 l~~N~l~g  134 (214)
                      +..|+++.
T Consensus       109 ltynnl~e  116 (264)
T KOG0617|consen  109 LTYNNLNE  116 (264)
T ss_pred             cccccccc
Confidence            66666653


No 6  
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]
Probab=99.01  E-value=4e-11  Score=89.12  Aligned_cols=105  Identities=21%  Similarity=0.297  Sum_probs=91.5

Q ss_pred             CCCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeecccccccc-CCCccccccccchh
Q 035742           46 AGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSG-KIPLEVGLLTHLKV  124 (214)
Q Consensus        46 ~~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g-~~p~~~~~l~~L~~  124 (214)
                      ..+|+.|++.+|++. .+| ..++.++.|+.|++.-|++. .+|..|+.++.|+.||+.+|++.. .+|..|..++.|+.
T Consensus        55 l~nlevln~~nnqie-~lp-~~issl~klr~lnvgmnrl~-~lprgfgs~p~levldltynnl~e~~lpgnff~m~tlra  131 (264)
T KOG0617|consen   55 LKNLEVLNLSNNQIE-ELP-TSISSLPKLRILNVGMNRLN-ILPRGFGSFPALEVLDLTYNNLNENSLPGNFFYMTTLRA  131 (264)
T ss_pred             hhhhhhhhcccchhh-hcC-hhhhhchhhhheecchhhhh-cCccccCCCchhhhhhccccccccccCCcchhHHHHHHH
Confidence            347889999999999 899 99999999999999999998 899999999999999999999974 58889999999999


Q ss_pred             hhcccccceeecchhhhhcCCCCchhhhh
Q 035742          125 LHFQFNQLKLLVLVLEVIKGKHPRDFLCS  153 (214)
Q Consensus       125 L~l~~N~l~g~~p~~~~l~g~~p~~~~~~  153 (214)
                      |++++|.|.-.+|+.+.++..--..+..|
T Consensus       132 lyl~dndfe~lp~dvg~lt~lqil~lrdn  160 (264)
T KOG0617|consen  132 LYLGDNDFEILPPDVGKLTNLQILSLRDN  160 (264)
T ss_pred             HHhcCCCcccCChhhhhhcceeEEeeccC
Confidence            99999999998888777775544444443


No 7  
>PF13855 LRR_8:  Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A ....
Probab=98.97  E-value=3.6e-10  Score=70.61  Aligned_cols=60  Identities=35%  Similarity=0.552  Sum_probs=38.2

Q ss_pred             CeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeecccccc
Q 035742           48 RVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQL  108 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l  108 (214)
                      +|+.|++++|.++ .+|...|.++++|++|++++|.+....|..|..+++|++|++++|+|
T Consensus         2 ~L~~L~l~~n~l~-~i~~~~f~~l~~L~~L~l~~N~l~~i~~~~f~~l~~L~~L~l~~N~l   61 (61)
T PF13855_consen    2 NLESLDLSNNKLT-EIPPDSFSNLPNLETLDLSNNNLTSIPPDAFSNLPNLRYLDLSNNNL   61 (61)
T ss_dssp             TESEEEETSSTES-EECTTTTTTGTTESEEEETSSSESEEETTTTTTSTTESEEEETSSSB
T ss_pred             cCcEEECCCCCCC-ccCHHHHcCCCCCCEeEccCCccCccCHHHHcCCCCCCEEeCcCCcC
Confidence            4666777777666 44435666666777777766666644455566666666666666654


No 8  
>PF13855 LRR_8:  Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A ....
Probab=98.95  E-value=2.5e-10  Score=71.31  Aligned_cols=61  Identities=33%  Similarity=0.441  Sum_probs=55.1

Q ss_pred             CCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhhcccccc
Q 035742           72 PQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHFQFNQL  132 (214)
Q Consensus        72 ~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l~~N~l  132 (214)
                      ++|+.|++++|+++...+..|..+++|++|++++|.++...|..|.++++|++|++++|+|
T Consensus         1 p~L~~L~l~~n~l~~i~~~~f~~l~~L~~L~l~~N~l~~i~~~~f~~l~~L~~L~l~~N~l   61 (61)
T PF13855_consen    1 PNLESLDLSNNKLTEIPPDSFSNLPNLETLDLSNNNLTSIPPDAFSNLPNLRYLDLSNNNL   61 (61)
T ss_dssp             TTESEEEETSSTESEECTTTTTTGTTESEEEETSSSESEEETTTTTTSTTESEEEETSSSB
T ss_pred             CcCcEEECCCCCCCccCHHHHcCCCCCCEeEccCCccCccCHHHHcCCCCCCEEeCcCCcC
Confidence            5789999999999955556789999999999999999977778999999999999999975


No 9  
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]
Probab=98.82  E-value=2e-09  Score=89.17  Aligned_cols=107  Identities=23%  Similarity=0.381  Sum_probs=89.4

Q ss_pred             CCCCCcCccc---ceeeeCCCC----------CeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCC
Q 035742           29 VSSKICPCAW---FGISCSDAG----------RVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNL   95 (214)
Q Consensus        29 ~~~~~~~c~w---~gv~c~~~~----------~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l   95 (214)
                      -|-+.|.|.-   .-|+|+..+          ..++|+|..|.|+ .||+..|..+.+|+.|||++|+|+..-|.+|..+
T Consensus        36 ~CP~pC~Cs~~~g~~VdCr~~GL~eVP~~LP~~tveirLdqN~I~-~iP~~aF~~l~~LRrLdLS~N~Is~I~p~AF~GL  114 (498)
T KOG4237|consen   36 ACPAPCTCSDVEGGIVDCRGKGLTEVPANLPPETVEIRLDQNQIS-SIPPGAFKTLHRLRRLDLSKNNISFIAPDAFKGL  114 (498)
T ss_pred             cCCCCcccCCCCCceEEccCCCcccCcccCCCcceEEEeccCCcc-cCChhhccchhhhceecccccchhhcChHhhhhh
Confidence            3556677765   558898532          6788999999999 7887999999999999999999999999999999


Q ss_pred             cccceeeccc-cccccCCC-ccccccccchhhhcccccceeecc
Q 035742           96 SKLSYISLQS-NQLSGKIP-LEVGLLTHLKVLHFQFNQLKLLVL  137 (214)
Q Consensus        96 ~~L~~L~ls~-N~l~g~~p-~~~~~l~~L~~L~l~~N~l~g~~p  137 (214)
                      ++|..|-+-+ |+|+ .+| ..|+++.+|+.|.+.-|++.....
T Consensus       115 ~~l~~Lvlyg~NkI~-~l~k~~F~gL~slqrLllNan~i~Cir~  157 (498)
T KOG4237|consen  115 ASLLSLVLYGNNKIT-DLPKGAFGGLSSLQRLLLNANHINCIRQ  157 (498)
T ss_pred             HhhhHHHhhcCCchh-hhhhhHhhhHHHHHHHhcChhhhcchhH
Confidence            9988887666 9999 555 578999999999999998876543


No 10 
>PF08263 LRRNT_2:  Leucine rich repeat N-terminal domain;  InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []. LRRs occur in proteins ranging from viruses to eukaryotes, and appear to provide a structural framework for the formation of protein-protein interactions [, ].Proteins containing LRRs include tyrosine kinase receptors, cell-adhesion molecules, virulence factors, and extracellular matrix-binding glycoproteins, and are involved in a variety of biological processes, including signal transduction, cell adhesion, DNA repair, recombination, transcription, RNA processing, disease resistance, apoptosis, and the immune response []. Sequence analyses of LRR proteins suggested the existence of several different subfamilies of LRRs. The significance of this classification is that repeats from different subfamilies never occur simultaneously and have most probably evolved independently. It is, however, now clear that all major classes of LRR have curved horseshoe structures with a parallel beta sheet on the concave side and mostly helical elements on the convex side. At least six families of LRR proteins, characterised by different lengths and consensus sequences of the repeats, have been identified. Eleven-residue segments of the LRRs (LxxLxLxxN/CxL), corresponding to the beta-strand and adjacent loop regions, are conserved in LRR proteins, whereas the remaining parts of the repeats (herein termed variable) may be very different. Despite the differences, each of the variable parts contains two half-turns at both ends and a "linear" segment (as the chain follows a linear path overall), usually formed by a helix, in the middle. The concave face and the adjacent loops are the most common protein interaction surfaces on LRR proteins. 3D structure of some LRR proteins-ligand complexes show that the concave surface of LRR domain is ideal for interaction with alpha-helix, thus supporting earlier conclusions that the elongated and curved LRR structure provides an outstanding framework for achieving diverse protein-protein interactions []. Molecular modeling suggests that the conserved pattern LxxLxL, which is shorter than the previously proposed LxxLxLxxN/CxL is sufficient to impart the characteristic horseshoe curvature to proteins with 20- to 30-residue repeats [].  This domain is often found at the N terminus of tandem leucine rich repeats.; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1OGQ_A.
Probab=98.81  E-value=2.7e-09  Score=61.78  Aligned_cols=37  Identities=38%  Similarity=0.969  Sum_probs=27.0

Q ss_pred             ChhhhhhhhcccCCCCCCCCCCcCCC--CCCCCCCcCcccceeeeC
Q 035742            1 ADALLKWKASLQSHNRSLLPSWTNAT--TNVSSKICPCAWFGISCS   44 (214)
Q Consensus         1 ~~~l~~~~~~~~~~~~~~~~~W~~~~--~~~~~~~~~c~w~gv~c~   44 (214)
                      ++||++||.++.+++...+.+|. .+  .+      +|.|.||+|+
T Consensus         5 ~~aLl~~k~~l~~~~~~~l~~W~-~~~~~~------~C~W~GV~Cd   43 (43)
T PF08263_consen    5 RQALLAFKKSLNNDPSGVLSSWN-PSSDSD------PCSWSGVTCD   43 (43)
T ss_dssp             HHHHHHHHHCTT-SC-CCCTT---TT--S-------CCCSTTEEE-
T ss_pred             HHHHHHHHHhcccccCcccccCC-CcCCCC------CeeeccEEeC
Confidence            47999999999976567899994 43  56      9999999995


No 11 
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]
Probab=98.76  E-value=1.1e-09  Score=94.64  Aligned_cols=90  Identities=21%  Similarity=0.147  Sum_probs=52.6

Q ss_pred             CeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhhc
Q 035742           48 RVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHF  127 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l  127 (214)
                      .|+.|+|+.|.|....+ ..+...++|++|+|++|+++..-+.+|..+..|+.|+|++|.+...--..|..+++|+.|||
T Consensus       294 ~L~~L~lS~NaI~rih~-d~WsftqkL~~LdLs~N~i~~l~~~sf~~L~~Le~LnLs~Nsi~~l~e~af~~lssL~~LdL  372 (873)
T KOG4194|consen  294 SLEQLDLSYNAIQRIHI-DSWSFTQKLKELDLSSNRITRLDEGSFRVLSQLEELNLSHNSIDHLAEGAFVGLSSLHKLDL  372 (873)
T ss_pred             hhhhhccchhhhheeec-chhhhcccceeEeccccccccCChhHHHHHHHhhhhcccccchHHHHhhHHHHhhhhhhhcC
Confidence            34455555555554434 45555555556666666655444555555555566666666555333344666777777777


Q ss_pred             ccccceeecch
Q 035742          128 QFNQLKLLVLV  138 (214)
Q Consensus       128 ~~N~l~g~~p~  138 (214)
                      ++|.+++.|-+
T Consensus       373 r~N~ls~~IED  383 (873)
T KOG4194|consen  373 RSNELSWCIED  383 (873)
T ss_pred             cCCeEEEEEec
Confidence            77777776654


No 12 
>KOG0472 consensus Leucine-rich repeat protein [Function unknown]
Probab=98.73  E-value=2.1e-09  Score=89.27  Aligned_cols=105  Identities=22%  Similarity=0.270  Sum_probs=61.3

Q ss_pred             CCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhh
Q 035742           47 GRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLH  126 (214)
Q Consensus        47 ~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~  126 (214)
                      .+++.|+|++|-+. .+| .+++.+..|+.|+++.|+|. .+|..+..+..++.+-.++|++....|..+.++.+|.+||
T Consensus       435 ~kLt~L~L~NN~Ln-~LP-~e~~~lv~Lq~LnlS~NrFr-~lP~~~y~lq~lEtllas~nqi~~vd~~~l~nm~nL~tLD  511 (565)
T KOG0472|consen  435 QKLTFLDLSNNLLN-DLP-EEMGSLVRLQTLNLSFNRFR-MLPECLYELQTLETLLASNNQIGSVDPSGLKNMRNLTTLD  511 (565)
T ss_pred             hcceeeecccchhh-hcc-hhhhhhhhhheecccccccc-cchHHHhhHHHHHHHHhccccccccChHHhhhhhhcceec
Confidence            46777777777766 777 77777777888888877775 5555544444444444444444422222355555555555


Q ss_pred             cccccceeecchhhhhcCCCCchhhhhh
Q 035742          127 FQFNQLKLLVLVLEVIKGKHPRDFLCSI  154 (214)
Q Consensus       127 l~~N~l~g~~p~~~~l~g~~p~~~~~~~  154 (214)
                      +.+|.+...+|.+..++...-.++..|.
T Consensus       512 L~nNdlq~IPp~LgnmtnL~hLeL~gNp  539 (565)
T KOG0472|consen  512 LQNNDLQQIPPILGNMTNLRHLELDGNP  539 (565)
T ss_pred             cCCCchhhCChhhccccceeEEEecCCc
Confidence            5555555555555555544444444443


No 13 
>PF14580 LRR_9:  Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A.
Probab=98.69  E-value=2.3e-08  Score=75.58  Aligned_cols=82  Identities=27%  Similarity=0.374  Sum_probs=24.6

Q ss_pred             CeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhh-hCCcccceeeccccccccC-CCccccccccchhh
Q 035742           48 RVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQI-GNLSKLSYISLQSNQLSGK-IPLEVGLLTHLKVL  125 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~-~~l~~L~~L~ls~N~l~g~-~p~~~~~l~~L~~L  125 (214)
                      +++.|+|++|.|+ .+.  .+..++.|+.|++++|.++ .+.+.+ ..+++|+.|++++|+|... .-..+..+++|+.|
T Consensus        43 ~L~~L~Ls~N~I~-~l~--~l~~L~~L~~L~L~~N~I~-~i~~~l~~~lp~L~~L~L~~N~I~~l~~l~~L~~l~~L~~L  118 (175)
T PF14580_consen   43 KLEVLDLSNNQIT-KLE--GLPGLPRLKTLDLSNNRIS-SISEGLDKNLPNLQELYLSNNKISDLNELEPLSSLPKLRVL  118 (175)
T ss_dssp             T--EEE-TTS--S---T--T----TT--EEE--SS----S-CHHHHHH-TT--EEE-TTS---SCCCCGGGGG-TT--EE
T ss_pred             CCCEEECCCCCCc-ccc--CccChhhhhhcccCCCCCC-ccccchHHhCCcCCEEECcCCcCCChHHhHHHHcCCCccee
Confidence            4555566666555 333  3555555666666666555 233233 2455566666666655421 11234445555555


Q ss_pred             hcccccce
Q 035742          126 HFQFNQLK  133 (214)
Q Consensus       126 ~l~~N~l~  133 (214)
                      ++.+|.++
T Consensus       119 ~L~~NPv~  126 (175)
T PF14580_consen  119 SLEGNPVC  126 (175)
T ss_dssp             E-TT-GGG
T ss_pred             eccCCccc
Confidence            55555554


No 14 
>PF14580 LRR_9:  Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A.
Probab=98.65  E-value=1.6e-08  Score=76.41  Aligned_cols=81  Identities=25%  Similarity=0.378  Sum_probs=29.9

Q ss_pred             CeEEEEecCCCCccccCccccC-CCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccc-cccccchhh
Q 035742           48 RVINISLRNTGLSGTLSDFSFS-SFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEV-GLLTHLKVL  125 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~~p~~~~~-~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~-~~l~~L~~L  125 (214)
                      +++.|+|++|.|+ .+.  .++ .+.+|+.|++++|.++ .++ .+..+++|+.|++++|+++ .+...+ ..+++|+.|
T Consensus        20 ~~~~L~L~~n~I~-~Ie--~L~~~l~~L~~L~Ls~N~I~-~l~-~l~~L~~L~~L~L~~N~I~-~i~~~l~~~lp~L~~L   93 (175)
T PF14580_consen   20 KLRELNLRGNQIS-TIE--NLGATLDKLEVLDLSNNQIT-KLE-GLPGLPRLKTLDLSNNRIS-SISEGLDKNLPNLQEL   93 (175)
T ss_dssp             -------------------S--TT-TT--EEE-TTS--S---T-T----TT--EEE--SS----S-CHHHHHH-TT--EE
T ss_pred             ccccccccccccc-ccc--chhhhhcCCCEEECCCCCCc-ccc-CccChhhhhhcccCCCCCC-ccccchHHhCCcCCEE
Confidence            5799999999998 554  565 6899999999999998 444 6788999999999999999 565545 468999999


Q ss_pred             hccccccee
Q 035742          126 HFQFNQLKL  134 (214)
Q Consensus       126 ~l~~N~l~g  134 (214)
                      ++++|++..
T Consensus        94 ~L~~N~I~~  102 (175)
T PF14580_consen   94 YLSNNKISD  102 (175)
T ss_dssp             E-TTS---S
T ss_pred             ECcCCcCCC
Confidence            999999974


No 15 
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]
Probab=98.63  E-value=1.1e-08  Score=89.65  Aligned_cols=93  Identities=23%  Similarity=0.323  Sum_probs=56.9

Q ss_pred             CeEEEEecCCCCcc-ccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCcc-ccccccchhh
Q 035742           48 RVINISLRNTGLSG-TLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLE-VGLLTHLKVL  125 (214)
Q Consensus        48 ~L~~L~L~~n~l~g-~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~-~~~l~~L~~L  125 (214)
                      .|+++.+..|+++. .+| ..+..+..|+.||||+|++. ..|..+....++-.|+||+|+|. .||.. |.+++.|-+|
T Consensus        79 ~LRsv~~R~N~LKnsGiP-~diF~l~dLt~lDLShNqL~-EvP~~LE~AKn~iVLNLS~N~Ie-tIPn~lfinLtDLLfL  155 (1255)
T KOG0444|consen   79 RLRSVIVRDNNLKNSGIP-TDIFRLKDLTILDLSHNQLR-EVPTNLEYAKNSIVLNLSYNNIE-TIPNSLFINLTDLLFL  155 (1255)
T ss_pred             hhHHHhhhccccccCCCC-chhcccccceeeecchhhhh-hcchhhhhhcCcEEEEcccCccc-cCCchHHHhhHhHhhh
Confidence            45555556665542 255 56666666666666666666 56666666666666666666666 55533 4566666666


Q ss_pred             hcccccceeecchhhhhc
Q 035742          126 HFQFNQLKLLVLVLEVIK  143 (214)
Q Consensus       126 ~l~~N~l~g~~p~~~~l~  143 (214)
                      ||++|++...+|....+.
T Consensus       156 DLS~NrLe~LPPQ~RRL~  173 (1255)
T KOG0444|consen  156 DLSNNRLEMLPPQIRRLS  173 (1255)
T ss_pred             ccccchhhhcCHHHHHHh
Confidence            666666666666544443


No 16 
>KOG0472 consensus Leucine-rich repeat protein [Function unknown]
Probab=98.61  E-value=5.1e-09  Score=87.05  Aligned_cols=96  Identities=24%  Similarity=0.278  Sum_probs=83.5

Q ss_pred             CcccceeeeCCC---------------CCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccc
Q 035742           35 PCAWFGISCSDA---------------GRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLS   99 (214)
Q Consensus        35 ~c~w~gv~c~~~---------------~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~   99 (214)
                      -|.+.-.+|-+.               ..|+.|+++.|+|. .+| ..+..+..++.+-.++|++...-|..+.++.+|.
T Consensus       431 l~~l~kLt~L~L~NN~Ln~LP~e~~~lv~Lq~LnlS~NrFr-~lP-~~~y~lq~lEtllas~nqi~~vd~~~l~nm~nL~  508 (565)
T KOG0472|consen  431 LSQLQKLTFLDLSNNLLNDLPEEMGSLVRLQTLNLSFNRFR-MLP-ECLYELQTLETLLASNNQIGSVDPSGLKNMRNLT  508 (565)
T ss_pred             HHhhhcceeeecccchhhhcchhhhhhhhhheecccccccc-cch-HHHhhHHHHHHHHhccccccccChHHhhhhhhcc
Confidence            677777777531               26899999999998 889 7777778888888888999856666699999999


Q ss_pred             eeeccccccccCCCccccccccchhhhcccccce
Q 035742          100 YISLQSNQLSGKIPLEVGLLTHLKVLHFQFNQLK  133 (214)
Q Consensus       100 ~L~ls~N~l~g~~p~~~~~l~~L~~L~l~~N~l~  133 (214)
                      .||+.+|.+. .+|+.++++++|++|++.+|.|+
T Consensus       509 tLDL~nNdlq-~IPp~LgnmtnL~hLeL~gNpfr  541 (565)
T KOG0472|consen  509 TLDLQNNDLQ-QIPPILGNMTNLRHLELDGNPFR  541 (565)
T ss_pred             eeccCCCchh-hCChhhccccceeEEEecCCccC
Confidence            9999999999 99999999999999999999998


No 17 
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]
Probab=98.58  E-value=6.9e-09  Score=93.73  Aligned_cols=86  Identities=29%  Similarity=0.425  Sum_probs=78.8

Q ss_pred             CCCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhh
Q 035742           46 AGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVL  125 (214)
Q Consensus        46 ~~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L  125 (214)
                      ..+|+.|+|++|.|. .+|+..+.++..|+.|+||+|.++ .+|..+.++..|++|...+|++. .+| .+.+++.|+++
T Consensus       382 ~~hLKVLhLsyNrL~-~fpas~~~kle~LeeL~LSGNkL~-~Lp~tva~~~~L~tL~ahsN~l~-~fP-e~~~l~qL~~l  457 (1081)
T KOG0618|consen  382 FKHLKVLHLSYNRLN-SFPASKLRKLEELEELNLSGNKLT-TLPDTVANLGRLHTLRAHSNQLL-SFP-ELAQLPQLKVL  457 (1081)
T ss_pred             ccceeeeeecccccc-cCCHHHHhchHHhHHHhcccchhh-hhhHHHHhhhhhHHHhhcCCcee-ech-hhhhcCcceEE
Confidence            348999999999998 888778999999999999999998 89999999999999999999998 888 78999999999


Q ss_pred             hcccccceee
Q 035742          126 HFQFNQLKLL  135 (214)
Q Consensus       126 ~l~~N~l~g~  135 (214)
                      |++.|+++..
T Consensus       458 DlS~N~L~~~  467 (1081)
T KOG0618|consen  458 DLSCNNLSEV  467 (1081)
T ss_pred             ecccchhhhh
Confidence            9999998753


No 18 
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]
Probab=98.55  E-value=1.4e-08  Score=88.04  Aligned_cols=87  Identities=20%  Similarity=0.201  Sum_probs=70.4

Q ss_pred             CCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhh
Q 035742           47 GRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLH  126 (214)
Q Consensus        47 ~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~  126 (214)
                      .+++.|+|+.|+++..-. ..+.+++.|+.|++++|.|...-+..+...++|++|+|++|+++...+..|..+..|++|+
T Consensus       269 ~kme~l~L~~N~l~~vn~-g~lfgLt~L~~L~lS~NaI~rih~d~WsftqkL~~LdLs~N~i~~l~~~sf~~L~~Le~Ln  347 (873)
T KOG4194|consen  269 EKMEHLNLETNRLQAVNE-GWLFGLTSLEQLDLSYNAIQRIHIDSWSFTQKLKELDLSSNRITRLDEGSFRVLSQLEELN  347 (873)
T ss_pred             cccceeecccchhhhhhc-ccccccchhhhhccchhhhheeecchhhhcccceeEeccccccccCChhHHHHHHHhhhhc
Confidence            367888888888884434 7788888888888888888878888888888888888888888855666788888888888


Q ss_pred             ccccccee
Q 035742          127 FQFNQLKL  134 (214)
Q Consensus       127 l~~N~l~g  134 (214)
                      |++|.+..
T Consensus       348 Ls~Nsi~~  355 (873)
T KOG4194|consen  348 LSHNSIDH  355 (873)
T ss_pred             ccccchHH
Confidence            88888764


No 19 
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]
Probab=98.49  E-value=4e-08  Score=86.13  Aligned_cols=83  Identities=25%  Similarity=0.394  Sum_probs=71.2

Q ss_pred             CCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhh-hhCCcccceeeccccccccCCCccccccccchhh
Q 035742           47 GRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQ-IGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVL  125 (214)
Q Consensus        47 ~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~-~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L  125 (214)
                      ..|+.|||++|.++ ..| ..+....++-.|+||+|+|. .+|.. +.+++.|-+||||+|++. .+|+.+..+..|++|
T Consensus       103 ~dLt~lDLShNqL~-EvP-~~LE~AKn~iVLNLS~N~Ie-tIPn~lfinLtDLLfLDLS~NrLe-~LPPQ~RRL~~LqtL  178 (1255)
T KOG0444|consen  103 KDLTILDLSHNQLR-EVP-TNLEYAKNSIVLNLSYNNIE-TIPNSLFINLTDLLFLDLSNNRLE-MLPPQIRRLSMLQTL  178 (1255)
T ss_pred             ccceeeecchhhhh-hcc-hhhhhhcCcEEEEcccCccc-cCCchHHHhhHhHhhhccccchhh-hcCHHHHHHhhhhhh
Confidence            46888999999998 888 88888889999999999998 66655 668899999999999998 888888999999999


Q ss_pred             hcccccce
Q 035742          126 HFQFNQLK  133 (214)
Q Consensus       126 ~l~~N~l~  133 (214)
                      .|++|.+.
T Consensus       179 ~Ls~NPL~  186 (1255)
T KOG0444|consen  179 KLSNNPLN  186 (1255)
T ss_pred             hcCCChhh
Confidence            99999764


No 20 
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]
Probab=98.34  E-value=6.7e-08  Score=83.56  Aligned_cols=87  Identities=26%  Similarity=0.418  Sum_probs=63.7

Q ss_pred             EEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhhccccc
Q 035742           52 ISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHFQFNQ  131 (214)
Q Consensus        52 L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l~~N~  131 (214)
                      +.|..|.+. .+| ..+.++..|++|+|+.|+++ .+|..+..|+ |+.|.+++|+++ .+|..++.+..|..|+.+.|+
T Consensus       103 liLy~n~~r-~ip-~~i~~L~~lt~l~ls~NqlS-~lp~~lC~lp-Lkvli~sNNkl~-~lp~~ig~~~tl~~ld~s~ne  177 (722)
T KOG0532|consen  103 LILYHNCIR-TIP-EAICNLEALTFLDLSSNQLS-HLPDGLCDLP-LKVLIVSNNKLT-SLPEEIGLLPTLAHLDVSKNE  177 (722)
T ss_pred             HHHHhccce-ecc-hhhhhhhHHHHhhhccchhh-cCChhhhcCc-ceeEEEecCccc-cCCcccccchhHHHhhhhhhh
Confidence            344445554 566 66777788888888888887 7777777777 788888888887 788888877788888888888


Q ss_pred             ceeecchhhhhc
Q 035742          132 LKLLVLVLEVIK  143 (214)
Q Consensus       132 l~g~~p~~~~l~  143 (214)
                      +...++.+..+.
T Consensus       178 i~slpsql~~l~  189 (722)
T KOG0532|consen  178 IQSLPSQLGYLT  189 (722)
T ss_pred             hhhchHHhhhHH
Confidence            877666544443


No 21 
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional
Probab=98.33  E-value=3.1e-07  Score=83.85  Aligned_cols=61  Identities=26%  Similarity=0.266  Sum_probs=40.4

Q ss_pred             CCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhhcccccceeecch
Q 035742           73 QLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHFQFNQLKLLVLV  138 (214)
Q Consensus        73 ~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l~~N~l~g~~p~  138 (214)
                      +|+.|++++|.++ .+|..   ..+|+.|++++|+|+ .+|..+.++++|+.|+|++|+|++.+|.
T Consensus       403 ~L~~LdLS~N~Ls-sIP~l---~~~L~~L~Ls~NqLt-~LP~sl~~L~~L~~LdLs~N~Ls~~~~~  463 (788)
T PRK15387        403 ELKELMVSGNRLT-SLPML---PSGLLSLSVYRNQLT-RLPESLIHLSSETTVNLEGNPLSERTLQ  463 (788)
T ss_pred             CCCEEEccCCcCC-CCCcc---hhhhhhhhhccCccc-ccChHHhhccCCCeEECCCCCCCchHHH
Confidence            4555555555555 34432   234666777777777 6777777788888888888888877654


No 22 
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]
Probab=98.31  E-value=1.4e-07  Score=67.89  Aligned_cols=84  Identities=24%  Similarity=0.386  Sum_probs=68.4

Q ss_pred             CCCeEEEEecCCCCccccCccccC-CCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchh
Q 035742           46 AGRVINISLRNTGLSGTLSDFSFS-SFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKV  124 (214)
Q Consensus        46 ~~~L~~L~L~~n~l~g~~p~~~~~-~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~  124 (214)
                      .-+|+.++|++|.+. .+| +.|. .++.++.|++++|.++ .+|.++..++.|+.++++.|.|. ..|.-+..+.+|..
T Consensus        52 ~~el~~i~ls~N~fk-~fp-~kft~kf~t~t~lNl~~neis-dvPeE~Aam~aLr~lNl~~N~l~-~~p~vi~~L~~l~~  127 (177)
T KOG4579|consen   52 GYELTKISLSDNGFK-KFP-KKFTIKFPTATTLNLANNEIS-DVPEELAAMPALRSLNLRFNPLN-AEPRVIAPLIKLDM  127 (177)
T ss_pred             CceEEEEecccchhh-hCC-HHHhhccchhhhhhcchhhhh-hchHHHhhhHHhhhcccccCccc-cchHHHHHHHhHHH
Confidence            346788889999888 777 5554 4568888999999988 78888888999999999999888 78888888888888


Q ss_pred             hhcccccce
Q 035742          125 LHFQFNQLK  133 (214)
Q Consensus       125 L~l~~N~l~  133 (214)
                      |+..+|.+.
T Consensus       128 Lds~~na~~  136 (177)
T KOG4579|consen  128 LDSPENARA  136 (177)
T ss_pred             hcCCCCccc
Confidence            888888765


No 23 
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]
Probab=98.26  E-value=2.5e-07  Score=76.93  Aligned_cols=86  Identities=22%  Similarity=0.211  Sum_probs=55.6

Q ss_pred             CCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhh
Q 035742           47 GRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLH  126 (214)
Q Consensus        47 ~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~  126 (214)
                      .+|+.|+|++|.|++.-+ .+|.++..++.|.|..|++...-...|.++..|+.|+|.+|+|+-.-|..|..+.+|.+|+
T Consensus       274 ~~L~~lnlsnN~i~~i~~-~aFe~~a~l~eL~L~~N~l~~v~~~~f~~ls~L~tL~L~~N~it~~~~~aF~~~~~l~~l~  352 (498)
T KOG4237|consen  274 PNLRKLNLSNNKITRIED-GAFEGAAELQELYLTRNKLEFVSSGMFQGLSGLKTLSLYDNQITTVAPGAFQTLFSLSTLN  352 (498)
T ss_pred             ccceEeccCCCccchhhh-hhhcchhhhhhhhcCcchHHHHHHHhhhccccceeeeecCCeeEEEecccccccceeeeee
Confidence            466666777777664444 6666677777777777766644444566666677777777777656666666666666666


Q ss_pred             cccccce
Q 035742          127 FQFNQLK  133 (214)
Q Consensus       127 l~~N~l~  133 (214)
                      |-.|.|.
T Consensus       353 l~~Np~~  359 (498)
T KOG4237|consen  353 LLSNPFN  359 (498)
T ss_pred             hccCccc
Confidence            6666553


No 24 
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]
Probab=98.26  E-value=1.4e-07  Score=85.44  Aligned_cols=100  Identities=26%  Similarity=0.485  Sum_probs=85.9

Q ss_pred             CeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhhc
Q 035742           48 RVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHF  127 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l  127 (214)
                      +|.+|++++|.+. ..| ..+..+..|+.|+++.|-+. ..|.+..++.+|+++.|..|++. .+|.++..+.+|++|++
T Consensus        46 ~L~~l~lsnn~~~-~fp-~~it~l~~L~~ln~s~n~i~-~vp~s~~~~~~l~~lnL~~n~l~-~lP~~~~~lknl~~Ldl  121 (1081)
T KOG0618|consen   46 KLKSLDLSNNQIS-SFP-IQITLLSHLRQLNLSRNYIR-SVPSSCSNMRNLQYLNLKNNRLQ-SLPASISELKNLQYLDL  121 (1081)
T ss_pred             eeEEeeccccccc-cCC-chhhhHHHHhhcccchhhHh-hCchhhhhhhcchhheeccchhh-cCchhHHhhhccccccc
Confidence            4899999999987 888 88999999999999999998 88899999999999999999998 99999999999999999


Q ss_pred             ccccceeecchhhhhcCCCCchhh
Q 035742          128 QFNQLKLLVLVLEVIKGKHPRDFL  151 (214)
Q Consensus       128 ~~N~l~g~~p~~~~l~g~~p~~~~  151 (214)
                      +.|+|.-.++.++.++-..-..++
T Consensus       122 S~N~f~~~Pl~i~~lt~~~~~~~s  145 (1081)
T KOG0618|consen  122 SFNHFGPIPLVIEVLTAEEELAAS  145 (1081)
T ss_pred             chhccCCCchhHHhhhHHHHHhhh
Confidence            999998666655544443333333


No 25 
>PF12799 LRR_4:  Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B ....
Probab=98.24  E-value=1e-06  Score=51.09  Aligned_cols=36  Identities=36%  Similarity=0.575  Sum_probs=17.1

Q ss_pred             CCcEEeCcCCcCcCCChhhhhCCcccceeeccccccc
Q 035742           73 QLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLS  109 (214)
Q Consensus        73 ~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~  109 (214)
                      +|++|++++|+|+ .+|+.++++++|+.|++++|+|+
T Consensus         2 ~L~~L~l~~N~i~-~l~~~l~~l~~L~~L~l~~N~i~   37 (44)
T PF12799_consen    2 NLEELDLSNNQIT-DLPPELSNLPNLETLNLSNNPIS   37 (44)
T ss_dssp             T-SEEEETSSS-S-SHGGHGTTCTTSSEEEETSSCCS
T ss_pred             cceEEEccCCCCc-ccCchHhCCCCCCEEEecCCCCC
Confidence            3455555555554 34444555555555555555544


No 26 
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]
Probab=98.15  E-value=3.8e-07  Score=73.65  Aligned_cols=57  Identities=25%  Similarity=0.361  Sum_probs=31.7

Q ss_pred             eEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccc
Q 035742           49 VINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLS  109 (214)
Q Consensus        49 L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~  109 (214)
                      |+.+||++|.|+ .+. ++..-++.++.|++++|.+. .+ ..+..+++|+.||||+|.++
T Consensus       286 LtelDLS~N~I~-~iD-ESvKL~Pkir~L~lS~N~i~-~v-~nLa~L~~L~~LDLS~N~Ls  342 (490)
T KOG1259|consen  286 LTELDLSGNLIT-QID-ESVKLAPKLRRLILSQNRIR-TV-QNLAELPQLQLLDLSGNLLA  342 (490)
T ss_pred             hhhccccccchh-hhh-hhhhhccceeEEecccccee-ee-hhhhhcccceEeecccchhH
Confidence            555666666655 444 55555556666666666554 22 23555556666666666554


No 27 
>PF12799 LRR_4:  Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B ....
Probab=98.14  E-value=8.8e-07  Score=51.32  Aligned_cols=39  Identities=26%  Similarity=0.455  Sum_probs=33.6

Q ss_pred             cccceeeccccccccCCCccccccccchhhhcccccceee
Q 035742           96 SKLSYISLQSNQLSGKIPLEVGLLTHLKVLHFQFNQLKLL  135 (214)
Q Consensus        96 ~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l~~N~l~g~  135 (214)
                      ++|++|++++|+|+ .+|..++++++|+.|++++|+++..
T Consensus         1 ~~L~~L~l~~N~i~-~l~~~l~~l~~L~~L~l~~N~i~~i   39 (44)
T PF12799_consen    1 KNLEELDLSNNQIT-DLPPELSNLPNLETLNLSNNPISDI   39 (44)
T ss_dssp             TT-SEEEETSSS-S-SHGGHGTTCTTSSEEEETSSCCSBE
T ss_pred             CcceEEEccCCCCc-ccCchHhCCCCCCEEEecCCCCCCC
Confidence            47999999999999 7888899999999999999999843


No 28 
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional
Probab=98.14  E-value=3.1e-06  Score=77.50  Aligned_cols=79  Identities=22%  Similarity=0.385  Sum_probs=54.3

Q ss_pred             CCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhh
Q 035742           47 GRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLH  126 (214)
Q Consensus        47 ~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~  126 (214)
                      .+|+.|++++|.++ .+| ..+.  ++|+.|++++|+++ .+|..+.  ++|+.|++++|.|+ .+|..+.  ..|+.|+
T Consensus       325 ~sL~~L~Ls~N~Lt-~LP-~~l~--~sL~~L~Ls~N~L~-~LP~~lp--~~L~~LdLs~N~Lt-~LP~~l~--~sL~~Ld  394 (754)
T PRK15370        325 PGLKTLEAGENALT-SLP-ASLP--PELQVLDVSKNQIT-VLPETLP--PTITTLDVSRNALT-NLPENLP--AALQIMQ  394 (754)
T ss_pred             ccceeccccCCccc-cCC-hhhc--CcccEEECCCCCCC-cCChhhc--CCcCEEECCCCcCC-CCCHhHH--HHHHHHh
Confidence            35777777777776 466 4443  57788888888776 5665553  57788888888887 5666553  3577888


Q ss_pred             cccccceee
Q 035742          127 FQFNQLKLL  135 (214)
Q Consensus       127 l~~N~l~g~  135 (214)
                      +++|+|++.
T Consensus       395 Ls~N~L~~L  403 (754)
T PRK15370        395 ASRNNLVRL  403 (754)
T ss_pred             hccCCcccC
Confidence            888887744


No 29 
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional
Probab=98.07  E-value=5.2e-06  Score=76.03  Aligned_cols=13  Identities=15%  Similarity=0.340  Sum_probs=6.8

Q ss_pred             CeEEEEecCCCCc
Q 035742           48 RVINISLRNTGLS   60 (214)
Q Consensus        48 ~L~~L~L~~n~l~   60 (214)
                      +|+.|+|++|.|+
T Consensus       343 ~Lq~LdLS~N~Ls  355 (788)
T PRK15387        343 GLQELSVSDNQLA  355 (788)
T ss_pred             ccceEecCCCccC
Confidence            3455555555554


No 30 
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]
Probab=98.04  E-value=2.8e-06  Score=72.33  Aligned_cols=88  Identities=26%  Similarity=0.348  Sum_probs=68.8

Q ss_pred             CCeEEEEecCCCCccccCccccCCCC-CCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhh
Q 035742           47 GRVINISLRNTGLSGTLSDFSFSSFP-QLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVL  125 (214)
Q Consensus        47 ~~L~~L~L~~n~l~g~~p~~~~~~l~-~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L  125 (214)
                      ..++.|++.+|.++ .++ +....+. +|+.|++++|.+. .+|..+..++.|+.|++++|+++ .+|...+.++.|+.|
T Consensus       116 ~~l~~L~l~~n~i~-~i~-~~~~~~~~nL~~L~l~~N~i~-~l~~~~~~l~~L~~L~l~~N~l~-~l~~~~~~~~~L~~L  191 (394)
T COG4886         116 TNLTSLDLDNNNIT-DIP-PLIGLLKSNLKELDLSDNKIE-SLPSPLRNLPNLKNLDLSFNDLS-DLPKLLSNLSNLNNL  191 (394)
T ss_pred             cceeEEecCCcccc-cCc-cccccchhhcccccccccchh-hhhhhhhccccccccccCCchhh-hhhhhhhhhhhhhhe
Confidence            46788888888888 677 6666664 8888888888887 67677888888888888888888 777766677888888


Q ss_pred             hcccccceeecch
Q 035742          126 HFQFNQLKLLVLV  138 (214)
Q Consensus       126 ~l~~N~l~g~~p~  138 (214)
                      ++++|+++-..+.
T Consensus       192 ~ls~N~i~~l~~~  204 (394)
T COG4886         192 DLSGNKISDLPPE  204 (394)
T ss_pred             eccCCccccCchh
Confidence            8888888765554


No 31 
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional
Probab=98.04  E-value=5.5e-06  Score=75.91  Aligned_cols=35  Identities=23%  Similarity=0.329  Sum_probs=17.6

Q ss_pred             ccceeeccccccccCCCccccccccchhhhccccccee
Q 035742           97 KLSYISLQSNQLSGKIPLEVGLLTHLKVLHFQFNQLKL  134 (214)
Q Consensus        97 ~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l~~N~l~g  134 (214)
                      +|+.|++++|+++ .+|..+.  .+|+.|++++|+|++
T Consensus       263 ~L~~L~Ls~N~L~-~LP~~l~--~sL~~L~Ls~N~Lt~  297 (754)
T PRK15370        263 ALQSLDLFHNKIS-CLPENLP--EELRYLSVYDNSIRT  297 (754)
T ss_pred             CCCEEECcCCccC-ccccccC--CCCcEEECCCCcccc
Confidence            4555555555555 3444332  245555555555543


No 32 
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]
Probab=98.02  E-value=2.3e-06  Score=72.92  Aligned_cols=97  Identities=28%  Similarity=0.464  Sum_probs=80.6

Q ss_pred             CeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhhc
Q 035742           48 RVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHF  127 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l  127 (214)
                      +|+.|++++|.+. .+| ..+..++.|+.|++++|++. .+|...+.++.|+.|++++|+++ .+|..+.....|+++.+
T Consensus       141 nL~~L~l~~N~i~-~l~-~~~~~l~~L~~L~l~~N~l~-~l~~~~~~~~~L~~L~ls~N~i~-~l~~~~~~~~~L~~l~~  216 (394)
T COG4886         141 NLKELDLSDNKIE-SLP-SPLRNLPNLKNLDLSFNDLS-DLPKLLSNLSNLNNLDLSGNKIS-DLPPEIELLSALEELDL  216 (394)
T ss_pred             hcccccccccchh-hhh-hhhhccccccccccCCchhh-hhhhhhhhhhhhhheeccCCccc-cCchhhhhhhhhhhhhh
Confidence            7999999999998 776 68999999999999999998 78877779999999999999999 88887777778999999


Q ss_pred             ccccceeecchhhhhcCCCCc
Q 035742          128 QFNQLKLLVLVLEVIKGKHPR  148 (214)
Q Consensus       128 ~~N~l~g~~p~~~~l~g~~p~  148 (214)
                      ++|.+...+..+..+....+.
T Consensus       217 ~~N~~~~~~~~~~~~~~l~~l  237 (394)
T COG4886         217 SNNSIIELLSSLSNLKNLSGL  237 (394)
T ss_pred             cCCcceecchhhhhccccccc
Confidence            999655555544444433333


No 33 
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).
Probab=97.96  E-value=2.4e-06  Score=70.28  Aligned_cols=38  Identities=24%  Similarity=0.354  Sum_probs=16.3

Q ss_pred             CCCcEEeCcCCcCcCC----ChhhhhCCcccceeeccccccc
Q 035742           72 PQLVHLDLSLNGFLGT----IPSQIGNLSKLSYISLQSNQLS  109 (214)
Q Consensus        72 ~~L~~L~l~~n~l~~~----~p~~~~~l~~L~~L~ls~N~l~  109 (214)
                      ++|+.|++++|.+++.    ++..+..+++|+.|++++|.++
T Consensus       137 ~~L~~L~L~~n~l~~~~~~~~~~~~~~~~~L~~L~l~~n~l~  178 (319)
T cd00116         137 PALEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIG  178 (319)
T ss_pred             CCceEEEcCCCcCCchHHHHHHHHHHhCCCcCEEECcCCCCc
Confidence            4445555555544421    1222333344444444444444


No 34 
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]
Probab=97.95  E-value=2.9e-06  Score=68.66  Aligned_cols=90  Identities=23%  Similarity=0.235  Sum_probs=62.8

Q ss_pred             cceeeeCC-----CCCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCC
Q 035742           38 WFGISCSD-----AGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKI  112 (214)
Q Consensus        38 w~gv~c~~-----~~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~  112 (214)
                      +.-++|.+     ...++.|++++|+|. .+.  .+..+++|+.|||++|.++ .+...-..+.+.+.|.|+.|.+. .+
T Consensus       293 ~N~I~~iDESvKL~Pkir~L~lS~N~i~-~v~--nLa~L~~L~~LDLS~N~Ls-~~~Gwh~KLGNIKtL~La~N~iE-~L  367 (490)
T KOG1259|consen  293 GNLITQIDESVKLAPKLRRLILSQNRIR-TVQ--NLAELPQLQLLDLSGNLLA-ECVGWHLKLGNIKTLKLAQNKIE-TL  367 (490)
T ss_pred             ccchhhhhhhhhhccceeEEecccccee-eeh--hhhhcccceEeecccchhH-hhhhhHhhhcCEeeeehhhhhHh-hh
Confidence            34456643     347999999999998 554  5899999999999999987 44444445666667777777664 22


Q ss_pred             Cccccccccchhhhcccccce
Q 035742          113 PLEVGLLTHLKVLHFQFNQLK  133 (214)
Q Consensus       113 p~~~~~l~~L~~L~l~~N~l~  133 (214)
                       ..++++-+|..||+++|++.
T Consensus       368 -SGL~KLYSLvnLDl~~N~Ie  387 (490)
T KOG1259|consen  368 -SGLRKLYSLVNLDLSSNQIE  387 (490)
T ss_pred             -hhhHhhhhheeccccccchh
Confidence             33556666666777777664


No 35 
>PLN03210 Resistant to P. syringae 6; Provisional
Probab=97.93  E-value=1.3e-05  Score=77.10  Aligned_cols=81  Identities=19%  Similarity=0.270  Sum_probs=43.5

Q ss_pred             CeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhhc
Q 035742           48 RVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHF  127 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l  127 (214)
                      +|+.|++.+|.+. .++ ..+..+++|+.|+++++...+.+| .+..+++|+.|++++|.....+|..++++++|+.|++
T Consensus       612 ~L~~L~L~~s~l~-~L~-~~~~~l~~Lk~L~Ls~~~~l~~ip-~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L  688 (1153)
T PLN03210        612 NLVKLQMQGSKLE-KLW-DGVHSLTGLRNIDLRGSKNLKEIP-DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDM  688 (1153)
T ss_pred             CCcEEECcCcccc-ccc-cccccCCCCCEEECCCCCCcCcCC-ccccCCcccEEEecCCCCccccchhhhccCCCCEEeC
Confidence            4555666655555 444 445555566666665544333444 3555555555555555443455555555555555555


Q ss_pred             cccc
Q 035742          128 QFNQ  131 (214)
Q Consensus       128 ~~N~  131 (214)
                      ++|.
T Consensus       689 ~~c~  692 (1153)
T PLN03210        689 SRCE  692 (1153)
T ss_pred             CCCC
Confidence            5543


No 36 
>PLN03210 Resistant to P. syringae 6; Provisional
Probab=97.92  E-value=1.6e-05  Score=76.63  Aligned_cols=95  Identities=23%  Similarity=0.215  Sum_probs=72.3

Q ss_pred             cceeeeCCCCCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCcccc
Q 035742           38 WFGISCSDAGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVG  117 (214)
Q Consensus        38 w~gv~c~~~~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~  117 (214)
                      |.|+.+  ..+|+.|+|+++...+.+|  .+..+++|+.|++++|.....+|..+.++++|+.|++++|..-..+|..+ 
T Consensus       627 ~~~~~~--l~~Lk~L~Ls~~~~l~~ip--~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-  701 (1153)
T PLN03210        627 WDGVHS--LTGLRNIDLRGSKNLKEIP--DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-  701 (1153)
T ss_pred             cccccc--CCCCCEEECCCCCCcCcCC--ccccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCcC-
Confidence            555532  3579999999876555777  58889999999999987667899999999999999999875545788765 


Q ss_pred             ccccchhhhcccccceeecc
Q 035742          118 LLTHLKVLHFQFNQLKLLVL  137 (214)
Q Consensus       118 ~l~~L~~L~l~~N~l~g~~p  137 (214)
                      ++++|+.|++++|...+.+|
T Consensus       702 ~l~sL~~L~Lsgc~~L~~~p  721 (1153)
T PLN03210        702 NLKSLYRLNLSGCSRLKSFP  721 (1153)
T ss_pred             CCCCCCEEeCCCCCCccccc
Confidence            67777777777765444443


No 37 
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]
Probab=97.88  E-value=2.4e-06  Score=74.21  Aligned_cols=36  Identities=28%  Similarity=0.523  Sum_probs=20.2

Q ss_pred             cceeeccccccccCCCccccccccchhhhccccccee
Q 035742           98 LSYISLQSNQLSGKIPLEVGLLTHLKVLHFQFNQLKL  134 (214)
Q Consensus        98 L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l~~N~l~g  134 (214)
                      |..||++.|+++ .+|..|.+|+.|++|-|.+|.+..
T Consensus       213 Li~lDfScNkis-~iPv~fr~m~~Lq~l~LenNPLqS  248 (722)
T KOG0532|consen  213 LIRLDFSCNKIS-YLPVDFRKMRHLQVLQLENNPLQS  248 (722)
T ss_pred             eeeeecccCcee-ecchhhhhhhhheeeeeccCCCCC
Confidence            345555555555 555555555556655555555543


No 38 
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily. LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1).
Probab=97.86  E-value=2.8e-06  Score=69.92  Aligned_cols=88  Identities=20%  Similarity=0.239  Sum_probs=63.5

Q ss_pred             CCCeEEEEecCCCCccccCccccCCCCC---CcEEeCcCCcCcC----CChhhhhCC-cccceeeccccccccC----CC
Q 035742           46 AGRVINISLRNTGLSGTLSDFSFSSFPQ---LVHLDLSLNGFLG----TIPSQIGNL-SKLSYISLQSNQLSGK----IP  113 (214)
Q Consensus        46 ~~~L~~L~L~~n~l~g~~p~~~~~~l~~---L~~L~l~~n~l~~----~~p~~~~~l-~~L~~L~ls~N~l~g~----~p  113 (214)
                      ..+|+.|++++|.+.+..+ ..+..+..   |+.|++++|.+++    .+...+..+ ++|+.|++++|.+++.    ++
T Consensus        80 ~~~L~~L~l~~~~~~~~~~-~~~~~l~~~~~L~~L~ls~~~~~~~~~~~l~~~l~~~~~~L~~L~L~~n~l~~~~~~~~~  158 (319)
T cd00116          80 GCGLQELDLSDNALGPDGC-GVLESLLRSSSLQELKLNNNGLGDRGLRLLAKGLKDLPPALEKLVLGRNRLEGASCEALA  158 (319)
T ss_pred             cCceeEEEccCCCCChhHH-HHHHHHhccCcccEEEeeCCccchHHHHHHHHHHHhCCCCceEEEcCCCcCCchHHHHHH
Confidence            4578999999988875555 55555555   9999999988873    233445666 8889999999988743    23


Q ss_pred             ccccccccchhhhccccccee
Q 035742          114 LEVGLLTHLKVLHFQFNQLKL  134 (214)
Q Consensus       114 ~~~~~l~~L~~L~l~~N~l~g  134 (214)
                      ..+..+++|++|++++|.+++
T Consensus       159 ~~~~~~~~L~~L~l~~n~l~~  179 (319)
T cd00116         159 KALRANRDLKELNLANNGIGD  179 (319)
T ss_pred             HHHHhCCCcCEEECcCCCCch
Confidence            345566778888888888874


No 39 
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]
Probab=97.85  E-value=9.3e-07  Score=63.65  Aligned_cols=94  Identities=27%  Similarity=0.443  Sum_probs=75.2

Q ss_pred             eeCCCCCeEEEEecCCCCccccCc--cccCCCCCCcEEeCcCCcCcCCChhhhhC-CcccceeeccccccccCCCccccc
Q 035742           42 SCSDAGRVINISLRNTGLSGTLSD--FSFSSFPQLVHLDLSLNGFLGTIPSQIGN-LSKLSYISLQSNQLSGKIPLEVGL  118 (214)
Q Consensus        42 ~c~~~~~L~~L~L~~n~l~g~~p~--~~~~~l~~L~~L~l~~n~l~~~~p~~~~~-l~~L~~L~ls~N~l~g~~p~~~~~  118 (214)
                      +|.+...+..++|+++.+- .+++  -.+.....|+.++|++|.+. .+|+.|.. .+.++.+++++|.++ .+|..+..
T Consensus        22 rcedakE~h~ldLssc~lm-~i~davy~l~~~~el~~i~ls~N~fk-~fp~kft~kf~t~t~lNl~~neis-dvPeE~Aa   98 (177)
T KOG4579|consen   22 RCEDAKELHFLDLSSCQLM-YIADAVYMLSKGYELTKISLSDNGFK-KFPKKFTIKFPTATTLNLANNEIS-DVPEELAA   98 (177)
T ss_pred             hhHHHHHhhhcccccchhh-HHHHHHHHHhCCceEEEEecccchhh-hCCHHHhhccchhhhhhcchhhhh-hchHHHhh
Confidence            3655556788899998875 5551  23456677888899999998 67777765 458999999999999 99999999


Q ss_pred             cccchhhhcccccceeecch
Q 035742          119 LTHLKVLHFQFNQLKLLVLV  138 (214)
Q Consensus       119 l~~L~~L~l~~N~l~g~~p~  138 (214)
                      ++.|+.|+++.|.|.-.+-.
T Consensus        99 m~aLr~lNl~~N~l~~~p~v  118 (177)
T KOG4579|consen   99 MPALRSLNLRFNPLNAEPRV  118 (177)
T ss_pred             hHHhhhcccccCccccchHH
Confidence            99999999999999865543


No 40 
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]
Probab=97.82  E-value=9.5e-06  Score=75.55  Aligned_cols=89  Identities=30%  Similarity=0.425  Sum_probs=76.6

Q ss_pred             CCeEEEEecCCC--CccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchh
Q 035742           47 GRVINISLRNTG--LSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKV  124 (214)
Q Consensus        47 ~~L~~L~L~~n~--l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~  124 (214)
                      ..+++|-+..|.  +. .++...|..++.|+.|||++|.=-+.+|..++.+-+|++|++++..++ .+|..++++..|.+
T Consensus       545 ~~L~tLll~~n~~~l~-~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~-~LP~~l~~Lk~L~~  622 (889)
T KOG4658|consen  545 PKLRTLLLQRNSDWLL-EISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGIS-HLPSGLGNLKKLIY  622 (889)
T ss_pred             CccceEEEeecchhhh-hcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCcc-ccchHHHHHHhhhe
Confidence            368999999996  55 555356888999999999998777799999999999999999999999 99999999999999


Q ss_pred             hhcccccceeecc
Q 035742          125 LHFQFNQLKLLVL  137 (214)
Q Consensus       125 L~l~~N~l~g~~p  137 (214)
                      |++..+.....+|
T Consensus       623 Lnl~~~~~l~~~~  635 (889)
T KOG4658|consen  623 LNLEVTGRLESIP  635 (889)
T ss_pred             ecccccccccccc
Confidence            9999876544443


No 41 
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]
Probab=97.51  E-value=4.7e-05  Score=71.04  Aligned_cols=85  Identities=28%  Similarity=0.325  Sum_probs=74.0

Q ss_pred             CCCCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchh
Q 035742           45 DAGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKV  124 (214)
Q Consensus        45 ~~~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~  124 (214)
                      ....|+.|||++|.=-+.+| ..++.|-+|++|++++..+. .+|..++++..|.+|++.++.....+|..+..+++|++
T Consensus       569 ~m~~LrVLDLs~~~~l~~LP-~~I~~Li~LryL~L~~t~I~-~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~  646 (889)
T KOG4658|consen  569 SLPLLRVLDLSGNSSLSKLP-SSIGELVHLRYLDLSDTGIS-HLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRV  646 (889)
T ss_pred             hCcceEEEECCCCCccCcCC-hHHhhhhhhhcccccCCCcc-ccchHHHHHHhhheeccccccccccccchhhhcccccE
Confidence            35689999999987767899 99999999999999999998 99999999999999999988766566666677999999


Q ss_pred             hhccccc
Q 035742          125 LHFQFNQ  131 (214)
Q Consensus       125 L~l~~N~  131 (214)
                      |.+..-.
T Consensus       647 L~l~~s~  653 (889)
T KOG4658|consen  647 LRLPRSA  653 (889)
T ss_pred             EEeeccc
Confidence            8886544


No 42 
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]
Probab=97.46  E-value=7.1e-05  Score=64.38  Aligned_cols=85  Identities=24%  Similarity=0.295  Sum_probs=57.8

Q ss_pred             CCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhh
Q 035742           47 GRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLH  126 (214)
Q Consensus        47 ~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~  126 (214)
                      .+++.|++..|.|. .+. ..+..+++|++|++++|.|+...  .+..++.|+.|++++|.++ .+.. +..+..|+.++
T Consensus        95 ~~l~~l~l~~n~i~-~i~-~~l~~~~~L~~L~ls~N~I~~i~--~l~~l~~L~~L~l~~N~i~-~~~~-~~~l~~L~~l~  168 (414)
T KOG0531|consen   95 KSLEALDLYDNKIE-KIE-NLLSSLVNLQVLDLSFNKITKLE--GLSTLTLLKELNLSGNLIS-DISG-LESLKSLKLLD  168 (414)
T ss_pred             cceeeeeccccchh-hcc-cchhhhhcchheecccccccccc--chhhccchhhheeccCcch-hccC-Cccchhhhccc
Confidence            46777888888887 444 23677888888888888886332  3555666778888888776 4332 45567777777


Q ss_pred             cccccceeecc
Q 035742          127 FQFNQLKLLVL  137 (214)
Q Consensus       127 l~~N~l~g~~p  137 (214)
                      +++|++...-+
T Consensus       169 l~~n~i~~ie~  179 (414)
T KOG0531|consen  169 LSYNRIVDIEN  179 (414)
T ss_pred             CCcchhhhhhh
Confidence            77777765444


No 43 
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]
Probab=97.30  E-value=2.6e-05  Score=69.83  Aligned_cols=80  Identities=24%  Similarity=0.399  Sum_probs=45.7

Q ss_pred             CCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhh-hhCCcccceeeccccccccCCCccccccccchhh
Q 035742           47 GRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQ-IGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVL  125 (214)
Q Consensus        47 ~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~-~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L  125 (214)
                      ..++.|+|++|+++ ..  ..+..++.|++|||++|.+. .+|.- ...+. |+.|.+.+|.++ .+ ..+.++.+|+.|
T Consensus       187 ~ale~LnLshNk~~-~v--~~Lr~l~~LkhLDlsyN~L~-~vp~l~~~gc~-L~~L~lrnN~l~-tL-~gie~LksL~~L  259 (1096)
T KOG1859|consen  187 PALESLNLSHNKFT-KV--DNLRRLPKLKHLDLSYNCLR-HVPQLSMVGCK-LQLLNLRNNALT-TL-RGIENLKSLYGL  259 (1096)
T ss_pred             HHhhhhccchhhhh-hh--HHHHhcccccccccccchhc-cccccchhhhh-heeeeecccHHH-hh-hhHHhhhhhhcc
Confidence            36778888888887 33  46778888888888888886 44431 22222 444444444443 11 223444445555


Q ss_pred             hcccccce
Q 035742          126 HFQFNQLK  133 (214)
Q Consensus       126 ~l~~N~l~  133 (214)
                      |++.|-++
T Consensus       260 DlsyNll~  267 (1096)
T KOG1859|consen  260 DLSYNLLS  267 (1096)
T ss_pred             chhHhhhh
Confidence            55555443


No 44 
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]
Probab=97.21  E-value=0.00032  Score=53.85  Aligned_cols=82  Identities=21%  Similarity=0.216  Sum_probs=65.5

Q ss_pred             CeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCC--ccccccccchhh
Q 035742           48 RVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIP--LEVGLLTHLKVL  125 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p--~~~~~l~~L~~L  125 (214)
                      ....+||++|.+. .+  +.|..++.|..|.+.+|+|+..-|.--..+++|..|.+.+|.|. .+-  .-+..++.|++|
T Consensus        43 ~~d~iDLtdNdl~-~l--~~lp~l~rL~tLll~nNrIt~I~p~L~~~~p~l~~L~LtnNsi~-~l~dl~pLa~~p~L~~L  118 (233)
T KOG1644|consen   43 QFDAIDLTDNDLR-KL--DNLPHLPRLHTLLLNNNRITRIDPDLDTFLPNLKTLILTNNSIQ-ELGDLDPLASCPKLEYL  118 (233)
T ss_pred             ccceecccccchh-hc--ccCCCccccceEEecCCcceeeccchhhhccccceEEecCcchh-hhhhcchhccCCcccee
Confidence            4678999999987 54  47899999999999999999555544456788999999999987 332  235677889999


Q ss_pred             hcccccce
Q 035742          126 HFQFNQLK  133 (214)
Q Consensus       126 ~l~~N~l~  133 (214)
                      .+-+|..+
T Consensus       119 tll~Npv~  126 (233)
T KOG1644|consen  119 TLLGNPVE  126 (233)
T ss_pred             eecCCchh
Confidence            99999775


No 45 
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]
Probab=97.15  E-value=2.7e-05  Score=69.78  Aligned_cols=83  Identities=27%  Similarity=0.349  Sum_probs=66.6

Q ss_pred             CeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhhc
Q 035742           48 RVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHF  127 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l  127 (214)
                      .|...+.++|.+. .+. .++.-++.|+.|+|++|+++. .. .+..++.|++|||++|.+. .+|..-..-..|+.|.+
T Consensus       165 ~L~~a~fsyN~L~-~mD-~SLqll~ale~LnLshNk~~~-v~-~Lr~l~~LkhLDlsyN~L~-~vp~l~~~gc~L~~L~l  239 (1096)
T KOG1859|consen  165 KLATASFSYNRLV-LMD-ESLQLLPALESLNLSHNKFTK-VD-NLRRLPKLKHLDLSYNCLR-HVPQLSMVGCKLQLLNL  239 (1096)
T ss_pred             hHhhhhcchhhHH-hHH-HHHHHHHHhhhhccchhhhhh-hH-HHHhcccccccccccchhc-cccccchhhhhheeeee
Confidence            4677788889887 666 888899999999999999973 33 7889999999999999998 77763222234999999


Q ss_pred             ccccceee
Q 035742          128 QFNQLKLL  135 (214)
Q Consensus       128 ~~N~l~g~  135 (214)
                      .+|.++..
T Consensus       240 rnN~l~tL  247 (1096)
T KOG1859|consen  240 RNNALTTL  247 (1096)
T ss_pred             cccHHHhh
Confidence            99988753


No 46 
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]
Probab=96.98  E-value=0.00044  Score=54.85  Aligned_cols=83  Identities=25%  Similarity=0.309  Sum_probs=65.1

Q ss_pred             CCeEEEEecCCCCccccCccccCCCCCCcEEeCcCC--cCcCCChhhhhCCcccceeeccccccccCCCcc---cccccc
Q 035742           47 GRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLN--GFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLE---VGLLTH  121 (214)
Q Consensus        47 ~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n--~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~---~~~l~~  121 (214)
                      ..+..+.+.+..++ ++  ..|..+++|+.|.++.|  ++.+.++.-...+++|++++++.|++.-  +.+   +..+.+
T Consensus        43 ~~le~ls~~n~glt-t~--~~~P~Lp~LkkL~lsdn~~~~~~~l~vl~e~~P~l~~l~ls~Nki~~--lstl~pl~~l~n  117 (260)
T KOG2739|consen   43 VELELLSVINVGLT-TL--TNFPKLPKLKKLELSDNYRRVSGGLEVLAEKAPNLKVLNLSGNKIKD--LSTLRPLKELEN  117 (260)
T ss_pred             cchhhhhhhcccee-ec--ccCCCcchhhhhcccCCcccccccceehhhhCCceeEEeecCCcccc--ccccchhhhhcc
Confidence            46777777777777 33  46888999999999999  7777777777778999999999999972  333   456677


Q ss_pred             chhhhccccccee
Q 035742          122 LKVLHFQFNQLKL  134 (214)
Q Consensus       122 L~~L~l~~N~l~g  134 (214)
                      |..|++..+..+.
T Consensus       118 L~~Ldl~n~~~~~  130 (260)
T KOG2739|consen  118 LKSLDLFNCSVTN  130 (260)
T ss_pred             hhhhhcccCCccc
Confidence            8899998886654


No 47 
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]
Probab=96.95  E-value=0.00025  Score=61.02  Aligned_cols=82  Identities=23%  Similarity=0.248  Sum_probs=65.9

Q ss_pred             CeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhhc
Q 035742           48 RVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHF  127 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l  127 (214)
                      .+..+.+..|.++ .+- ..+..+.+|+.|++..|.|. .+...+..+++|++|++++|.|+...+  +..++.|+.|++
T Consensus        73 ~l~~l~l~~n~i~-~~~-~~l~~~~~l~~l~l~~n~i~-~i~~~l~~~~~L~~L~ls~N~I~~i~~--l~~l~~L~~L~l  147 (414)
T KOG0531|consen   73 SLKELNLRQNLIA-KIL-NHLSKLKSLEALDLYDNKIE-KIENLLSSLVNLQVLDLSFNKITKLEG--LSTLTLLKELNL  147 (414)
T ss_pred             hHHhhccchhhhh-hhh-cccccccceeeeeccccchh-hcccchhhhhcchheeccccccccccc--hhhccchhhhee
Confidence            4556668888887 333 56889999999999999998 444447889999999999999984433  667788999999


Q ss_pred             cccccee
Q 035742          128 QFNQLKL  134 (214)
Q Consensus       128 ~~N~l~g  134 (214)
                      ++|.++.
T Consensus       148 ~~N~i~~  154 (414)
T KOG0531|consen  148 SGNLISD  154 (414)
T ss_pred             ccCcchh
Confidence            9999874


No 48 
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]
Probab=96.92  E-value=0.00025  Score=60.07  Aligned_cols=88  Identities=19%  Similarity=0.149  Sum_probs=47.3

Q ss_pred             CCCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCCh-hhhhCCcccceeeccccccccCCCccccccccchh
Q 035742           46 AGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIP-SQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKV  124 (214)
Q Consensus        46 ~~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p-~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~  124 (214)
                      ..+|+.|+|+.|.+.-......-..+++|+.|.++.+.++..-- .....+++|+.|+|..|...+..-.....+..|+.
T Consensus       171 Lp~Le~LNls~Nrl~~~~~s~~~~~l~~lK~L~l~~CGls~k~V~~~~~~fPsl~~L~L~~N~~~~~~~~~~~i~~~L~~  250 (505)
T KOG3207|consen  171 LPSLENLNLSSNRLSNFISSNTTLLLSHLKQLVLNSCGLSWKDVQWILLTFPSLEVLYLEANEIILIKATSTKILQTLQE  250 (505)
T ss_pred             cccchhcccccccccCCccccchhhhhhhheEEeccCCCCHHHHHHHHHhCCcHHHhhhhcccccceecchhhhhhHHhh
Confidence            34555666666655422221112234555666666665552211 12334567777777777533333334455677888


Q ss_pred             hhcccccce
Q 035742          125 LHFQFNQLK  133 (214)
Q Consensus       125 L~l~~N~l~  133 (214)
                      |+|++|++-
T Consensus       251 LdLs~N~li  259 (505)
T KOG3207|consen  251 LDLSNNNLI  259 (505)
T ss_pred             ccccCCccc
Confidence            888888764


No 49 
>KOG0473 consensus Leucine-rich repeat protein [Function unknown]
Probab=96.80  E-value=4.2e-05  Score=59.90  Aligned_cols=84  Identities=24%  Similarity=0.214  Sum_probs=76.5

Q ss_pred             CCCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhh
Q 035742           46 AGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVL  125 (214)
Q Consensus        46 ~~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L  125 (214)
                      ..+++.||++.|.+. .+. ..|+.++.|..|+++.|++. .+|..++.+..+..+++..|.++ ..|.+++.+++++++
T Consensus        41 ~kr~tvld~~s~r~v-n~~-~n~s~~t~~~rl~~sknq~~-~~~~d~~q~~e~~~~~~~~n~~~-~~p~s~~k~~~~k~~  116 (326)
T KOG0473|consen   41 FKRVTVLDLSSNRLV-NLG-KNFSILTRLVRLDLSKNQIK-FLPKDAKQQRETVNAASHKNNHS-QQPKSQKKEPHPKKN  116 (326)
T ss_pred             cceeeeehhhhhHHH-hhc-cchHHHHHHHHHhccHhhHh-hChhhHHHHHHHHHHHhhccchh-hCCccccccCCcchh
Confidence            457899999999987 666 78999999999999999998 89999999999999999999998 999999999999999


Q ss_pred             hcccccce
Q 035742          126 HFQFNQLK  133 (214)
Q Consensus       126 ~l~~N~l~  133 (214)
                      ++-.|.|.
T Consensus       117 e~k~~~~~  124 (326)
T KOG0473|consen  117 EQKKTEFF  124 (326)
T ss_pred             hhccCcch
Confidence            99998864


No 50 
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=96.57  E-value=0.0034  Score=53.12  Aligned_cols=75  Identities=29%  Similarity=0.509  Sum_probs=51.8

Q ss_pred             hhhhhcCCCCchhhh--------hhcccccchhhhhhhhcCCCCCCCcchhHHHHHHHHHHhhcccCCCCCCCCCHHHHH
Q 035742          138 VLEVIKGKHPRDFLC--------SILSSSLTKDVALDEMLDPRLPTSSCSVQEKLISIMGVAFPCLNESPVSRPTMQTVS  209 (214)
Q Consensus       138 ~~~~l~g~~p~~~~~--------~~~~~~~~~~~~~~~~l~~~lp~~~~~~~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~  209 (214)
                      .++.++|..+.+...        .|. ........+.+++|+++..........+.++..+|+.|++.++..||+|.+|+
T Consensus       268 llElitgr~~~d~~~~~~~~~l~~w~-~~~~~~~~~~eiiD~~l~~~~~~~~~~~~~~~~~a~~C~~~~~~~RP~m~~Vv  346 (361)
T KOG1187|consen  268 LLELITGRKAVDQSRPRGELSLVEWA-KPLLEEGKLREIVDPRLKEGEYPDEKEVKKLAELALRCLRPDPKERPTMSQVV  346 (361)
T ss_pred             HHHHHhCCcccCCCCCcccccHHHHH-HHHHHCcchhheeCCCccCCCCChHHHHHHHHHHHHHHcCcCCCcCcCHHHHH
Confidence            367888887666421        111 11122225678889888742222126778899999999999999999999999


Q ss_pred             HHhc
Q 035742          210 QQLQ  213 (214)
Q Consensus       210 ~~L~  213 (214)
                      ++|+
T Consensus       347 ~~L~  350 (361)
T KOG1187|consen  347 KELE  350 (361)
T ss_pred             HHHH
Confidence            9985


No 51 
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]
Probab=96.48  E-value=0.00064  Score=57.71  Aligned_cols=84  Identities=20%  Similarity=0.248  Sum_probs=43.3

Q ss_pred             CeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCCh--hhhhCCcccceeeccccccccC-CCcc-----cccc
Q 035742           48 RVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIP--SQIGNLSKLSYISLQSNQLSGK-IPLE-----VGLL  119 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p--~~~~~l~~L~~L~ls~N~l~g~-~p~~-----~~~l  119 (214)
                      ++..|+|.+|...+... .....+..|+.|||++|++- ..+  ...+.++.|+.|+++.+.+... +|+.     ...+
T Consensus       223 sl~~L~L~~N~~~~~~~-~~~~i~~~L~~LdLs~N~li-~~~~~~~~~~l~~L~~Lnls~tgi~si~~~d~~s~~kt~~f  300 (505)
T KOG3207|consen  223 SLEVLYLEANEIILIKA-TSTKILQTLQELDLSNNNLI-DFDQGYKVGTLPGLNQLNLSSTGIASIAEPDVESLDKTHTF  300 (505)
T ss_pred             cHHHhhhhcccccceec-chhhhhhHHhhccccCCccc-ccccccccccccchhhhhccccCcchhcCCCccchhhhccc
Confidence            35555555553221222 33444556666666666654 233  3455566666666666665422 2322     2344


Q ss_pred             ccchhhhcccccce
Q 035742          120 THLKVLHFQFNQLK  133 (214)
Q Consensus       120 ~~L~~L~l~~N~l~  133 (214)
                      .+|++|++..|++.
T Consensus       301 ~kL~~L~i~~N~I~  314 (505)
T KOG3207|consen  301 PKLEYLNISENNIR  314 (505)
T ss_pred             ccceeeecccCccc
Confidence            56667777766663


No 52 
>KOG2982 consensus Uncharacterized conserved protein [Function unknown]
Probab=96.36  E-value=0.00096  Score=54.28  Aligned_cols=84  Identities=25%  Similarity=0.255  Sum_probs=50.6

Q ss_pred             CeEEEEecCCCCccc--cCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccC-CCccccccccchh
Q 035742           48 RVINISLRNTGLSGT--LSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGK-IPLEVGLLTHLKV  124 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~--~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~-~p~~~~~l~~L~~  124 (214)
                      +++.+||.+|.|+..  +. .-+..++.|+.|+++.|++...+-.....+.+|+.|-|.+..+.+. ....+..++.++.
T Consensus        72 ~v~elDL~~N~iSdWseI~-~ile~lP~l~~LNls~N~L~s~I~~lp~p~~nl~~lVLNgT~L~w~~~~s~l~~lP~vte  150 (418)
T KOG2982|consen   72 DVKELDLTGNLISDWSEIG-AILEQLPALTTLNLSCNSLSSDIKSLPLPLKNLRVLVLNGTGLSWTQSTSSLDDLPKVTE  150 (418)
T ss_pred             hhhhhhcccchhccHHHHH-HHHhcCccceEeeccCCcCCCccccCcccccceEEEEEcCCCCChhhhhhhhhcchhhhh
Confidence            567777777777621  22 3345677778888887777633322223455677777766666543 2334456666777


Q ss_pred             hhcccccc
Q 035742          125 LHFQFNQL  132 (214)
Q Consensus       125 L~l~~N~l  132 (214)
                      |+++.|++
T Consensus       151 lHmS~N~~  158 (418)
T KOG2982|consen  151 LHMSDNSL  158 (418)
T ss_pred             hhhccchh
Confidence            77777743


No 53 
>PF00560 LRR_1:  Leucine Rich Repeat;  InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []. LRRs occur in proteins ranging from viruses to eukaryotes, and appear to provide a structural framework for the formation of protein-protein interactions [, ].Proteins containing LRRs include tyrosine kinase receptors, cell-adhesion molecules, virulence factors, and extracellular matrix-binding glycoproteins, and are involved in a variety of biological processes, including signal transduction, cell adhesion, DNA repair, recombination, transcription, RNA processing, disease resistance, apoptosis, and the immune response []. Sequence analyses of LRR proteins suggested the existence of several different subfamilies of LRRs. The significance of this classification is that repeats from different subfamilies never occur simultaneously and have most probably evolved independently. It is, however, now clear that all major classes of LRR have curved horseshoe structures with a parallel beta sheet on the concave side and mostly helical elements on the convex side. At least six families of LRR proteins, characterised by different lengths and consensus sequences of the repeats, have been identified. Eleven-residue segments of the LRRs (LxxLxLxxN/CxL), corresponding to the beta-strand and adjacent loop regions, are conserved in LRR proteins, whereas the remaining parts of the repeats (herein termed variable) may be very different. Despite the differences, each of the variable parts contains two half-turns at both ends and a "linear" segment (as the chain follows a linear path overall), usually formed by a helix, in the middle. The concave face and the adjacent loops are the most common protein interaction surfaces on LRR proteins. 3D structure of some LRR proteins-ligand complexes show that the concave surface of LRR domain is ideal for interaction with alpha-helix, thus supporting earlier conclusions that the elongated and curved LRR structure provides an outstanding framework for achieving diverse protein-protein interactions []. Molecular modeling suggests that the conserved pattern LxxLxL, which is shorter than the previously proposed LxxLxLxxN/CxL is sufficient to impart the characteristic horseshoe curvature to proteins with 20- to 30-residue repeats []. ; GO: 0005515 protein binding; PDB: 4ECO_B 2A0Z_A 3ULU_A 1ZIW_A 3ULV_A 1DCE_C 1LTX_A 3J0A_B 3A79_B 4FCG_A ....
Probab=96.27  E-value=0.0014  Score=31.73  Aligned_cols=18  Identities=39%  Similarity=0.737  Sum_probs=8.5

Q ss_pred             cceeeccccccccCCCccc
Q 035742           98 LSYISLQSNQLSGKIPLEV  116 (214)
Q Consensus        98 L~~L~ls~N~l~g~~p~~~  116 (214)
                      |++|++++|+|+ .+|..|
T Consensus         2 L~~Ldls~n~l~-~ip~~~   19 (22)
T PF00560_consen    2 LEYLDLSGNNLT-SIPSSF   19 (22)
T ss_dssp             ESEEEETSSEES-EEGTTT
T ss_pred             ccEEECCCCcCE-eCChhh
Confidence            444455555444 444443


No 54 
>KOG2123 consensus Uncharacterized conserved protein [Function unknown]
Probab=96.17  E-value=0.00036  Score=56.16  Aligned_cols=86  Identities=23%  Similarity=0.289  Sum_probs=38.5

Q ss_pred             eCCCCCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCC--ccccccc
Q 035742           43 CSDAGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIP--LEVGLLT  120 (214)
Q Consensus        43 c~~~~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p--~~~~~l~  120 (214)
                      |++..++..|+.-+++|. .|.  -...++.|+.|.|+-|.|+..  ..+..|++|++|+|..|.|. .+-  ..+.+++
T Consensus        15 ~sdl~~vkKLNcwg~~L~-DIs--ic~kMp~lEVLsLSvNkIssL--~pl~rCtrLkElYLRkN~I~-sldEL~YLknlp   88 (388)
T KOG2123|consen   15 CSDLENVKKLNCWGCGLD-DIS--ICEKMPLLEVLSLSVNKISSL--APLQRCTRLKELYLRKNCIE-SLDELEYLKNLP   88 (388)
T ss_pred             hhHHHHhhhhcccCCCcc-HHH--HHHhcccceeEEeeccccccc--hhHHHHHHHHHHHHHhcccc-cHHHHHHHhcCc
Confidence            333334445555555444 221  234455555555555555421  12444555555555555544 222  1234445


Q ss_pred             cchhhhccccccee
Q 035742          121 HLKVLHFQFNQLKL  134 (214)
Q Consensus       121 ~L~~L~l~~N~l~g  134 (214)
                      +|+.|.|..|.-.|
T Consensus        89 sLr~LWL~ENPCc~  102 (388)
T KOG2123|consen   89 SLRTLWLDENPCCG  102 (388)
T ss_pred             hhhhHhhccCCccc
Confidence            55555555554433


No 55 
>PF00560 LRR_1:  Leucine Rich Repeat;  InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []. LRRs occur in proteins ranging from viruses to eukaryotes, and appear to provide a structural framework for the formation of protein-protein interactions [, ].Proteins containing LRRs include tyrosine kinase receptors, cell-adhesion molecules, virulence factors, and extracellular matrix-binding glycoproteins, and are involved in a variety of biological processes, including signal transduction, cell adhesion, DNA repair, recombination, transcription, RNA processing, disease resistance, apoptosis, and the immune response []. Sequence analyses of LRR proteins suggested the existence of several different subfamilies of LRRs. The significance of this classification is that repeats from different subfamilies never occur simultaneously and have most probably evolved independently. It is, however, now clear that all major classes of LRR have curved horseshoe structures with a parallel beta sheet on the concave side and mostly helical elements on the convex side. At least six families of LRR proteins, characterised by different lengths and consensus sequences of the repeats, have been identified. Eleven-residue segments of the LRRs (LxxLxLxxN/CxL), corresponding to the beta-strand and adjacent loop regions, are conserved in LRR proteins, whereas the remaining parts of the repeats (herein termed variable) may be very different. Despite the differences, each of the variable parts contains two half-turns at both ends and a "linear" segment (as the chain follows a linear path overall), usually formed by a helix, in the middle. The concave face and the adjacent loops are the most common protein interaction surfaces on LRR proteins. 3D structure of some LRR proteins-ligand complexes show that the concave surface of LRR domain is ideal for interaction with alpha-helix, thus supporting earlier conclusions that the elongated and curved LRR structure provides an outstanding framework for achieving diverse protein-protein interactions []. Molecular modeling suggests that the conserved pattern LxxLxL, which is shorter than the previously proposed LxxLxLxxN/CxL is sufficient to impart the characteristic horseshoe curvature to proteins with 20- to 30-residue repeats []. ; GO: 0005515 protein binding; PDB: 4ECO_B 2A0Z_A 3ULU_A 1ZIW_A 3ULV_A 1DCE_C 1LTX_A 3J0A_B 3A79_B 4FCG_A ....
Probab=96.10  E-value=0.002  Score=31.22  Aligned_cols=18  Identities=50%  Similarity=0.589  Sum_probs=8.3

Q ss_pred             CcEEeCcCCcCcCCChhhh
Q 035742           74 LVHLDLSLNGFLGTIPSQI   92 (214)
Q Consensus        74 L~~L~l~~n~l~~~~p~~~   92 (214)
                      |++|++++|+++ .+|+.|
T Consensus         2 L~~Ldls~n~l~-~ip~~~   19 (22)
T PF00560_consen    2 LEYLDLSGNNLT-SIPSSF   19 (22)
T ss_dssp             ESEEEETSSEES-EEGTTT
T ss_pred             ccEEECCCCcCE-eCChhh
Confidence            444445544444 444443


No 56 
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]
Probab=96.02  E-value=0.0045  Score=47.67  Aligned_cols=79  Identities=20%  Similarity=0.305  Sum_probs=56.9

Q ss_pred             EEEEecCCCCccccCccccC-CCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhhcc
Q 035742           50 INISLRNTGLSGTLSDFSFS-SFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHFQ  128 (214)
Q Consensus        50 ~~L~L~~n~l~g~~p~~~~~-~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l~  128 (214)
                      ++++|.+..+. .+.  .++ -+.....+||++|.+.  .-..|..+++|.+|.+++|+|+.+-|.--..+++|..|.+.
T Consensus        22 ~e~~LR~lkip-~ie--nlg~~~d~~d~iDLtdNdl~--~l~~lp~l~rL~tLll~nNrIt~I~p~L~~~~p~l~~L~Lt   96 (233)
T KOG1644|consen   22 RELDLRGLKIP-VIE--NLGATLDQFDAIDLTDNDLR--KLDNLPHLPRLHTLLLNNNRITRIDPDLDTFLPNLKTLILT   96 (233)
T ss_pred             ccccccccccc-chh--hccccccccceecccccchh--hcccCCCccccceEEecCCcceeeccchhhhccccceEEec
Confidence            56677766554 222  222 2346788999999985  33467789999999999999995555433445679999999


Q ss_pred             cccce
Q 035742          129 FNQLK  133 (214)
Q Consensus       129 ~N~l~  133 (214)
                      +|++.
T Consensus        97 nNsi~  101 (233)
T KOG1644|consen   97 NNSIQ  101 (233)
T ss_pred             Ccchh
Confidence            99876


No 57 
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]
Probab=95.68  E-value=0.006  Score=55.85  Aligned_cols=91  Identities=16%  Similarity=0.160  Sum_probs=54.2

Q ss_pred             eeeeCCCCCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcC-CChhhhhCCcccceeeccccccccCCC-----
Q 035742           40 GISCSDAGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLG-TIPSQIGNLSKLSYISLQSNQLSGKIP-----  113 (214)
Q Consensus        40 gv~c~~~~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~-~~p~~~~~l~~L~~L~ls~N~l~g~~p-----  113 (214)
                      ..-|....+|.+||+++.+++ .+  ..++.+.+|+.|.+.+=.+.. ..-..+.+|++|+.||+|..... ..+     
T Consensus       166 ~~lc~sFpNL~sLDIS~TnI~-nl--~GIS~LknLq~L~mrnLe~e~~~~l~~LF~L~~L~vLDIS~~~~~-~~~~ii~q  241 (699)
T KOG3665|consen  166 SQLCASFPNLRSLDISGTNIS-NL--SGISRLKNLQVLSMRNLEFESYQDLIDLFNLKKLRVLDISRDKNN-DDTKIIEQ  241 (699)
T ss_pred             HHHhhccCccceeecCCCCcc-Cc--HHHhccccHHHHhccCCCCCchhhHHHHhcccCCCeeeccccccc-cchHHHHH
Confidence            344555566777777777766 33  356666677666666555431 22235667777777777776654 222     


Q ss_pred             --ccccccccchhhhccccccee
Q 035742          114 --LEVGLLTHLKVLHFQFNQLKL  134 (214)
Q Consensus       114 --~~~~~l~~L~~L~l~~N~l~g  134 (214)
                        +.-..+++|++||.|++.+.+
T Consensus       242 Ylec~~~LpeLrfLDcSgTdi~~  264 (699)
T KOG3665|consen  242 YLECGMVLPELRFLDCSGTDINE  264 (699)
T ss_pred             HHHhcccCccccEEecCCcchhH
Confidence              122346777777777766554


No 58 
>KOG2123 consensus Uncharacterized conserved protein [Function unknown]
Probab=95.31  E-value=0.0019  Score=52.15  Aligned_cols=81  Identities=23%  Similarity=0.286  Sum_probs=62.9

Q ss_pred             eeCCCCCeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChh--hhhCCcccceeeccccccccCCCcc----
Q 035742           42 SCSDAGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPS--QIGNLSKLSYISLQSNQLSGKIPLE----  115 (214)
Q Consensus        42 ~c~~~~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~--~~~~l~~L~~L~ls~N~l~g~~p~~----  115 (214)
                      .|..-..|+.|.|+-|.|+ .+  ..|..+++|+.|+|..|.|. .+.+  -+.++++|+.|+|..|.-.|.-+..    
T Consensus        36 ic~kMp~lEVLsLSvNkIs-sL--~pl~rCtrLkElYLRkN~I~-sldEL~YLknlpsLr~LWL~ENPCc~~ag~nYR~~  111 (388)
T KOG2123|consen   36 ICEKMPLLEVLSLSVNKIS-SL--APLQRCTRLKELYLRKNCIE-SLDELEYLKNLPSLRTLWLDENPCCGEAGQNYRRK  111 (388)
T ss_pred             HHHhcccceeEEeeccccc-cc--hhHHHHHHHHHHHHHhcccc-cHHHHHHHhcCchhhhHhhccCCcccccchhHHHH
Confidence            3555567999999999999 44  35899999999999999997 3433  3678999999999999988776653    


Q ss_pred             -ccccccchhhh
Q 035742          116 -VGLLTHLKVLH  126 (214)
Q Consensus       116 -~~~l~~L~~L~  126 (214)
                       +.-|++|+.||
T Consensus       112 VLR~LPnLkKLD  123 (388)
T KOG2123|consen  112 VLRVLPNLKKLD  123 (388)
T ss_pred             HHHHcccchhcc
Confidence             34456666664


No 59 
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]
Probab=94.95  E-value=0.0082  Score=49.75  Aligned_cols=37  Identities=19%  Similarity=0.284  Sum_probs=16.4

Q ss_pred             cccceeecccccccc----CCCccccccccchhhhcccccc
Q 035742           96 SKLSYISLQSNQLSG----KIPLEVGLLTHLKVLHFQFNQL  132 (214)
Q Consensus        96 ~~L~~L~ls~N~l~g----~~p~~~~~l~~L~~L~l~~N~l  132 (214)
                      ++|+.+.+.+|.++-    .+-..+...+.|..|+|++|.+
T Consensus       270 p~L~vl~l~gNeIt~da~~~la~~~~ek~dL~kLnLngN~l  310 (382)
T KOG1909|consen  270 PSLEVLELAGNEITRDAALALAACMAEKPDLEKLNLNGNRL  310 (382)
T ss_pred             CCCceeccCcchhHHHHHHHHHHHHhcchhhHHhcCCcccc
Confidence            445555555554431    0112233344555555555555


No 60 
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]
Probab=94.90  E-value=0.012  Score=46.81  Aligned_cols=66  Identities=27%  Similarity=0.342  Sum_probs=50.2

Q ss_pred             cccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeecccc--ccccCCCccccccccchhhhcccccce
Q 035742           66 FSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSN--QLSGKIPLEVGLLTHLKVLHFQFNQLK  133 (214)
Q Consensus        66 ~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N--~l~g~~p~~~~~l~~L~~L~l~~N~l~  133 (214)
                      .-...+..|+.|.+.+..++ .+ ..+..+++|+.|.++.|  .+.+.++.....+++|+++++++|++.
T Consensus        37 gl~d~~~~le~ls~~n~glt-t~-~~~P~Lp~LkkL~lsdn~~~~~~~l~vl~e~~P~l~~l~ls~Nki~  104 (260)
T KOG2739|consen   37 GLTDEFVELELLSVINVGLT-TL-TNFPKLPKLKKLELSDNYRRVSGGLEVLAEKAPNLKVLNLSGNKIK  104 (260)
T ss_pred             cccccccchhhhhhhcccee-ec-ccCCCcchhhhhcccCCcccccccceehhhhCCceeEEeecCCccc
Confidence            44555667777777777665 11 24567889999999999  666667666677799999999999987


No 61 
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]
Probab=94.90  E-value=0.0094  Score=54.61  Aligned_cols=85  Identities=20%  Similarity=0.275  Sum_probs=59.9

Q ss_pred             CCCeEEEEecCCCCccc-cCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeecccccccc-CCCccccccccch
Q 035742           46 AGRVINISLRNTGLSGT-LSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSG-KIPLEVGLLTHLK  123 (214)
Q Consensus        46 ~~~L~~L~L~~n~l~g~-~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g-~~p~~~~~l~~L~  123 (214)
                      ..+|++|.+.+-.+... +. .-..++++|..||+|+.+++..  ..++++++|+.|.+.+=.|.. ..-..+.+|++|+
T Consensus       147 LPsL~sL~i~~~~~~~~dF~-~lc~sFpNL~sLDIS~TnI~nl--~GIS~LknLq~L~mrnLe~e~~~~l~~LF~L~~L~  223 (699)
T KOG3665|consen  147 LPSLRSLVISGRQFDNDDFS-QLCASFPNLRSLDISGTNISNL--SGISRLKNLQVLSMRNLEFESYQDLIDLFNLKKLR  223 (699)
T ss_pred             CcccceEEecCceecchhHH-HHhhccCccceeecCCCCccCc--HHHhccccHHHHhccCCCCCchhhHHHHhcccCCC
Confidence            34688888887766432 12 3456788999999999888733  678888888888877666652 1123467788999


Q ss_pred             hhhcccccce
Q 035742          124 VLHFQFNQLK  133 (214)
Q Consensus       124 ~L~l~~N~l~  133 (214)
                      .||+|.....
T Consensus       224 vLDIS~~~~~  233 (699)
T KOG3665|consen  224 VLDISRDKNN  233 (699)
T ss_pred             eeeccccccc
Confidence            9999876554


No 62 
>PF13504 LRR_7:  Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D ....
Probab=94.18  E-value=0.024  Score=25.53  Aligned_cols=11  Identities=36%  Similarity=0.594  Sum_probs=3.3

Q ss_pred             cceeecccccc
Q 035742           98 LSYISLQSNQL  108 (214)
Q Consensus        98 L~~L~ls~N~l  108 (214)
                      |+.|++++|+|
T Consensus         3 L~~L~l~~n~L   13 (17)
T PF13504_consen    3 LRTLDLSNNRL   13 (17)
T ss_dssp             -SEEEETSS--
T ss_pred             cCEEECCCCCC
Confidence            33444444443


No 63 
>PRK15386 type III secretion protein GogB; Provisional
Probab=93.82  E-value=0.1  Score=44.89  Aligned_cols=60  Identities=13%  Similarity=0.242  Sum_probs=42.7

Q ss_pred             CCeEEEEecCCCCccccCccccCCCCCCcEEeCcCC-cCcCCChhhhhCCcccceeecccc-ccccCCCcc
Q 035742           47 GRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLN-GFLGTIPSQIGNLSKLSYISLQSN-QLSGKIPLE  115 (214)
Q Consensus        47 ~~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n-~l~~~~p~~~~~l~~L~~L~ls~N-~l~g~~p~~  115 (214)
                      .+++.|+++++.|+ .+| .   -..+|+.|.++++ .++ .+|..+  ..+|+.|++++| .+. .+|..
T Consensus        52 ~~l~~L~Is~c~L~-sLP-~---LP~sLtsL~Lsnc~nLt-sLP~~L--P~nLe~L~Ls~Cs~L~-sLP~s  113 (426)
T PRK15386         52 RASGRLYIKDCDIE-SLP-V---LPNELTEITIENCNNLT-TLPGSI--PEGLEKLTVCHCPEIS-GLPES  113 (426)
T ss_pred             cCCCEEEeCCCCCc-ccC-C---CCCCCcEEEccCCCCcc-cCCchh--hhhhhheEccCccccc-ccccc
Confidence            46889999999888 666 2   2346999999874 443 666554  357889999888 554 66654


No 64 
>smart00370 LRR Leucine-rich repeats, outliers.
Probab=92.41  E-value=0.15  Score=25.34  Aligned_cols=14  Identities=50%  Similarity=0.603  Sum_probs=6.9

Q ss_pred             CCCcEEeCcCCcCc
Q 035742           72 PQLVHLDLSLNGFL   85 (214)
Q Consensus        72 ~~L~~L~l~~n~l~   85 (214)
                      ++|+.|++++|++.
T Consensus         2 ~~L~~L~L~~N~l~   15 (26)
T smart00370        2 PNLRELDLSNNQLS   15 (26)
T ss_pred             CCCCEEECCCCcCC
Confidence            34455555555554


No 65 
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily.
Probab=92.41  E-value=0.15  Score=25.34  Aligned_cols=14  Identities=50%  Similarity=0.603  Sum_probs=6.9

Q ss_pred             CCCcEEeCcCCcCc
Q 035742           72 PQLVHLDLSLNGFL   85 (214)
Q Consensus        72 ~~L~~L~l~~n~l~   85 (214)
                      ++|+.|++++|++.
T Consensus         2 ~~L~~L~L~~N~l~   15 (26)
T smart00369        2 PNLRELDLSNNQLS   15 (26)
T ss_pred             CCCCEEECCCCcCC
Confidence            34455555555554


No 66 
>PF13306 LRR_5:  Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A.
Probab=92.24  E-value=0.21  Score=35.01  Aligned_cols=79  Identities=18%  Similarity=0.219  Sum_probs=46.5

Q ss_pred             CeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhhc
Q 035742           48 RVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHF  127 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l  127 (214)
                      +|+.+.+.. .+. .++...|.+++.|+.+.+..+ +...-...|.++.+|+.+.+.. .+...-...|..+++|+.+++
T Consensus        13 ~l~~i~~~~-~~~-~I~~~~F~~~~~l~~i~~~~~-~~~i~~~~F~~~~~l~~i~~~~-~~~~i~~~~F~~~~~l~~i~~   88 (129)
T PF13306_consen   13 NLESITFPN-TIK-KIGENAFSNCTSLKSINFPNN-LTSIGDNAFSNCKSLESITFPN-NLKSIGDNAFSNCTNLKNIDI   88 (129)
T ss_dssp             T--EEEETS-T---EE-TTTTTT-TT-SEEEESST-TSCE-TTTTTT-TT-EEEEETS-TT-EE-TTTTTT-TTECEEEE
T ss_pred             CCCEEEECC-Cee-EeChhhccccccccccccccc-ccccceeeeecccccccccccc-ccccccccccccccccccccc
Confidence            678888874 566 565477888888999998775 6534445677887888888865 443233455677888888888


Q ss_pred             ccc
Q 035742          128 QFN  130 (214)
Q Consensus       128 ~~N  130 (214)
                      ..|
T Consensus        89 ~~~   91 (129)
T PF13306_consen   89 PSN   91 (129)
T ss_dssp             TTT
T ss_pred             Ccc
Confidence            665


No 67 
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]
Probab=91.36  E-value=0.1  Score=43.47  Aligned_cols=86  Identities=20%  Similarity=0.278  Sum_probs=45.4

Q ss_pred             CCeEEEEecCCCCccc----cCccccCCCCCCcEEeCcCCcCcC----CChhhhhCCcccceeeccccccccC----CCc
Q 035742           47 GRVINISLRNTGLSGT----LSDFSFSSFPQLVHLDLSLNGFLG----TIPSQIGNLSKLSYISLQSNQLSGK----IPL  114 (214)
Q Consensus        47 ~~L~~L~L~~n~l~g~----~p~~~~~~l~~L~~L~l~~n~l~~----~~p~~~~~l~~L~~L~ls~N~l~g~----~p~  114 (214)
                      ..|+++....|.+...    +. ..|...+.|+.+.+..|.|..    .+-..+..+++|+.|||..|.|+..    +..
T Consensus       157 ~~Lrv~i~~rNrlen~ga~~~A-~~~~~~~~leevr~~qN~I~~eG~~al~eal~~~~~LevLdl~DNtft~egs~~Lak  235 (382)
T KOG1909|consen  157 PKLRVFICGRNRLENGGATALA-EAFQSHPTLEEVRLSQNGIRPEGVTALAEALEHCPHLEVLDLRDNTFTLEGSVALAK  235 (382)
T ss_pred             cceEEEEeeccccccccHHHHH-HHHHhccccceEEEecccccCchhHHHHHHHHhCCcceeeecccchhhhHHHHHHHH
Confidence            4566666666665311    11 334455666666666665531    1223455666666666666666521    122


Q ss_pred             cccccccchhhhcccccce
Q 035742          115 EVGLLTHLKVLHFQFNQLK  133 (214)
Q Consensus       115 ~~~~l~~L~~L~l~~N~l~  133 (214)
                      .+..+++|+.++++++.++
T Consensus       236 aL~s~~~L~El~l~dcll~  254 (382)
T KOG1909|consen  236 ALSSWPHLRELNLGDCLLE  254 (382)
T ss_pred             Hhcccchheeecccccccc
Confidence            3444455666666665554


No 68 
>KOG2982 consensus Uncharacterized conserved protein [Function unknown]
Probab=91.13  E-value=0.12  Score=42.54  Aligned_cols=70  Identities=21%  Similarity=0.325  Sum_probs=51.5

Q ss_pred             ccceeeeC--CCCCeEEEEecCCCCccccCcccc-CCCCCCcEEeCcCCcCcCCChh-hhhCCcccceeecccccc
Q 035742           37 AWFGISCS--DAGRVINISLRNTGLSGTLSDFSF-SSFPQLVHLDLSLNGFLGTIPS-QIGNLSKLSYISLQSNQL  108 (214)
Q Consensus        37 ~w~gv~c~--~~~~L~~L~L~~n~l~g~~p~~~~-~~l~~L~~L~l~~n~l~~~~p~-~~~~l~~L~~L~ls~N~l  108 (214)
                      .|+-|.|.  ...+|+.|+|+.|.+...|.  .+ ..+.+|+.|-|.+..+....-. .+..++.++.|+++.|.+
T Consensus        85 dWseI~~ile~lP~l~~LNls~N~L~s~I~--~lp~p~~nl~~lVLNgT~L~w~~~~s~l~~lP~vtelHmS~N~~  158 (418)
T KOG2982|consen   85 DWSEIGAILEQLPALTTLNLSCNSLSSDIK--SLPLPLKNLRVLVLNGTGLSWTQSTSSLDDLPKVTELHMSDNSL  158 (418)
T ss_pred             cHHHHHHHHhcCccceEeeccCCcCCCccc--cCcccccceEEEEEcCCCCChhhhhhhhhcchhhhhhhhccchh
Confidence            47766654  67799999999999985554  23 4567889999988887654443 456788888888888843


No 69 
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]
Probab=90.95  E-value=0.085  Score=42.76  Aligned_cols=84  Identities=17%  Similarity=0.270  Sum_probs=39.3

Q ss_pred             CCeEEEEecCCCCccccCc---cccCCCCCCcEEeCcCCcCcCC----Ch-------hhhhCCcccceeeccccccccCC
Q 035742           47 GRVINISLRNTGLSGTLSD---FSFSSFPQLVHLDLSLNGFLGT----IP-------SQIGNLSKLSYISLQSNQLSGKI  112 (214)
Q Consensus        47 ~~L~~L~L~~n~l~g~~p~---~~~~~l~~L~~L~l~~n~l~~~----~p-------~~~~~l~~L~~L~ls~N~l~g~~  112 (214)
                      ..++.++|++|.|...-..   ..+.+-.+|+..+++.- ++|.    ++       +.+..|++|+..+||.|-|....
T Consensus        30 d~~~evdLSGNtigtEA~e~l~~~ia~~~~L~vvnfsd~-ftgr~kde~~~~L~~Ll~aLlkcp~l~~v~LSDNAfg~~~  108 (388)
T COG5238          30 DELVEVDLSGNTIGTEAMEELCNVIANVRNLRVVNFSDA-FTGRDKDELYSNLVMLLKALLKCPRLQKVDLSDNAFGSEF  108 (388)
T ss_pred             cceeEEeccCCcccHHHHHHHHHHHhhhcceeEeehhhh-hhcccHHHHHHHHHHHHHHHhcCCcceeeeccccccCccc
Confidence            3567777777776522110   22333444555554432 1111    11       23334555566666666555444


Q ss_pred             Ccc----ccccccchhhhccccc
Q 035742          113 PLE----VGLLTHLKVLHFQFNQ  131 (214)
Q Consensus       113 p~~----~~~l~~L~~L~l~~N~  131 (214)
                      |+.    +++-+.|.+|.+++|.
T Consensus       109 ~e~L~d~is~~t~l~HL~l~NnG  131 (388)
T COG5238         109 PEELGDLISSSTDLVHLKLNNNG  131 (388)
T ss_pred             chHHHHHHhcCCCceeEEeecCC
Confidence            433    2333455555555553


No 70 
>PRK15386 type III secretion protein GogB; Provisional
Probab=89.75  E-value=0.26  Score=42.41  Aligned_cols=61  Identities=15%  Similarity=0.158  Sum_probs=43.5

Q ss_pred             ccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccc-cccccCCCccccccccchhhhcccc-ccee
Q 035742           67 SFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQS-NQLSGKIPLEVGLLTHLKVLHFQFN-QLKL  134 (214)
Q Consensus        67 ~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~-N~l~g~~p~~~~~l~~L~~L~l~~N-~l~g  134 (214)
                      .+..+.+++.|++++|.+. .+|   .-..+|+.|.+++ +.++ .+|..+.  .+|+.|++++| .+..
T Consensus        47 r~~~~~~l~~L~Is~c~L~-sLP---~LP~sLtsL~Lsnc~nLt-sLP~~LP--~nLe~L~Ls~Cs~L~s  109 (426)
T PRK15386         47 QIEEARASGRLYIKDCDIE-SLP---VLPNELTEITIENCNNLT-TLPGSIP--EGLEKLTVCHCPEISG  109 (426)
T ss_pred             HHHHhcCCCEEEeCCCCCc-ccC---CCCCCCcEEEccCCCCcc-cCCchhh--hhhhheEccCcccccc
Confidence            3445688999999999887 667   2334699999987 4554 6776542  57888888887 5544


No 71 
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=88.88  E-value=0.5  Score=37.77  Aligned_cols=31  Identities=26%  Similarity=0.640  Sum_probs=24.5

Q ss_pred             HHHHHHHHHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          181 QEKLISIMGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       181 ~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      +..+.+++   ..|...+|.+||++++|.+.|++
T Consensus       252 ~~~~~~l~---~~c~~~~p~~Rp~~~~i~~~l~~  282 (283)
T cd05048         252 PARVYALM---IECWNEIPARRPRFKDIHTRLRS  282 (283)
T ss_pred             CHHHHHHH---HHHccCChhhCcCHHHHHHHHhc
Confidence            34444444   44999999999999999999974


No 72 
>KOG0473 consensus Leucine-rich repeat protein [Function unknown]
Probab=88.50  E-value=0.022  Score=45.05  Aligned_cols=73  Identities=19%  Similarity=0.209  Sum_probs=60.8

Q ss_pred             ccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhhcccccceeec
Q 035742           62 TLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHFQFNQLKLLV  136 (214)
Q Consensus        62 ~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l~~N~l~g~~  136 (214)
                      .+|--++..+...+.||++.|++. .+-..|..++.|..|+++.|++. .+|..++.+..+..+++..|.++-.+
T Consensus        32 ~~~v~ei~~~kr~tvld~~s~r~v-n~~~n~s~~t~~~rl~~sknq~~-~~~~d~~q~~e~~~~~~~~n~~~~~p  104 (326)
T KOG0473|consen   32 EIPVREIASFKRVTVLDLSSNRLV-NLGKNFSILTRLVRLDLSKNQIK-FLPKDAKQQRETVNAASHKNNHSQQP  104 (326)
T ss_pred             ccchhhhhccceeeeehhhhhHHH-hhccchHHHHHHHHHhccHhhHh-hChhhHHHHHHHHHHHhhccchhhCC
Confidence            344245667788899999999986 55567888899999999999998 89999999999999999999887543


No 73 
>PF13306 LRR_5:  Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A.
Probab=88.27  E-value=0.44  Score=33.36  Aligned_cols=77  Identities=18%  Similarity=0.235  Sum_probs=45.4

Q ss_pred             CeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCcCCChhhhhCCcccceeeccccccccCCCccccccccchhhhc
Q 035742           48 RVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHF  127 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l  127 (214)
                      +++.+.+..+ +. .+++..|.+...++.+.+.. .+...-...|..+++|+.+.+..+ +...-...|.+. .|+.+.+
T Consensus        36 ~l~~i~~~~~-~~-~i~~~~F~~~~~l~~i~~~~-~~~~i~~~~F~~~~~l~~i~~~~~-~~~i~~~~f~~~-~l~~i~~  110 (129)
T PF13306_consen   36 SLKSINFPNN-LT-SIGDNAFSNCKSLESITFPN-NLKSIGDNAFSNCTNLKNIDIPSN-ITEIGSSSFSNC-NLKEINI  110 (129)
T ss_dssp             T-SEEEESST-TS-CE-TTTTTT-TT-EEEEETS-TT-EE-TTTTTT-TTECEEEETTT--BEEHTTTTTT--T--EEE-
T ss_pred             cccccccccc-cc-ccceeeeecccccccccccc-cccccccccccccccccccccCcc-ccEEchhhhcCC-CceEEEE
Confidence            6889998875 66 66657788988899999976 443233445777999999998765 442334456665 6776666


Q ss_pred             cc
Q 035742          128 QF  129 (214)
Q Consensus       128 ~~  129 (214)
                      ..
T Consensus       111 ~~  112 (129)
T PF13306_consen  111 PS  112 (129)
T ss_dssp             TT
T ss_pred             CC
Confidence            54


No 74 
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=87.23  E-value=1  Score=36.25  Aligned_cols=25  Identities=16%  Similarity=0.456  Sum_probs=21.4

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .+...|...+|.+||+|.+|.++|+
T Consensus       256 ~li~~~l~~~P~~Rpt~~~v~~~l~  280 (291)
T cd05094         256 DIMLGCWQREPQQRLNIKEIYKILH  280 (291)
T ss_pred             HHHHHHcccChhhCcCHHHHHHHHH
Confidence            4444599999999999999999985


No 75 
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=86.94  E-value=0.98  Score=36.25  Aligned_cols=28  Identities=21%  Similarity=0.490  Sum_probs=23.8

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      +..+...|++.+|.+||++.++++.|++
T Consensus       261 l~~li~~~l~~~p~~Rpt~~el~~~l~~  288 (288)
T cd05050         261 LYNLMRLCWSKLPSDRPSFASINRILQR  288 (288)
T ss_pred             HHHHHHHHcccCcccCCCHHHHHHHhhC
Confidence            4455566999999999999999999975


No 76 
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=86.85  E-value=0.49  Score=37.67  Aligned_cols=28  Identities=14%  Similarity=0.347  Sum_probs=23.6

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      +..+...|...+|.+||+|.+|+++|++
T Consensus       255 ~~~li~~cl~~~p~~Rpt~~ei~~~l~~  282 (284)
T cd05038         255 VYDLMKLCWEAEPQDRPSFADLILIVDR  282 (284)
T ss_pred             HHHHHHHHhccChhhCCCHHHHHHHHhh
Confidence            4455556999999999999999999973


No 77 
>PF13516 LRR_6:  Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A ....
Probab=86.83  E-value=0.17  Score=24.64  Aligned_cols=13  Identities=46%  Similarity=0.434  Sum_probs=5.2

Q ss_pred             CCcEEeCcCCcCc
Q 035742           73 QLVHLDLSLNGFL   85 (214)
Q Consensus        73 ~L~~L~l~~n~l~   85 (214)
                      +|+.|++++|.|+
T Consensus         3 ~L~~L~l~~n~i~   15 (24)
T PF13516_consen    3 NLETLDLSNNQIT   15 (24)
T ss_dssp             T-SEEE-TSSBEH
T ss_pred             CCCEEEccCCcCC
Confidence            4444455444443


No 78 
>PHA02988 hypothetical protein; Provisional
Probab=86.19  E-value=1.5  Score=35.40  Aligned_cols=29  Identities=17%  Similarity=0.468  Sum_probs=24.0

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+.+++..   |...+|.+||++.+|++.|+
T Consensus       249 ~~l~~li~~---cl~~dp~~Rps~~ell~~l~  277 (283)
T PHA02988        249 LEIKCIVEA---CTSHDSIKRPNIKEILYNLS  277 (283)
T ss_pred             HHHHHHHHH---HhcCCcccCcCHHHHHHHHH
Confidence            555555555   99999999999999999885


No 79 
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=85.32  E-value=1.9  Score=33.93  Aligned_cols=29  Identities=28%  Similarity=0.541  Sum_probs=22.6

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+.+++.   .|...+|.+||+|.+|.++++
T Consensus       235 ~~~~~li~---~~l~~~p~~Rpt~~~i~~~~~  263 (267)
T cd08229         235 EELRQLVN---MCINPDPEKRPDITYVYDVAK  263 (267)
T ss_pred             HHHHHHHH---HhcCCCcccCCCHHHHHHHHh
Confidence            44444444   499999999999998888875


No 80 
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=85.12  E-value=1.3  Score=35.19  Aligned_cols=30  Identities=23%  Similarity=0.442  Sum_probs=24.0

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ..+.+++..   |...+|.+||++.+|.++|++
T Consensus       251 ~~~~~li~~---~l~~~p~~Rp~~~eil~~l~~  280 (280)
T cd05049         251 SEVYDIMLG---CWKRDPQQRINIKDIHERLQK  280 (280)
T ss_pred             HHHHHHHHH---HcCCCcccCCCHHHHHHHhhC
Confidence            444444444   999999999999999999974


No 81 
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type.
Probab=84.33  E-value=0.62  Score=23.44  Aligned_cols=17  Identities=29%  Similarity=0.546  Sum_probs=10.5

Q ss_pred             ccceeeccccccccCCCc
Q 035742           97 KLSYISLQSNQLSGKIPL  114 (214)
Q Consensus        97 ~L~~L~ls~N~l~g~~p~  114 (214)
                      +|+.|++++|+++ .+|+
T Consensus         3 ~L~~L~vs~N~Lt-~LPe   19 (26)
T smart00364        3 SLKELNVSNNQLT-SLPE   19 (26)
T ss_pred             ccceeecCCCccc-cCcc
Confidence            4566666666666 5554


No 82 
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca
Probab=84.25  E-value=2.2  Score=33.51  Aligned_cols=25  Identities=24%  Similarity=0.583  Sum_probs=21.3

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .....|...+|.+||++.+|.++|+
T Consensus       233 ~li~~cl~~~p~~Rp~~~~il~~l~  257 (262)
T cd05058         233 EVMLSCWHPKPEMRPTFSELVSRIE  257 (262)
T ss_pred             HHHHHHcCCChhhCCCHHHHHHHHH
Confidence            3444599999999999999999986


No 83 
>PF07714 Pkinase_Tyr:  Protein tyrosine kinase Protein kinase; unclassified specificity. Tyrosine kinase, catalytic domain;  InterPro: IPR001245 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].  ; GO: 0004672 protein kinase activity, 0006468 protein phosphorylation; PDB: 2HYY_C 1OPL_A 2V7A_A 2G2H_B 2G1T_A 3PYY_A 3CS9_D 2HZI_A 2E2B_A 2HIW_A ....
Probab=83.98  E-value=0.7  Score=36.67  Aligned_cols=28  Identities=29%  Similarity=0.650  Sum_probs=19.9

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHh
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQL  212 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L  212 (214)
                      ..+.+++..   |...+|.+||+|++++++|
T Consensus       232 ~~~~~li~~---C~~~~p~~RPs~~~i~~~L  259 (259)
T PF07714_consen  232 KDIYSLIQQ---CWSHDPEKRPSFQEILQEL  259 (259)
T ss_dssp             HHHHHHHHH---HT-SSGGGS--HHHHHHHH
T ss_pred             HHHHHHHHH---HcCCChhhCcCHHHHHhcC
Confidence            445555555   9999999999999999986


No 84 
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=83.95  E-value=1.3  Score=35.38  Aligned_cols=26  Identities=23%  Similarity=0.574  Sum_probs=21.9

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+...|...+|.+||+|++|+++|+
T Consensus       256 ~~li~~cl~~~p~~Rpt~~ei~~~l~  281 (284)
T cd05081         256 YAIMKECWNNDPSQRPSFSELALQVE  281 (284)
T ss_pred             HHHHHHHccCChhhCCCHHHHHHHHH
Confidence            34444599999999999999999986


No 85 
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=83.84  E-value=1.5  Score=35.05  Aligned_cols=25  Identities=28%  Similarity=0.648  Sum_probs=21.5

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .+...|...+|.+||++++|...|+
T Consensus       257 ~li~~cl~~~p~~RP~~~~i~~~l~  281 (283)
T cd05091         257 TLMLECWNEFPSRRPRFKDIHSRLR  281 (283)
T ss_pred             HHHHHHhCCCcccCCCHHHHHHHhh
Confidence            4444599999999999999999986


No 86 
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=83.48  E-value=0.97  Score=35.44  Aligned_cols=27  Identities=26%  Similarity=0.524  Sum_probs=22.9

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      +..+...|...+|.+||++.+|.++|+
T Consensus       230 ~~~l~~~~l~~~p~~Rp~~~~~l~~l~  256 (256)
T cd05112         230 VYELMQHCWKERPEDRPSFSLLLHQLA  256 (256)
T ss_pred             HHHHHHHHcccChhhCCCHHHHHHhhC
Confidence            445566699999999999999999885


No 87 
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=83.27  E-value=1.5  Score=34.56  Aligned_cols=29  Identities=21%  Similarity=0.429  Sum_probs=23.8

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+.+++..   |...+|.+||+|.+|+.+|+
T Consensus       225 ~~l~~li~~---~~~~~p~~Rp~~~~i~~~l~  253 (257)
T cd05116         225 PEMYDLMKL---CWTYGVDERPGFAVVELRLR  253 (257)
T ss_pred             HHHHHHHHH---HhccCchhCcCHHHHHHHHh
Confidence            444555555   99999999999999999986


No 88 
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored 
Probab=83.10  E-value=1  Score=35.56  Aligned_cols=27  Identities=15%  Similarity=0.379  Sum_probs=22.7

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ..+...|...+|..||+|++|.++|++
T Consensus       240 ~~li~~c~~~~p~~Rp~~~~i~~~l~~  266 (268)
T cd05063         240 YQLMLQCWQQDRARRPRFVDIVNLLDK  266 (268)
T ss_pred             HHHHHHHcCCCcccCcCHHHHHHHHHh
Confidence            445555999999999999999999863


No 89 
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=83.06  E-value=1.1  Score=36.12  Aligned_cols=29  Identities=24%  Similarity=0.426  Sum_probs=23.9

Q ss_pred             HHHHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          186 SIMGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       186 ~l~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ++..+...|...+|.+||+|.+|.+.|+.
T Consensus       268 ~l~~li~~cl~~~p~~Rpt~~el~~~L~~  296 (296)
T cd05051         268 DIYELMLECWRRDEEDRPTFREIHLFLQR  296 (296)
T ss_pred             HHHHHHHHHhccChhcCCCHHHHHHHhcC
Confidence            34555566999999999999999999873


No 90 
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=82.85  E-value=1.3  Score=35.62  Aligned_cols=27  Identities=22%  Similarity=0.317  Sum_probs=22.2

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ..+...|+..+|.+||+|+++++.|++
T Consensus       251 ~~li~~~l~~~p~~Rps~~~ll~~l~~  277 (288)
T cd05061         251 TDLMRMCWQFNPKMRPTFLEIVNLLKD  277 (288)
T ss_pred             HHHHHHHcCCChhHCcCHHHHHHHHHh
Confidence            344445999999999999999998863


No 91 
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=82.83  E-value=1.2  Score=35.89  Aligned_cols=27  Identities=19%  Similarity=0.418  Sum_probs=22.6

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ..+...|...+|.+||+|.+|.+.|+.
T Consensus       270 ~~li~~cl~~~p~~Rp~~~~i~~~l~~  296 (296)
T cd05095         270 YKLMLSCWRRNAKERPSFQEIHATLLE  296 (296)
T ss_pred             HHHHHHHcCCCcccCCCHHHHHHHHhC
Confidence            344455999999999999999999874


No 92 
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=82.63  E-value=1.6  Score=34.78  Aligned_cols=27  Identities=15%  Similarity=0.341  Sum_probs=22.3

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ..+...|.+.+|.+||++.+++++|+.
T Consensus       251 ~~li~~~l~~~p~~Rps~~e~l~~l~~  277 (277)
T cd05062         251 FELMRMCWQYNPKMRPSFLEIISSIKE  277 (277)
T ss_pred             HHHHHHHcCCChhhCcCHHHHHHHhhC
Confidence            334445999999999999999999874


No 93 
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds 
Probab=82.54  E-value=2.9  Score=32.93  Aligned_cols=26  Identities=23%  Similarity=0.593  Sum_probs=21.3

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ......|...+|.+||++.++++.|+
T Consensus       231 ~~li~~cl~~~p~~Rp~~~~ll~~~~  256 (256)
T cd05113         231 YAIMYSCWHEKAEERPTFQQLLSSIE  256 (256)
T ss_pred             HHHHHHHcCCCcccCCCHHHHHHhhC
Confidence            33444599999999999999999875


No 94 
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly 
Probab=82.47  E-value=1.3  Score=35.56  Aligned_cols=26  Identities=19%  Similarity=0.420  Sum_probs=21.7

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ......|...+|.+||++.+|.+.|+
T Consensus       252 ~~li~~~l~~~p~~Rpt~~~v~~~l~  277 (288)
T cd05093         252 YDLMLGCWQREPHMRLNIKEIHSLLQ  277 (288)
T ss_pred             HHHHHHHccCChhhCCCHHHHHHHHH
Confidence            34444599999999999999999886


No 95 
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=82.16  E-value=3.4  Score=32.48  Aligned_cols=30  Identities=30%  Similarity=0.558  Sum_probs=23.7

Q ss_pred             HHHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          181 QEKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       181 ~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      +..+.+++.   .|...+|.+||++.+|.+.|+
T Consensus       229 ~~~~~~li~---~~l~~~p~~Rp~~~~i~~~l~  258 (260)
T cd05069         229 PESLHELMK---LCWKKDPDERPTFEYIQSFLE  258 (260)
T ss_pred             CHHHHHHHH---HHccCCcccCcCHHHHHHHHh
Confidence            344444544   499999999999999999986


No 96 
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=82.06  E-value=1.2  Score=35.91  Aligned_cols=27  Identities=19%  Similarity=0.475  Sum_probs=22.7

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      +......|...+|.+||+|.+|.++|+
T Consensus       268 l~~li~~~l~~~p~~RPs~~~i~~~l~  294 (295)
T cd05097         268 VFKLMMRCWSRDIKDRPTFNKIHHFLR  294 (295)
T ss_pred             HHHHHHHHcCCCchhCcCHHHHHHHHh
Confidence            344555599999999999999999986


No 97 
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=81.94  E-value=1.2  Score=34.96  Aligned_cols=26  Identities=19%  Similarity=0.602  Sum_probs=22.2

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+...|...+|.+||+++++.++|+
T Consensus       234 ~~~i~~~l~~~p~~Rpt~~~l~~~L~  259 (261)
T cd05148         234 YKIMLECWAAEPEDRPSFKALREELD  259 (261)
T ss_pred             HHHHHHHcCCCchhCcCHHHHHHHHh
Confidence            34445699999999999999999986


No 98 
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=81.80  E-value=1.9  Score=34.06  Aligned_cols=27  Identities=19%  Similarity=0.411  Sum_probs=22.4

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ..+...|...+|.+||++.+|.++|++
T Consensus       238 ~~li~~cl~~~p~~Rp~~~ei~~~l~~  264 (266)
T cd05033         238 YQLMLDCWQKDRNERPTFSQIVSTLDK  264 (266)
T ss_pred             HHHHHHHcCCCcccCcCHHHHHHHHHh
Confidence            344445999999999999999999873


No 99 
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=81.73  E-value=1.3  Score=34.93  Aligned_cols=25  Identities=20%  Similarity=0.492  Sum_probs=21.4

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .+...|...+|.+||++.++.++|+
T Consensus       236 ~li~~cl~~~p~~Rp~~~~l~~~l~  260 (263)
T cd05052         236 ELMRACWQWNPSDRPSFAEIHQAFE  260 (263)
T ss_pred             HHHHHHccCCcccCCCHHHHHHHHH
Confidence            3444599999999999999999986


No 100
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein. Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi
Probab=81.65  E-value=1.1  Score=36.09  Aligned_cols=26  Identities=27%  Similarity=0.668  Sum_probs=22.3

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ......|...+|.+||++++++++|+
T Consensus       259 ~~~i~~cl~~~P~~Rp~~~~i~~~l~  284 (290)
T cd05045         259 YNLMLTCWKQEPDKRPTFADISKELE  284 (290)
T ss_pred             HHHHHHHccCCcccCCCHHHHHHHHH
Confidence            34455699999999999999999987


No 101
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=81.51  E-value=1  Score=38.08  Aligned_cols=26  Identities=23%  Similarity=0.594  Sum_probs=22.0

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      .+...|.+.+|.+||+|.+|+++|++
T Consensus       348 ~li~~cl~~dP~~RPs~~eil~~l~~  373 (375)
T cd05104         348 DIMKSCWDADPLKRPTFKQIVQLIEQ  373 (375)
T ss_pred             HHHHHHccCChhHCcCHHHHHHHHHh
Confidence            34445999999999999999999874


No 102
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=81.31  E-value=1.3  Score=35.56  Aligned_cols=27  Identities=26%  Similarity=0.569  Sum_probs=22.8

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      +..+...|...+|.+||+|++|++.|+
T Consensus       263 ~~~li~~~l~~~p~~Rps~~eil~~l~  289 (293)
T cd05053         263 LYHLMRDCWHEVPSQRPTFKQLVEDLD  289 (293)
T ss_pred             HHHHHHHHcccCcccCcCHHHHHHHHH
Confidence            445555699999999999999999986


No 103
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=81.27  E-value=1.7  Score=35.83  Aligned_cols=26  Identities=23%  Similarity=0.534  Sum_probs=21.9

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+...|...+|.+||++.+|+++|+
T Consensus       307 ~~li~~cl~~dp~~RPs~~el~~~l~  332 (338)
T cd05102         307 YRIMLACWQGDPKERPTFSALVEILG  332 (338)
T ss_pred             HHHHHHHccCChhhCcCHHHHHHHHH
Confidence            34444599999999999999999986


No 104
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=81.26  E-value=1.4  Score=34.67  Aligned_cols=27  Identities=26%  Similarity=0.642  Sum_probs=22.4

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      +..+...|...+|.+||+|.+++++|.
T Consensus       230 ~~~li~~c~~~~p~~Rps~~~l~~~l~  256 (256)
T cd05114         230 VYEVMYSCWHEKPEGRPTFAELLRAIT  256 (256)
T ss_pred             HHHHHHHHccCCcccCcCHHHHHHhhC
Confidence            345555699999999999999999873


No 105
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=81.25  E-value=2.1  Score=33.85  Aligned_cols=26  Identities=23%  Similarity=0.480  Sum_probs=21.8

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+...|...+|.+||++.++.++|+
T Consensus       244 ~~li~~~l~~~p~~Rps~~~l~~~l~  269 (272)
T cd05075         244 YSLMSSCWLLNPKDRPSFETLRCELE  269 (272)
T ss_pred             HHHHHHHcCCCcccCcCHHHHHHHHH
Confidence            34444599999999999999999986


No 106
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory
Probab=81.12  E-value=2  Score=34.29  Aligned_cols=30  Identities=23%  Similarity=0.487  Sum_probs=23.9

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ..+.+++.   .|.+.+|.+||++.+|.++|++
T Consensus       251 ~~~~~li~---~cl~~~P~~Rp~~~~l~~~l~~  280 (280)
T cd05092         251 PEVYAIMQ---GCWQREPQQRMVIKDIHSRLQA  280 (280)
T ss_pred             HHHHHHHH---HHccCChhhCCCHHHHHHHHhC
Confidence            44444444   4999999999999999999874


No 107
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.
Probab=81.01  E-value=1.6  Score=34.46  Aligned_cols=22  Identities=27%  Similarity=0.516  Sum_probs=19.9

Q ss_pred             hcccCCCCCCCCCHHHHHHHhc
Q 035742          192 FPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..|...+|..||+|.+|++++.
T Consensus       247 ~~cl~~~p~~Rp~~~e~~~~~~  268 (269)
T cd08528         247 TSCLTPDAEARPDIIQVSAMIS  268 (269)
T ss_pred             HHHCCCCCccCCCHHHHHHHhc
Confidence            3599999999999999999985


No 108
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular 
Probab=80.47  E-value=1.4  Score=34.44  Aligned_cols=26  Identities=35%  Similarity=0.512  Sum_probs=22.0

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      .....|+..+|.+||++.+|.++|+.
T Consensus       227 ~li~~~l~~~p~~Rps~~~~~~~l~~  252 (252)
T cd05084         227 RLMERCWEYDPGQRPSFSTVHQELQS  252 (252)
T ss_pred             HHHHHHcCCChhhCcCHHHHHHHHhC
Confidence            34445999999999999999999974


No 109
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=80.34  E-value=1.4  Score=34.68  Aligned_cols=27  Identities=30%  Similarity=0.672  Sum_probs=22.7

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      +..+...|...+|.+||+|.++..+|+
T Consensus       233 ~~~li~~~l~~~P~~Rp~~~~l~~~l~  259 (261)
T cd05068         233 LYDIMLDCWKEDPDDRPTFETLQWKLE  259 (261)
T ss_pred             HHHHHHHHhhcCcccCCCHHHHHHHHh
Confidence            344555699999999999999999986


No 110
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=79.86  E-value=1.8  Score=33.73  Aligned_cols=28  Identities=21%  Similarity=0.481  Sum_probs=22.9

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      +......|...+|.+||++.+++++|+.
T Consensus       223 ~~~li~~~l~~~p~~Rp~~~~l~~~l~~  250 (250)
T cd05085         223 VYKVMQRCWDYKPENRPKFSELQKELAA  250 (250)
T ss_pred             HHHHHHHHcccCcccCCCHHHHHHHhcC
Confidence            3444455999999999999999999863


No 111
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity 
Probab=79.49  E-value=1.4  Score=34.69  Aligned_cols=26  Identities=19%  Similarity=0.503  Sum_probs=21.3

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+-..|.+.+|.+||++++++++|+
T Consensus       233 ~~li~~~l~~~p~~Rps~~~il~~l~  258 (258)
T cd05078         233 ANLINQCMDYEPDFRPSFRAIIRDLN  258 (258)
T ss_pred             HHHHHHHhccChhhCCCHHHHHHhcC
Confidence            33444499999999999999999874


No 112
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros. Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male
Probab=79.37  E-value=3.2  Score=32.69  Aligned_cols=30  Identities=30%  Similarity=0.661  Sum_probs=23.7

Q ss_pred             HHHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          181 QEKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       181 ~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      +..+.++..   .|...+|.+||++.+|.++|+
T Consensus       239 ~~~~~~li~---~~l~~~p~~Rp~~~~i~~~l~  268 (269)
T cd05044         239 PDKIYQLMT---NCWAQDPSERPTFDRIQEILQ  268 (269)
T ss_pred             hHHHHHHHH---HHcCCCcccCCCHHHHHHHHh
Confidence            344444444   599999999999999999986


No 113
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily.
Probab=79.23  E-value=1.9  Score=21.68  Aligned_cols=12  Identities=50%  Similarity=0.562  Sum_probs=5.9

Q ss_pred             CCcEEeCcCCcC
Q 035742           73 QLVHLDLSLNGF   84 (214)
Q Consensus        73 ~L~~L~l~~n~l   84 (214)
                      +|+.|++++|.|
T Consensus         3 ~L~~L~L~~NkI   14 (26)
T smart00365        3 NLEELDLSQNKI   14 (26)
T ss_pred             ccCEEECCCCcc
Confidence            444455555444


No 114
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=78.69  E-value=1.6  Score=34.91  Aligned_cols=26  Identities=19%  Similarity=0.291  Sum_probs=21.8

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ......|...+|.+||+|++|+++|+
T Consensus       254 ~~li~~cl~~~p~~Rps~~~i~~~l~  279 (283)
T cd05080         254 YILMKNCWETEAKFRPTFRSLIPILK  279 (283)
T ss_pred             HHHHHHHhccChhhCCCHHHHHHHHH
Confidence            33444599999999999999999986


No 115
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=78.40  E-value=2.3  Score=33.65  Aligned_cols=27  Identities=15%  Similarity=0.363  Sum_probs=22.3

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ......|.+.+|.+||+|.+|.++|++
T Consensus       239 ~~li~~~l~~~p~~Rp~~~~i~~~l~~  265 (267)
T cd05066         239 HQLMLDCWQKDRNERPKFEQIVSILDK  265 (267)
T ss_pred             HHHHHHHcccCchhCCCHHHHHHHHHh
Confidence            344445999999999999999999873


No 116
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=78.30  E-value=3  Score=33.26  Aligned_cols=30  Identities=27%  Similarity=0.636  Sum_probs=23.6

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ..+.+++.   .|...+|.+||++.+|.++|++
T Consensus       253 ~~~~~li~---~cl~~~p~~Rp~~~~i~~~l~~  282 (283)
T cd05090         253 PRMYSLMT---ECWQEGPSRRPRFKDIHTRLRS  282 (283)
T ss_pred             HHHHHHHH---HHcccCcccCcCHHHHHHHhhc
Confidence            34444444   5999999999999999999874


No 117
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms]
Probab=78.22  E-value=3.8  Score=34.78  Aligned_cols=71  Identities=21%  Similarity=0.389  Sum_probs=42.3

Q ss_pred             ceeecchhhhhcCCCCchhhhhhcccccchh-hhhhhhcCCCCCCCcchhHHHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          132 LKLLVLVLEVIKGKHPRDFLCSILSSSLTKD-VALDEMLDPRLPTSSCSVQEKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       132 l~g~~p~~~~l~g~~p~~~~~~~~~~~~~~~-~~~~~~l~~~lp~~~~~~~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      +++.|-.++.++|.+|..-...     .... ....+...+.+|....   ..+..++..   |=..+|.+||++.+++.
T Consensus       230 ySFgIvlWEl~t~~~Pf~~~~~-----~~~~~~v~~~~~Rp~~p~~~~---~~l~~l~~~---CW~~dp~~RP~f~ei~~  298 (362)
T KOG0192|consen  230 YSFGIVLWELLTGEIPFEDLAP-----VQVASAVVVGGLRPPIPKECP---PHLSSLMER---CWLVDPSRRPSFLEIVS  298 (362)
T ss_pred             hhHHHHHHHHHHCCCCCCCCCH-----HHHHHHHHhcCCCCCCCccCC---HHHHHHHHH---hCCCCCCcCCCHHHHHH
Confidence            3344444677777777643221     0111 1112444555666533   444445554   99999999999999999


Q ss_pred             Hhc
Q 035742          211 QLQ  213 (214)
Q Consensus       211 ~L~  213 (214)
                      +|+
T Consensus       299 ~l~  301 (362)
T KOG0192|consen  299 RLE  301 (362)
T ss_pred             HHH
Confidence            986


No 118
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=77.65  E-value=2  Score=34.82  Aligned_cols=26  Identities=15%  Similarity=0.377  Sum_probs=21.9

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+...|...+|.+||+|.+|++.|+
T Consensus       278 ~~li~~cl~~~p~~RPs~~~i~~~l~  303 (304)
T cd05096         278 YELMLQCWSRDCRERPSFSDIHAFLT  303 (304)
T ss_pred             HHHHHHHccCCchhCcCHHHHHHHHh
Confidence            34445599999999999999999886


No 119
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=76.93  E-value=3.3  Score=32.77  Aligned_cols=26  Identities=15%  Similarity=0.354  Sum_probs=21.5

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      .....|...+|.+||++.++.+.|++
T Consensus       239 ~li~~c~~~~p~~RP~~~~i~~~l~~  264 (266)
T cd05064         239 QLMLDCWQKERGERPRFSQIHSILSK  264 (266)
T ss_pred             HHHHHHcCCCchhCCCHHHHHHHHHh
Confidence            33345999999999999999998863


No 120
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=76.91  E-value=1.9  Score=33.83  Aligned_cols=26  Identities=19%  Similarity=0.512  Sum_probs=21.9

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      .+...|...+|.+||++.+|.++|++
T Consensus       229 ~li~~cl~~~p~~Rp~~~~l~~~l~~  254 (257)
T cd05060         229 SIMLSCWKYRPEDRPTFSELESTFRR  254 (257)
T ss_pred             HHHHHHhcCChhhCcCHHHHHHHHHh
Confidence            44445999999999999999999863


No 121
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological 
Probab=76.63  E-value=3.7  Score=32.48  Aligned_cols=27  Identities=22%  Similarity=0.379  Sum_probs=22.6

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ..+...|.+.+|.+||++.++.++|+.
T Consensus       251 ~~li~~~l~~~p~~Rpt~~~l~~~l~~  277 (277)
T cd05032         251 LELMRMCWQYNPKMRPTFLEIVSSLKD  277 (277)
T ss_pred             HHHHHHHcCCChhhCCCHHHHHHHhcC
Confidence            444455999999999999999999873


No 122
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu
Probab=76.54  E-value=3.4  Score=32.53  Aligned_cols=26  Identities=23%  Similarity=0.622  Sum_probs=21.5

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ......|...+|.+||++.+|++.|+
T Consensus       245 ~~li~~~l~~~p~~Rp~~~e~~~~l~  270 (273)
T cd05035         245 YDLMYSCWRADPKDRPTFTKLREVLE  270 (273)
T ss_pred             HHHHHHHcCCChhhCcCHHHHHHHHH
Confidence            33334499999999999999999886


No 123
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=76.22  E-value=2.2  Score=33.26  Aligned_cols=30  Identities=30%  Similarity=0.599  Sum_probs=23.7

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ..+.+++.   .|...+|.+||++.+|.+.|++
T Consensus       222 ~~~~~li~---~~l~~~p~~Rp~~~ell~~l~~  251 (251)
T cd05041         222 EEIYRLML---QCWAYDPENRPSFSEIYNELQI  251 (251)
T ss_pred             HHHHHHHH---HHhccChhhCcCHHHHHHHhhC
Confidence            44444444   4999999999999999999874


No 124
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=76.03  E-value=2.5  Score=33.20  Aligned_cols=27  Identities=22%  Similarity=0.374  Sum_probs=22.5

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ......|...+|.+||++.++.++|+.
T Consensus       234 ~~li~~~l~~~p~~Rp~~~~i~~~l~~  260 (261)
T cd05072         234 YDIMKTCWKEKAEERPTFDYLQSVLDD  260 (261)
T ss_pred             HHHHHHHccCCcccCcCHHHHHHHHhc
Confidence            344555999999999999999999863


No 125
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=75.90  E-value=3.1  Score=32.55  Aligned_cols=26  Identities=19%  Similarity=0.500  Sum_probs=21.9

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      .....|...+|..||++++|++.|++
T Consensus       228 ~li~~~l~~~p~~Rp~~~~l~~~l~~  253 (254)
T cd05083         228 VLMTSCWETEPKKRPSFHKLREKLEK  253 (254)
T ss_pred             HHHHHHcCCChhhCcCHHHHHHHHcc
Confidence            33345999999999999999999874


No 126
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=75.50  E-value=2.2  Score=33.75  Aligned_cols=27  Identities=15%  Similarity=0.364  Sum_probs=22.5

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ..+...|...+|.+||+|.+|..+|++
T Consensus       241 ~~li~~~l~~~p~~Rp~~~~i~~~l~~  267 (269)
T cd05065         241 HQLMLDCWQKDRNARPKFGQIVSTLDK  267 (269)
T ss_pred             HHHHHHHcCCChhhCcCHHHHHHHHHh
Confidence            344455999999999999999999863


No 127
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=75.16  E-value=3.2  Score=32.52  Aligned_cols=24  Identities=25%  Similarity=0.505  Sum_probs=20.8

Q ss_pred             HhhcccCCCCCCCCCHHHHHHHhc
Q 035742          190 VAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       190 ~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ....|...+|.+||++.+++++|+
T Consensus       231 li~~~l~~~p~~Rpt~~~l~~~l~  254 (256)
T cd05082         231 VMKQCWHLDAATRPSFLQLREQLE  254 (256)
T ss_pred             HHHHHhcCChhhCcCHHHHHHHHh
Confidence            334599999999999999999986


No 128
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=74.79  E-value=2.4  Score=33.29  Aligned_cols=27  Identities=26%  Similarity=0.671  Sum_probs=22.2

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      +..+...|...+|.+||+|.+|.++|.
T Consensus       230 ~~~li~~cl~~~p~~Rpt~~~~l~~l~  256 (256)
T cd05059         230 VYTIMYSCWHEKPEDRPAFKKLLSQLT  256 (256)
T ss_pred             HHHHHHHHhcCChhhCcCHHHHHHHhC
Confidence            344555599999999999999999873


No 129
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It 
Probab=74.78  E-value=2.5  Score=33.64  Aligned_cols=25  Identities=28%  Similarity=0.436  Sum_probs=21.3

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .+...|...+|.+||++.+|+++|+
T Consensus       250 ~li~~~l~~~p~~Rps~~~~~~~l~  274 (280)
T cd05043         250 AVMACCWALDPEERPSFSQLVQCLT  274 (280)
T ss_pred             HHHHHHcCCChhhCCCHHHHHHHHH
Confidence            3444599999999999999999986


No 130
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=74.65  E-value=2.8  Score=32.94  Aligned_cols=26  Identities=23%  Similarity=0.533  Sum_probs=21.9

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+...|...+|.+||+++++.+.|+
T Consensus       233 ~~li~~~l~~~p~~Rpt~~~l~~~l~  258 (260)
T cd05070         233 HELMLQCWKKDPEERPTFEYLQSFLE  258 (260)
T ss_pred             HHHHHHHcccCcccCcCHHHHHHHHh
Confidence            34445599999999999999999886


No 131
>KOG3864 consensus Uncharacterized conserved protein [Function unknown]
Probab=74.18  E-value=0.79  Score=35.52  Aligned_cols=81  Identities=11%  Similarity=0.113  Sum_probs=47.8

Q ss_pred             CeEEEEecCCCCccccCccccCCCCCCcEEeCcCCcCc-CCChhhhh-CCcccceeecccc-ccccCCCccccccccchh
Q 035742           48 RVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFL-GTIPSQIG-NLSKLSYISLQSN-QLSGKIPLEVGLLTHLKV  124 (214)
Q Consensus        48 ~L~~L~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~-~~~p~~~~-~l~~L~~L~ls~N-~l~g~~p~~~~~l~~L~~  124 (214)
                      .++.++-++..|... .-..+.+++.++.|.+.++.-- ..--..++ -.++|+.|+++.| +|+..--..+.++++|+.
T Consensus       102 ~IeaVDAsds~I~~e-Gle~L~~l~~i~~l~l~~ck~~dD~~L~~l~~~~~~L~~L~lsgC~rIT~~GL~~L~~lknLr~  180 (221)
T KOG3864|consen  102 KIEAVDASDSSIMYE-GLEHLRDLRSIKSLSLANCKYFDDWCLERLGGLAPSLQDLDLSGCPRITDGGLACLLKLKNLRR  180 (221)
T ss_pred             eEEEEecCCchHHHH-HHHHHhccchhhhheeccccchhhHHHHHhcccccchheeeccCCCeechhHHHHHHHhhhhHH
Confidence            467777777777632 2245666777777777766422 11111222 3467888888865 455333345667777777


Q ss_pred             hhccc
Q 035742          125 LHFQF  129 (214)
Q Consensus       125 L~l~~  129 (214)
                      |.+.+
T Consensus       181 L~l~~  185 (221)
T KOG3864|consen  181 LHLYD  185 (221)
T ss_pred             HHhcC
Confidence            77654


No 132
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=73.71  E-value=6.3  Score=30.63  Aligned_cols=22  Identities=18%  Similarity=0.306  Sum_probs=17.9

Q ss_pred             HhhcccCCCCCCCCCHHHHHHH
Q 035742          190 VAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       190 ~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      .-..|...+|.+||+|.+++..
T Consensus       232 ~i~~~l~~~p~~Rp~~~~ll~~  253 (256)
T cd08529         232 LIDQCLTKDYRQRPDTFQLLRN  253 (256)
T ss_pred             HHHHHccCCcccCcCHHHHhhC
Confidence            3334999999999999999763


No 133
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan
Probab=73.47  E-value=3.2  Score=32.29  Aligned_cols=26  Identities=23%  Similarity=0.566  Sum_probs=21.4

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+...|++.+|.+||++.++.+.|+
T Consensus       237 ~~li~~~l~~~p~~Rps~~~l~~~l~  262 (262)
T cd00192         237 YELMLSCWQLDPEDRPTFSELVERLE  262 (262)
T ss_pred             HHHHHHHccCCcccCcCHHHHHHhhC
Confidence            33444599999999999999999875


No 134
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=73.46  E-value=3.6  Score=32.13  Aligned_cols=25  Identities=28%  Similarity=0.616  Sum_probs=21.3

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .+...|.+.+|.+||++.+|++.|.
T Consensus       232 ~li~~~l~~~p~~Rps~~~~~~~l~  256 (257)
T cd05040         232 NVMLQCWAHNPADRPTFAALREFLP  256 (257)
T ss_pred             HHHHHHCCCCcccCCCHHHHHHHhc
Confidence            3444599999999999999999885


No 135
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l
Probab=73.24  E-value=2.8  Score=33.27  Aligned_cols=27  Identities=22%  Similarity=0.517  Sum_probs=22.6

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      +..+...|...+|.+||++.+++.+|+
T Consensus       240 ~~~li~~~l~~~p~~Rps~~~il~~l~  266 (270)
T cd05047         240 VYDLMRQCWREKPYERPSFAQILVSLN  266 (270)
T ss_pred             HHHHHHHHcccChhhCCCHHHHHHHHH
Confidence            345555599999999999999999986


No 136
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]
Probab=73.17  E-value=2.5  Score=34.57  Aligned_cols=43  Identities=28%  Similarity=0.461  Sum_probs=25.0

Q ss_pred             ccCCCCCCcEEeCcCCcCcCCChhhh----hCCcccceeeccccccc
Q 035742           67 SFSSFPQLVHLDLSLNGFLGTIPSQI----GNLSKLSYISLQSNQLS  109 (214)
Q Consensus        67 ~~~~l~~L~~L~l~~n~l~~~~p~~~----~~l~~L~~L~ls~N~l~  109 (214)
                      .+.++++|+..+||.|.|.-..|+.+    ...+.|.+|.+++|.+.
T Consensus        87 aLlkcp~l~~v~LSDNAfg~~~~e~L~d~is~~t~l~HL~l~NnGlG  133 (388)
T COG5238          87 ALLKCPRLQKVDLSDNAFGSEFPEELGDLISSSTDLVHLKLNNNGLG  133 (388)
T ss_pred             HHhcCCcceeeeccccccCcccchHHHHHHhcCCCceeEEeecCCCC
Confidence            34456666666666666655555433    33455666666666553


No 137
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=72.69  E-value=2.6  Score=34.12  Aligned_cols=25  Identities=24%  Similarity=0.485  Sum_probs=21.2

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .....|...+|.+||+|.+|+++|+
T Consensus       270 ~li~~cl~~~p~~Rps~~e~l~~l~  294 (304)
T cd05101         270 MMMRDCWHAIPSHRPTFKQLVEDLD  294 (304)
T ss_pred             HHHHHHcccChhhCCCHHHHHHHHH
Confidence            3444599999999999999999986


No 138
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=72.58  E-value=3.7  Score=32.68  Aligned_cols=25  Identities=24%  Similarity=0.594  Sum_probs=21.4

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .....|+..+|.+||++.+|.+.|+
T Consensus       252 ~~i~~cl~~~p~~Rps~~~vl~~l~  276 (277)
T cd05036         252 RIMTDCWQHTPEDRPNFATILERIQ  276 (277)
T ss_pred             HHHHHHcCCCcccCcCHHHHHHHhh
Confidence            3444599999999999999999886


No 139
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a
Probab=72.42  E-value=3.7  Score=32.19  Aligned_cols=25  Identities=28%  Similarity=0.509  Sum_probs=21.3

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..-..|...+|.+||++.+|.++|+
T Consensus       239 ~~i~~cl~~~p~~Rp~~~~il~~~~  263 (267)
T cd08224         239 DLVSRCINPDPEKRPDISYVLQVAK  263 (267)
T ss_pred             HHHHHHcCCCcccCCCHHHHHHHHH
Confidence            3344599999999999999999986


No 140
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac
Probab=72.01  E-value=3.1  Score=32.87  Aligned_cols=28  Identities=25%  Similarity=0.582  Sum_probs=23.4

Q ss_pred             HHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          186 SIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       186 ~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .+..+...|...+|..||++.+|.+.|+
T Consensus       243 ~~~~l~~~~l~~~p~~Rps~~~~~~~l~  270 (273)
T cd05074         243 DVYELMCQCWSPEPKCRPSFQHLRDQLE  270 (273)
T ss_pred             HHHHHHHHHcCCChhhCcCHHHHHHHHH
Confidence            3445555699999999999999999986


No 141
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=71.95  E-value=2.6  Score=35.61  Aligned_cols=30  Identities=40%  Similarity=0.619  Sum_probs=23.5

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ..+.+++.   .|...+|.+||++.+|+++|++
T Consensus       342 ~~l~~li~---~cl~~dp~~RPs~~~l~~~l~~  371 (374)
T cd05106         342 PEIYSIMK---MCWNLEPTERPTFSQISQLIQR  371 (374)
T ss_pred             HHHHHHHH---HHcCCChhhCcCHHHHHHHHHH
Confidence            34444444   4999999999999999999873


No 142
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk 
Probab=71.67  E-value=3.4  Score=32.34  Aligned_cols=24  Identities=33%  Similarity=0.606  Sum_probs=20.7

Q ss_pred             HhhcccCCCCCCCCCHHHHHHHhc
Q 035742          190 VAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       190 ~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .-..|+..+|.+||++.++.++|+
T Consensus       231 li~~~l~~~p~~Rp~~~~l~~~l~  254 (256)
T cd05039         231 VMKDCWELDPAKRPTFKQLREQLA  254 (256)
T ss_pred             HHHHHhccChhhCcCHHHHHHHHh
Confidence            333499999999999999999986


No 143
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=71.44  E-value=3.4  Score=33.56  Aligned_cols=25  Identities=24%  Similarity=0.501  Sum_probs=21.3

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .+...|...+|.+||+|.+|+++|+
T Consensus       273 ~li~~~l~~~p~~Rps~~evl~~l~  297 (307)
T cd05098         273 MMMRDCWHAVPSQRPTFKQLVEDLD  297 (307)
T ss_pred             HHHHHHcccChhhCcCHHHHHHHHH
Confidence            3444599999999999999999985


No 144
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=71.30  E-value=3.9  Score=32.67  Aligned_cols=26  Identities=19%  Similarity=0.339  Sum_probs=21.8

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ......|...+|.+||++.++.++|+
T Consensus       241 ~~li~~c~~~~p~~Rps~~el~~~l~  266 (279)
T cd05111         241 YMVMVKCWMIDENVRPTFKELANEFT  266 (279)
T ss_pred             HHHHHHHcCCCcccCcCHHHHHHHHH
Confidence            34445699999999999999999875


No 145
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type.
Probab=71.26  E-value=3.7  Score=20.77  Aligned_cols=13  Identities=46%  Similarity=0.381  Sum_probs=7.5

Q ss_pred             CCcEEeCcCCcCc
Q 035742           73 QLVHLDLSLNGFL   85 (214)
Q Consensus        73 ~L~~L~l~~n~l~   85 (214)
                      .|+.|+|++|.|.
T Consensus         3 ~L~~LdL~~N~i~   15 (28)
T smart00368        3 SLRELDLSNNKLG   15 (28)
T ss_pred             ccCEEECCCCCCC
Confidence            4556666666553


No 146
>smart00750 KIND kinase non-catalytic C-lobe domain. It is an interaction domain identified as being similar to the C-terminal protein kinase catalytic fold (C lobe). Its presence at the N terminus of signalling proteins and the absence of the active-site residues in the catalytic and activation loops suggest that it folds independently and is likely to be non-catalytic. The occurrence of KIND only in metazoa implies that it has evolved from the catalytic protein kinase domain into an interaction domain possibly by keeping the substrate-binding features
Probab=71.26  E-value=6.9  Score=28.68  Aligned_cols=25  Identities=12%  Similarity=0.135  Sum_probs=20.2

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHh
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQL  212 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L  212 (214)
                      ...-..|...+|.+||++.++++.+
T Consensus       142 ~~~i~~cl~~~p~~Rp~~~~ll~~~  166 (176)
T smart00750      142 ADFMRVCASRLPQRREAANHYLAHC  166 (176)
T ss_pred             HHHHHHHHhcccccccCHHHHHHHH
Confidence            3344449999999999999998875


No 147
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto
Probab=71.10  E-value=3.2  Score=34.48  Aligned_cols=28  Identities=25%  Similarity=0.574  Sum_probs=23.3

Q ss_pred             HHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          186 SIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       186 ~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ++..+...|.+.+|.+||++.+|+++|+
T Consensus       304 ~~~~l~~~cl~~~p~~RPs~~ell~~l~  331 (337)
T cd05054         304 EIYSIMLDCWHNNPEDRPTFSELVEILG  331 (337)
T ss_pred             HHHHHHHHHccCChhhCcCHHHHHHHHH
Confidence            3445556699999999999999999986


No 148
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=70.75  E-value=6.7  Score=30.91  Aligned_cols=26  Identities=23%  Similarity=0.493  Sum_probs=21.9

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+...|...+|.+||++.++.++|+
T Consensus       233 ~~li~~~l~~~p~~Rp~~~~~~~~l~  258 (262)
T cd05071         233 HDLMCQCWRKEPEERPTFEYLQAFLE  258 (262)
T ss_pred             HHHHHHHccCCcccCCCHHHHHHHHH
Confidence            34444599999999999999999986


No 149
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=70.15  E-value=3.8  Score=33.27  Aligned_cols=26  Identities=23%  Similarity=0.553  Sum_probs=21.7

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      .....|...+|.+||++.+|+++|++
T Consensus       275 ~li~~cl~~~p~~Rpt~~ell~~l~~  300 (302)
T cd05055         275 DIMKTCWDADPLKRPTFKQIVQLIGK  300 (302)
T ss_pred             HHHHHHcCCCchhCcCHHHHHHHHHh
Confidence            34444999999999999999999864


No 150
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=69.98  E-value=4.5  Score=32.01  Aligned_cols=27  Identities=19%  Similarity=0.362  Sum_probs=22.5

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      ......|+..+|.+||++.++.++|+|
T Consensus       249 ~~~i~~~l~~~p~~Rp~~~~~l~~l~~  275 (275)
T cd05046         249 YKLMTRCWAVNPKDRPSFSELVSALGE  275 (275)
T ss_pred             HHHHHHHcCCCcccCCCHHHHHHHhcC
Confidence            344445999999999999999999875


No 151
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=69.80  E-value=4.1  Score=32.57  Aligned_cols=26  Identities=19%  Similarity=0.351  Sum_probs=21.9

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ......|.+.+|.+||++.+|++.|+
T Consensus       256 ~~li~~~l~~~p~~Rpt~~~il~~l~  281 (284)
T cd05079         256 YQLMRKCWEFQPSKRTTFQNLIEGFE  281 (284)
T ss_pred             HHHHHHHccCCcccCcCHHHHHHHHH
Confidence            34444599999999999999999886


No 152
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms]
Probab=69.35  E-value=8.9  Score=32.36  Aligned_cols=39  Identities=31%  Similarity=0.601  Sum_probs=30.2

Q ss_pred             hhcCCCCCCCcchhHHHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          167 EMLDPRLPTSSCSVQEKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       167 ~~l~~~lp~~~~~~~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      +.-.+++|...++  ..+..++..   |++.+|.+||+.+++.+
T Consensus       296 ~~ppP~lP~~~fS--~ef~~FV~~---CL~Kdp~~R~s~~qLl~  334 (364)
T KOG0581|consen  296 DEPPPRLPEGEFS--PEFRSFVSC---CLRKDPSERPSAKQLLQ  334 (364)
T ss_pred             cCCCCCCCcccCC--HHHHHHHHH---HhcCCcccCCCHHHHhc
Confidence            3345677777555  677778887   99999999999998764


No 153
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]
Probab=69.13  E-value=2.6  Score=34.93  Aligned_cols=37  Identities=30%  Similarity=0.284  Sum_probs=16.4

Q ss_pred             CCCCcEEeCcCC-cCcCCChhhhhCCcccceeeccccc
Q 035742           71 FPQLVHLDLSLN-GFLGTIPSQIGNLSKLSYISLQSNQ  107 (214)
Q Consensus        71 l~~L~~L~l~~n-~l~~~~p~~~~~l~~L~~L~ls~N~  107 (214)
                      .++|..|||+.| .++...-..|..++.|++|.++.+.
T Consensus       312 cp~l~~LDLSD~v~l~~~~~~~~~kf~~L~~lSlsRCY  349 (419)
T KOG2120|consen  312 CPNLVHLDLSDSVMLKNDCFQEFFKFNYLQHLSLSRCY  349 (419)
T ss_pred             CCceeeeccccccccCchHHHHHHhcchheeeehhhhc
Confidence            445555555533 2333333344444555555444443


No 154
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp
Probab=68.82  E-value=3.7  Score=34.08  Aligned_cols=26  Identities=23%  Similarity=0.524  Sum_probs=22.0

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ......|...+|.+||++.+|++.|+
T Consensus       312 ~~~~~~cl~~~p~~Rps~~eil~~l~  337 (343)
T cd05103         312 YQTMLDCWHGEPSQRPTFSELVEHLG  337 (343)
T ss_pred             HHHHHHHccCChhhCcCHHHHHHHHH
Confidence            44445699999999999999999886


No 155
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt
Probab=68.25  E-value=4.4  Score=32.35  Aligned_cols=26  Identities=27%  Similarity=0.569  Sum_probs=21.3

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+...|...+|.+||++.+|++.|.
T Consensus       249 ~~li~~cl~~~p~~Rps~~~il~~L~  274 (274)
T cd05076         249 ATLISQCLTYEPTQRPSFRTILRDLT  274 (274)
T ss_pred             HHHHHHHcccChhhCcCHHHHHHhhC
Confidence            33444599999999999999999873


No 156
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis.  Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase
Probab=68.24  E-value=4.9  Score=31.60  Aligned_cols=29  Identities=31%  Similarity=0.518  Sum_probs=22.9

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+.+++.   .|...+|.+||++.+|.+.|+
T Consensus       235 ~~~~~li~---~cl~~~p~~Rp~~~~vl~~~~  263 (267)
T cd08228         235 EKLRELVS---MCIYPDPDQRPDIGYVHQIAK  263 (267)
T ss_pred             HHHHHHHH---HHCCCCcccCcCHHHHHHHHH
Confidence            33444444   499999999999999999876


No 157
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti
Probab=68.15  E-value=5.7  Score=30.99  Aligned_cols=26  Identities=15%  Similarity=0.419  Sum_probs=19.7

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++..   |.+.+|.+||+|.+|++
T Consensus       227 ~~~~~li~~---~l~~~p~~Rp~~~~vl~  252 (256)
T cd08218         227 YDLRNLVSQ---LFKRNPRDRPSVNSILE  252 (256)
T ss_pred             HHHHHHHHH---HhhCChhhCcCHHHHhh
Confidence            334444444   88999999999999986


No 158
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=68.13  E-value=4.1  Score=33.23  Aligned_cols=25  Identities=24%  Similarity=0.505  Sum_probs=21.2

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .....|+..+|.+||++.+|.+.|+
T Consensus       267 ~li~~cl~~~p~~Rps~~~ll~~l~  291 (314)
T cd05099         267 MLMRECWHAVPTQRPTFKQLVEALD  291 (314)
T ss_pred             HHHHHHcCCCcccCcCHHHHHHHHH
Confidence            3444599999999999999999886


No 159
>smart00219 TyrKc Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily.
Probab=68.13  E-value=7  Score=30.30  Aligned_cols=24  Identities=29%  Similarity=0.607  Sum_probs=19.9

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHh
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQL  212 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L  212 (214)
                      .....|+..+|.+||++.++.++|
T Consensus       235 ~~i~~~l~~~p~~Rpt~~~ll~~l  258 (258)
T smart00219      235 KLMLQCWAEDPEDRPTFSELVEIL  258 (258)
T ss_pred             HHHHHHCcCChhhCcCHHHHHhhC
Confidence            344459999999999999999875


No 160
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho
Probab=68.05  E-value=6.9  Score=30.77  Aligned_cols=29  Identities=17%  Similarity=0.362  Sum_probs=23.1

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+.+++..   |...+|.+||++.+|.+.|+
T Consensus       225 ~~l~~li~~---c~~~~~~~Rp~~~~i~~~l~  253 (257)
T cd05115         225 PEMYALMKD---CWIYKWEDRPNFAKVEERMR  253 (257)
T ss_pred             HHHHHHHHH---HcCCChhhCcCHHHHHHHHh
Confidence            444444444   99999999999999999986


No 161
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=67.71  E-value=12  Score=29.64  Aligned_cols=23  Identities=30%  Similarity=0.544  Sum_probs=18.7

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..-..|...+|.+||+|.+|+..
T Consensus       231 ~li~~~l~~~p~~Rp~~~~il~~  253 (277)
T cd06642         231 EFVEACLNKDPRFRPTAKELLKH  253 (277)
T ss_pred             HHHHHHccCCcccCcCHHHHHHh
Confidence            33445999999999999999863


No 162
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=67.44  E-value=6.6  Score=30.55  Aligned_cols=23  Identities=30%  Similarity=0.361  Sum_probs=18.6

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      .+...|+..+|.+||+|.+|++.
T Consensus       240 ~l~~~~l~~~p~~Rp~~~~il~~  262 (265)
T cd08217         240 EVIKSMLNVDPDKRPSTEELLQL  262 (265)
T ss_pred             HHHHHHccCCcccCCCHHHHhhC
Confidence            34445999999999999999863


No 163
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=66.82  E-value=8.3  Score=30.84  Aligned_cols=23  Identities=26%  Similarity=0.449  Sum_probs=18.8

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHH
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ...-..|+..+|.+||+|.+|+.
T Consensus       243 ~~li~~~l~~~p~~Rpt~~eil~  265 (287)
T cd06621         243 KDFIKQCLEKDPTRRPTPWDMLE  265 (287)
T ss_pred             HHHHHHHcCCCcccCCCHHHHHh
Confidence            34445599999999999999976


No 164
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=65.99  E-value=5.3  Score=31.32  Aligned_cols=26  Identities=27%  Similarity=0.488  Sum_probs=21.7

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ......|...+|.+||++.++.+.|+
T Consensus       233 ~~li~~~l~~~p~~Rp~~~~l~~~l~  258 (260)
T cd05067         233 YELMRLCWKEKPEERPTFEYLRSVLE  258 (260)
T ss_pred             HHHHHHHccCChhhCCCHHHHHHHhh
Confidence            34444599999999999999999986


No 165
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=64.91  E-value=5.3  Score=32.20  Aligned_cols=25  Identities=28%  Similarity=0.557  Sum_probs=21.0

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .....|...+|.+||++.+|+++|+
T Consensus       249 ~li~~~l~~~p~~Rp~~~~i~~~l~  273 (297)
T cd05089         249 ELMRQCWRDRPYERPPFAQISVQLS  273 (297)
T ss_pred             HHHHHHcCCChhhCcCHHHHHHHHH
Confidence            4444599999999999999998875


No 166
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=64.69  E-value=6.2  Score=30.88  Aligned_cols=26  Identities=23%  Similarity=0.576  Sum_probs=21.6

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ......|+..+|.+||+++++.+.|+
T Consensus       234 ~~~i~~~l~~~p~~Rp~~~~l~~~l~  259 (261)
T cd05034         234 YDLMLQCWDKDPEERPTFEYLQSFLE  259 (261)
T ss_pred             HHHHHHHcccCcccCCCHHHHHHHHh
Confidence            34444599999999999999999886


No 167
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=64.12  E-value=5  Score=33.05  Aligned_cols=26  Identities=23%  Similarity=0.501  Sum_probs=21.9

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+...|...+|.+||+|.++++.|+
T Consensus       266 ~~li~~cl~~~p~~Rps~~ell~~l~  291 (334)
T cd05100         266 YMIMRECWHAVPSQRPTFKQLVEDLD  291 (334)
T ss_pred             HHHHHHHcccChhhCcCHHHHHHHHH
Confidence            34445599999999999999999886


No 168
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=63.78  E-value=13  Score=28.98  Aligned_cols=28  Identities=21%  Similarity=0.540  Sum_probs=21.5

Q ss_pred             HHHHHHHHHHhhcccCCCCCCCCCHHHHHHH
Q 035742          181 QEKLISIMGVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       181 ~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ...+.+++..   |+..+|.+||++.++++.
T Consensus       229 ~~~l~~li~~---~l~~~p~~R~~~~~ll~~  256 (264)
T cd06623         229 SPEFRDFISA---CLQKDPKKRPSAAELLQH  256 (264)
T ss_pred             CHHHHHHHHH---HccCChhhCCCHHHHHhC
Confidence            3455555555   889999999999999863


No 169
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=63.38  E-value=6.7  Score=30.77  Aligned_cols=25  Identities=24%  Similarity=0.598  Sum_probs=21.3

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..-..|.+.+|.+||++.+|.++|+
T Consensus       234 ~~i~~~l~~~p~~Rp~~~~l~~~L~  258 (260)
T cd05073         234 NIMMRCWKNRPEERPTFEYIQSVLD  258 (260)
T ss_pred             HHHHHHcccCcccCcCHHHHHHHHh
Confidence            3344599999999999999999986


No 170
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=63.34  E-value=9.2  Score=30.13  Aligned_cols=29  Identities=31%  Similarity=0.549  Sum_probs=23.2

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+.+++.   .|...+|.+||++.++.++|+
T Consensus       235 ~~~~~li~---~~l~~~P~~Rpt~~~~~~~l~  263 (270)
T cd05056         235 PTLYSLMT---KCWAYDPSKRPRFTELKAQLS  263 (270)
T ss_pred             HHHHHHHH---HHcCCChhhCcCHHHHHHHHH
Confidence            44455444   499999999999999999886


No 171
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=62.20  E-value=6.4  Score=30.67  Aligned_cols=26  Identities=19%  Similarity=0.511  Sum_probs=21.3

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ...-..|...+|.+||++.+|.++|.
T Consensus       234 ~~li~~~l~~~p~~Rpt~~~il~~l~  259 (259)
T cd05037         234 ANLINQCWTYDPTKRPSFRAILRDLN  259 (259)
T ss_pred             HHHHHHHhccChhhCCCHHHHHHhcC
Confidence            34444599999999999999999874


No 172
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage
Probab=61.74  E-value=9.4  Score=30.18  Aligned_cols=19  Identities=37%  Similarity=0.553  Sum_probs=16.2

Q ss_pred             ccCCCCCCCCCHHHHHHHhc
Q 035742          194 CLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       194 C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      |. .+|.+||++++|+++|.
T Consensus       249 c~-~~P~~Rp~~~~i~~~l~  267 (268)
T cd05086         249 CW-LSPEKRATAEEVHRLLT  267 (268)
T ss_pred             Hh-hCcccCCCHHHHHHHhc
Confidence            66 46999999999999874


No 173
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=61.38  E-value=15  Score=28.60  Aligned_cols=27  Identities=19%  Similarity=0.534  Sum_probs=20.3

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..+.+++..   |...+|.+||++.+++..
T Consensus       231 ~~~~~li~~---~l~~~p~~Rpt~~~ll~~  257 (265)
T cd06605         231 PDFQDFVNL---CLIKDPRERPSYKELLEH  257 (265)
T ss_pred             HHHHHHHHH---HcCCCchhCcCHHHHhhC
Confidence            344445444   999999999999998753


No 174
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=61.26  E-value=7  Score=31.64  Aligned_cols=27  Identities=19%  Similarity=0.367  Sum_probs=22.3

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      +......|...+|..||+|.+++.+|+
T Consensus       240 ~~~li~~c~~~~p~~Rp~~~~l~~~l~  266 (303)
T cd05110         240 VYMVMVKCWMIDADSRPKFKELAAEFS  266 (303)
T ss_pred             HHHHHHHHcCCChhhCcCHHHHHHHHH
Confidence            344555699999999999999999875


No 175
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=61.11  E-value=6  Score=33.92  Aligned_cols=29  Identities=21%  Similarity=0.416  Sum_probs=23.2

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+.+++.   .|...+|..||++++|+++|+
T Consensus       369 ~~l~~li~---~cl~~~P~~RPs~~ell~~L~  397 (401)
T cd05107         369 DEIYEIMQ---KCWEEKFEIRPDFSQLVHLVG  397 (401)
T ss_pred             HHHHHHHH---HHcCCChhHCcCHHHHHHHHH
Confidence            34444444   499999999999999999986


No 176
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=60.36  E-value=5.9  Score=33.96  Aligned_cols=27  Identities=22%  Similarity=0.565  Sum_probs=22.6

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      +..+...|...+|.+||++.+|+++|+
T Consensus       369 l~~li~~cl~~dP~~RPt~~~l~~~l~  395 (400)
T cd05105         369 VYDIMVKCWNSEPEKRPSFLHLSDIVE  395 (400)
T ss_pred             HHHHHHHHCccCHhHCcCHHHHHHHHH
Confidence            344555699999999999999999986


No 177
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.
Probab=60.05  E-value=10  Score=29.52  Aligned_cols=22  Identities=18%  Similarity=0.451  Sum_probs=18.0

Q ss_pred             HHhhcccCCCCCCCCCHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      .....|...+|.+||++++++.
T Consensus       232 ~li~~~l~~~p~~Rp~~~~~l~  253 (257)
T cd08223         232 ELIATMLSKRPEKRPSVKSILR  253 (257)
T ss_pred             HHHHHHhccCcccCCCHHHHhc
Confidence            3444499999999999999875


No 178
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms]
Probab=60.01  E-value=13  Score=29.99  Aligned_cols=29  Identities=28%  Similarity=0.457  Sum_probs=23.1

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      +.+.+++.-   |++.+|.+||+..++...++
T Consensus       270 e~l~~lik~---mlqvdP~qRP~i~~ll~~~d  298 (302)
T KOG2345|consen  270 EALHQLIKS---MLQVDPNQRPTIPELLSKLD  298 (302)
T ss_pred             HHHHHHHHH---HhcCCcccCCCHHHHHHHHH
Confidence            444455444   99999999999999998875


No 179
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=59.47  E-value=7.4  Score=31.52  Aligned_cols=26  Identities=23%  Similarity=0.497  Sum_probs=21.5

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+...|...+|.+||++.+++.+|+
T Consensus       253 ~~li~~~l~~~p~~Rp~~~~il~~l~  278 (303)
T cd05088         253 YDLMRQCWREKPYERPSFAQILVSLN  278 (303)
T ss_pred             HHHHHHHcCCChhhCcCHHHHHHHHH
Confidence            34445599999999999999998874


No 180
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom
Probab=59.07  E-value=7.5  Score=30.69  Aligned_cols=26  Identities=19%  Similarity=0.515  Sum_probs=21.0

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+-..|...+|.+||++.++.+++.
T Consensus       237 ~~li~~cl~~dp~~Rp~~~~il~~~~  262 (262)
T cd05077         237 ADLMTHCMNYDPNQRPFFRAIMRDIN  262 (262)
T ss_pred             HHHHHHHcCCChhhCcCHHHHHHhcC
Confidence            34444599999999999999998763


No 181
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells
Probab=58.07  E-value=11  Score=29.69  Aligned_cols=28  Identities=25%  Similarity=0.521  Sum_probs=20.4

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      +.+.++...   |. .+|.+||++.+|+.+|.
T Consensus       241 ~~~~~l~~~---c~-~~P~~Rpt~~~l~~~l~  268 (269)
T cd05087         241 DRWYEVMQF---CW-LQPEQRPSAEEVHLLLS  268 (269)
T ss_pred             hHHHHHHHH---Hh-cCcccCCCHHHHHHHhc
Confidence            344445543   65 47999999999999875


No 182
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=57.56  E-value=13  Score=29.00  Aligned_cols=28  Identities=36%  Similarity=0.521  Sum_probs=21.2

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHh
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQL  212 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L  212 (214)
                      ..+..++.   .|.+.+|.+||++.++++.+
T Consensus       227 ~~~~~~i~---~~l~~~p~~R~s~~~ll~~~  254 (256)
T cd08221         227 SELISLVH---SLLQQDPEKRPTADEVLDQP  254 (256)
T ss_pred             HHHHHHHH---HHcccCcccCCCHHHHhhCc
Confidence            44444444   49999999999999998764


No 183
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=57.28  E-value=21  Score=28.20  Aligned_cols=21  Identities=33%  Similarity=0.600  Sum_probs=17.7

Q ss_pred             HhhcccCCCCCCCCCHHHHHH
Q 035742          190 VAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       190 ~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ....|.+.+|..||+|++++.
T Consensus       232 ~i~~~l~~~p~~Rp~~~~~l~  252 (277)
T cd06641         232 FVEACLNKEPSFRPTAKELLK  252 (277)
T ss_pred             HHHHHccCChhhCcCHHHHHh
Confidence            334499999999999999986


No 184
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
Probab=55.67  E-value=22  Score=27.82  Aligned_cols=26  Identities=15%  Similarity=0.247  Sum_probs=19.9

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++.   .|...+|.+||++.+|.+
T Consensus       238 ~~~~~li~---~~l~~~p~~Rp~~~~il~  263 (267)
T cd06628         238 SEAIDFLE---KTFEIDHNKRPTAAELLK  263 (267)
T ss_pred             HHHHHHHH---HHccCCchhCcCHHHHhh
Confidence            44444554   489999999999999875


No 185
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=55.08  E-value=20  Score=28.19  Aligned_cols=19  Identities=32%  Similarity=0.662  Sum_probs=16.4

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|+..+|.+||+++++++
T Consensus       232 ~~~l~~~p~~Rpt~~~il~  250 (274)
T cd06609         232 SLCLNKDPKERPSAKELLK  250 (274)
T ss_pred             HHHhhCChhhCcCHHHHhh
Confidence            3489999999999999975


No 186
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.
Probab=54.71  E-value=14  Score=28.71  Aligned_cols=18  Identities=22%  Similarity=0.516  Sum_probs=16.0

Q ss_pred             cccCCCCCCCCCHHHHHH
Q 035742          193 PCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       193 ~C~~~~p~~Rp~m~~V~~  210 (214)
                      .|...+|.+||++.+|.+
T Consensus       236 ~~l~~~p~~Rpt~~~ll~  253 (257)
T cd08225         236 QLFKVSPRDRPSITSILK  253 (257)
T ss_pred             HHhccChhhCcCHHHHhh
Confidence            488889999999999975


No 187
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=54.68  E-value=10  Score=30.94  Aligned_cols=26  Identities=15%  Similarity=0.279  Sum_probs=21.6

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ......|...+|..||++.++...|.
T Consensus       241 ~~li~~cl~~~p~~Rps~~~l~~~l~  266 (316)
T cd05108         241 YMIMVKCWMIDADSRPKFRELIIEFS  266 (316)
T ss_pred             HHHHHHHccCChhhCcCHHHHHHHHH
Confidence            44445699999999999999998865


No 188
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms]
Probab=54.13  E-value=20  Score=29.89  Aligned_cols=33  Identities=21%  Similarity=0.520  Sum_probs=24.0

Q ss_pred             CCCCCcchhHHHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          172 RLPTSSCSVQEKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       172 ~lp~~~~~~~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      .+|..+   .....+++..   |+..+|.+||++.+..+
T Consensus       243 ~ip~~l---s~~a~~Fl~~---C~~~~p~~Rpta~eLL~  275 (313)
T KOG0198|consen  243 EIPDSL---SDEAKDFLRK---CFKRDPEKRPTAEELLE  275 (313)
T ss_pred             CCCccc---CHHHHHHHHH---HhhcCcccCcCHHHHhh
Confidence            555554   3444556666   99999999999998765


No 189
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=54.09  E-value=11  Score=29.94  Aligned_cols=26  Identities=12%  Similarity=0.308  Sum_probs=21.4

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ......|...+|.+||++.++.+.|+
T Consensus       241 ~~li~~~l~~dp~~Rp~~~~l~~~l~  266 (279)
T cd05109         241 YMIMVKCWMIDSECRPRFRELVDEFS  266 (279)
T ss_pred             HHHHHHHcCCChhhCcCHHHHHHHHH
Confidence            34444599999999999999998875


No 190
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]
Probab=53.97  E-value=1.1  Score=36.93  Aligned_cols=55  Identities=27%  Similarity=0.294  Sum_probs=22.7

Q ss_pred             CcEEeCcCCcCcCC-ChhhhhCCcccceeeccccccccCCCccccccccchhhhcc
Q 035742           74 LVHLDLSLNGFLGT-IPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHFQ  128 (214)
Q Consensus        74 L~~L~l~~n~l~~~-~p~~~~~l~~L~~L~ls~N~l~g~~p~~~~~l~~L~~L~l~  128 (214)
                      |+++||++..++.. +-.-+..+..|+.|.+.++++...+-..+.+-..|+.|+++
T Consensus       187 lq~lDLS~s~it~stl~~iLs~C~kLk~lSlEg~~LdD~I~~~iAkN~~L~~lnls  242 (419)
T KOG2120|consen  187 LQHLDLSNSVITVSTLHGILSQCSKLKNLSLEGLRLDDPIVNTIAKNSNLVRLNLS  242 (419)
T ss_pred             hHHhhcchhheeHHHHHHHHHHHHhhhhccccccccCcHHHHHHhccccceeeccc
Confidence            55555555444311 11123344444444444444444333333333334444333


No 191
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
Probab=53.86  E-value=11  Score=28.64  Aligned_cols=24  Identities=21%  Similarity=0.133  Sum_probs=19.4

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHH
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      +......|...+|.+||++.++++
T Consensus       217 ~~~~i~~~l~~~p~~Rp~~~~~~~  240 (244)
T smart00220      217 AKDLIRKLLVKDPEKRLTAEEALQ  240 (244)
T ss_pred             HHHHHHHHccCCchhccCHHHHhh
Confidence            344445599999999999999986


No 192
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=48.55  E-value=21  Score=28.06  Aligned_cols=20  Identities=20%  Similarity=0.483  Sum_probs=17.2

Q ss_pred             hhcccCCCCCCCCCHHHHHH
Q 035742          191 AFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       191 ~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ...|+..+|.+||++.+|+.
T Consensus       245 i~~~l~~~p~~Rpt~~~ll~  264 (268)
T cd06624         245 ILRCFEPDPDKRASAHDLLQ  264 (268)
T ss_pred             HHHHcCCCchhCCCHHHHHh
Confidence            34599999999999999875


No 193
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,  and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an
Probab=48.51  E-value=24  Score=27.28  Aligned_cols=23  Identities=17%  Similarity=0.225  Sum_probs=18.2

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHH
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+-..|+..+|.+||++.++.+
T Consensus       230 ~~li~~~l~~~p~~Rp~~~~~l~  252 (256)
T cd08530         230 QNFIRSMLQVKPKLRPNCDKILA  252 (256)
T ss_pred             HHHHHHHcCCCcccCCCHHHHhc
Confidence            33444599999999999999874


No 194
>TIGR00864 PCC polycystin cation channel protein. Note: this model has been restricted to the amino half because for technical reasons.
Probab=47.99  E-value=11  Score=39.88  Aligned_cols=32  Identities=28%  Similarity=0.339  Sum_probs=28.0

Q ss_pred             EecCCCCccccCccccCCCCCCcEEeCcCCcCc
Q 035742           53 SLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFL   85 (214)
Q Consensus        53 ~L~~n~l~g~~p~~~~~~l~~L~~L~l~~n~l~   85 (214)
                      ||++|+|+ .+|...|..+++|+.|+|++|.+.
T Consensus         1 DLSnN~Ls-tLp~g~F~~L~sL~~LdLsgNPw~   32 (2740)
T TIGR00864         1 DISNNKIS-TIEEGICANLCNLSEIDLSGNPFE   32 (2740)
T ss_pred             CCCCCcCC-ccChHHhccCCCceEEEeeCCccc
Confidence            58899999 777578999999999999999885


No 195
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=47.72  E-value=20  Score=27.80  Aligned_cols=19  Identities=26%  Similarity=0.511  Sum_probs=16.9

Q ss_pred             cccCCCCCCCCCHHHHHHH
Q 035742          193 PCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       193 ~C~~~~p~~Rp~m~~V~~~  211 (214)
                      .|...+|.+||++.++...
T Consensus       234 ~~l~~~P~~Rp~~~~il~~  252 (255)
T cd08219         234 QMFKRNPRSRPSATTILSR  252 (255)
T ss_pred             HHHhCCcccCCCHHHHhhc
Confidence            4899999999999999865


No 196
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=47.72  E-value=25  Score=27.85  Aligned_cols=23  Identities=30%  Similarity=0.499  Sum_probs=18.5

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHH
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ...-..|...+|.+||++.+|+.
T Consensus       230 ~~li~~~l~~~p~~Rp~~~~il~  252 (277)
T cd06640         230 KEFIDACLNKDPSFRPTAKELLK  252 (277)
T ss_pred             HHHHHHHcccCcccCcCHHHHHh
Confidence            34444599999999999999965


No 197
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=47.40  E-value=23  Score=27.21  Aligned_cols=26  Identities=31%  Similarity=0.567  Sum_probs=20.2

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++.   .|+..+|.+||++.+++.
T Consensus       231 ~~l~~~i~---~~l~~~p~~Rp~~~~ll~  256 (260)
T cd06606         231 EEAKDFLR---KCLRRDPKKRPTADELLQ  256 (260)
T ss_pred             HHHHHHHH---HhCcCChhhCCCHHHHhh
Confidence            44455554   499999999999999875


No 198
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification]
Probab=46.60  E-value=14  Score=33.14  Aligned_cols=11  Identities=36%  Similarity=0.513  Sum_probs=5.2

Q ss_pred             cccceeecccc
Q 035742           96 SKLSYISLQSN  106 (214)
Q Consensus        96 ~~L~~L~ls~N  106 (214)
                      +.|..|+|++|
T Consensus       244 pklk~L~LS~N  254 (585)
T KOG3763|consen  244 PKLKTLDLSHN  254 (585)
T ss_pred             chhheeecccc
Confidence            44444444444


No 199
>PF00069 Pkinase:  Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain;  InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=45.70  E-value=16  Score=28.34  Aligned_cols=26  Identities=23%  Similarity=0.474  Sum_probs=19.8

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++..   |+..+|.+||++.++++
T Consensus       231 ~~l~~li~~---~l~~~p~~R~~~~~l~~  256 (260)
T PF00069_consen  231 EELRDLIKK---MLSKDPEQRPSAEELLK  256 (260)
T ss_dssp             HHHHHHHHH---HSSSSGGGSTTHHHHHT
T ss_pred             HHHHHHHHH---HccCChhHCcCHHHHhc
Confidence            344444444   89999999999999875


No 200
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=45.28  E-value=35  Score=28.29  Aligned_cols=26  Identities=19%  Similarity=0.404  Sum_probs=20.1

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++..   |+..+|.+||++.+|++
T Consensus       302 ~~l~~li~~---~l~~~P~~Rpt~~ell~  327 (353)
T PLN00034        302 REFRHFISC---CLQREPAKRWSAMQLLQ  327 (353)
T ss_pred             HHHHHHHHH---HccCChhhCcCHHHHhc
Confidence            344455544   99999999999999875


No 201
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=45.04  E-value=14  Score=29.34  Aligned_cols=23  Identities=17%  Similarity=0.180  Sum_probs=18.5

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHH
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ......|.+.+|.+||++++|.+
T Consensus       257 ~~li~~~l~~~P~~Rpt~~~il~  279 (283)
T cd07835         257 LDLLSKMLVYDPAKRISAKAALQ  279 (283)
T ss_pred             HHHHHHHhcCChhhCcCHHHHhc
Confidence            34444599999999999999875


No 202
>PHA02882 putative serine/threonine kinase; Provisional
Probab=44.95  E-value=35  Score=27.41  Aligned_cols=29  Identities=7%  Similarity=0.133  Sum_probs=22.7

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+.++...   |...++.+||++.++.+.++
T Consensus       266 ~~~~~~~~~---~~~~~~~~rp~~~~l~~~~~  294 (294)
T PHA02882        266 KFIYDFIEC---VTKLSYEEKPDYDALIKIFD  294 (294)
T ss_pred             HHHHHHHHH---HHhCCCCCCCCHHHHHHhhC
Confidence            444555555   88899999999999998763


No 203
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=44.73  E-value=14  Score=29.45  Aligned_cols=22  Identities=32%  Similarity=0.513  Sum_probs=18.6

Q ss_pred             HhhcccCCCCCCCCCHHHHHHH
Q 035742          190 VAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       190 ~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ....|...+|.+||++.+|.++
T Consensus       245 li~~~l~~dp~~Rpt~~e~~~~  266 (284)
T cd06620         245 FVDACLLKDPTERPTPQQLCAM  266 (284)
T ss_pred             HHHHHhcCCcccCcCHHHHhcC
Confidence            3345999999999999999876


No 204
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=44.06  E-value=21  Score=28.01  Aligned_cols=27  Identities=19%  Similarity=0.431  Sum_probs=20.5

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..+.+++..   |...+|.+||++.++++-
T Consensus       239 ~~~~~li~~---~l~~~P~~Rp~~~~il~~  265 (267)
T cd06646         239 STFHNFVKI---SLTKNPKKRPTAERLLTH  265 (267)
T ss_pred             HHHHHHHHH---HhhCChhhCcCHHHHhcC
Confidence            344445444   899999999999998764


No 205
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with 
Probab=43.89  E-value=24  Score=27.26  Aligned_cols=19  Identities=26%  Similarity=0.536  Sum_probs=16.7

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|...+|.+||++.++..
T Consensus       234 ~~~l~~~p~~Rpt~~~ll~  252 (256)
T cd08220         234 LSMLNLDPSKRPQLSQIMA  252 (256)
T ss_pred             HHHccCChhhCCCHHHHhh
Confidence            3489999999999999875


No 206
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=43.70  E-value=21  Score=28.17  Aligned_cols=24  Identities=25%  Similarity=0.271  Sum_probs=19.6

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHH
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      +......|...+|.+||++++++.
T Consensus       256 ~~~li~~cl~~~p~~Rpt~~ei~~  279 (283)
T cd07830         256 AIDLIKDMLRWDPKKRPTASQALQ  279 (283)
T ss_pred             HHHHHHHhcccCcccCCCHHHHhh
Confidence            345555699999999999999975


No 207
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=43.28  E-value=17  Score=28.77  Aligned_cols=23  Identities=26%  Similarity=0.521  Sum_probs=18.4

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHH
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+...|...+|.+||+|.+++.
T Consensus       260 ~~li~~~l~~~P~~Rp~~~~il~  282 (286)
T cd07846         260 LDLAKQCLRIDPDDRPSSSQLLH  282 (286)
T ss_pred             HHHHHHHhcCCcccchhHHHHhc
Confidence            34444599999999999999874


No 208
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=42.95  E-value=21  Score=27.92  Aligned_cols=19  Identities=26%  Similarity=0.424  Sum_probs=16.7

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|+..+|.+||++.+|++
T Consensus       253 ~~~l~~dp~~Rpt~~~ll~  271 (275)
T cd06608         253 SECLIKNYEQRPFMEELLE  271 (275)
T ss_pred             HHHhhcChhhCcCHHHHhc
Confidence            3499999999999999975


No 209
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=42.75  E-value=22  Score=28.14  Aligned_cols=26  Identities=23%  Similarity=0.353  Sum_probs=21.3

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ...-..|...+|..||++.++.++|+
T Consensus       241 ~~~~~~~l~~~p~~Rp~~~~l~~~l~  266 (279)
T cd05057         241 YMVLVKCWMIDAESRPTFKELINEFS  266 (279)
T ss_pred             HHHHHHHcCCChhhCCCHHHHHHHHH
Confidence            34444699999999999999999875


No 210
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=42.29  E-value=21  Score=28.11  Aligned_cols=24  Identities=17%  Similarity=0.153  Sum_probs=19.3

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHH
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      +.+.-..|...+|.+||++.+++.
T Consensus       256 ~~~~i~~~l~~~P~~Rp~~~~ll~  279 (283)
T cd05118         256 ALDLLSQMLHYDPHKRITAEQALA  279 (283)
T ss_pred             HHHHHHHHhccCcccCcCHHHHhh
Confidence            344445599999999999999975


No 211
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=42.14  E-value=47  Score=25.75  Aligned_cols=27  Identities=11%  Similarity=0.220  Sum_probs=20.2

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..+.+++..   |...+|.+||++.++++.
T Consensus       234 ~~~~~li~~---~l~~~p~~Rpt~~~ll~~  260 (263)
T cd06625         234 PDARNFLRR---TFVENAKKRPSAEELLRH  260 (263)
T ss_pred             HHHHHHHHH---HhhcCcccCCCHHHHhhC
Confidence            344444444   899999999999999764


No 212
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=42.00  E-value=23  Score=28.08  Aligned_cols=23  Identities=26%  Similarity=0.416  Sum_probs=18.5

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      .+-..|...+|.+||++++|++-
T Consensus       261 ~li~~~l~~~p~~Rps~~ell~~  283 (286)
T cd06638         261 DFIRKCLTKDYEKRPTVSDLLQH  283 (286)
T ss_pred             HHHHHHccCCcccCCCHHHHhhc
Confidence            33344999999999999999864


No 213
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=41.91  E-value=34  Score=26.81  Aligned_cols=19  Identities=37%  Similarity=0.679  Sum_probs=16.1

Q ss_pred             ccCCCCCCCCCHHHHHHHhc
Q 035742          194 CLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       194 C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      |. .+|.+||++.+|.++|.
T Consensus       250 ~~-~dp~~Rpt~~~v~~~l~  268 (269)
T cd05042         250 CW-LDPETRPTAEEVHELLT  268 (269)
T ss_pred             Hh-cCcccccCHHHHHHHhc
Confidence            44 48999999999999874


No 214
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex 
Probab=41.78  E-value=26  Score=27.66  Aligned_cols=19  Identities=16%  Similarity=0.132  Sum_probs=16.3

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|.+.+|.+||++++++.
T Consensus       262 ~~~l~~~P~~Rpt~~~~l~  280 (284)
T cd07860         262 SQMLHYDPNKRISAKAALA  280 (284)
T ss_pred             HHhcCCCcccCCCHHHHhc
Confidence            3489999999999999874


No 215
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core 
Probab=41.60  E-value=22  Score=27.14  Aligned_cols=26  Identities=23%  Similarity=0.595  Sum_probs=19.9

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++..   |+..+|.+||++.+|.+
T Consensus       225 ~~~~~~i~~---~l~~~p~~R~t~~~~l~  250 (253)
T cd05122         225 DEFKDFLKK---CLQKNPEKRPTAEQLLK  250 (253)
T ss_pred             HHHHHHHHH---HccCChhhCCCHHHHhc
Confidence            444555544   99999999999999875


No 216
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both
Probab=40.58  E-value=30  Score=27.30  Aligned_cols=21  Identities=19%  Similarity=0.064  Sum_probs=17.3

Q ss_pred             HhhcccCCCCCCCCCHHHHHH
Q 035742          190 VAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       190 ~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      .-..|.+.+|.+||++.++..
T Consensus       263 li~~~l~~dp~~Rp~~~~il~  283 (287)
T cd07838         263 LLKKMLTFNPHKRISAFEALQ  283 (287)
T ss_pred             HHHHHhccCCccCCCHHHHhc
Confidence            334599999999999999864


No 217
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=40.02  E-value=22  Score=27.96  Aligned_cols=24  Identities=17%  Similarity=0.124  Sum_probs=19.4

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHH
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      +......|...+|.+||++.+|++
T Consensus       260 ~~~~i~~~l~~~P~~Rp~~~~~l~  283 (287)
T cd07840         260 ALDLLDKLLTLDPKKRISADQALQ  283 (287)
T ss_pred             HHHHHHHHcCCChhhCcCHHHHhh
Confidence            345555699999999999999875


No 218
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase. Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1 
Probab=39.96  E-value=25  Score=27.31  Aligned_cols=26  Identities=23%  Similarity=0.638  Sum_probs=19.9

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++..   |+..+|.+||++.++++
T Consensus       238 ~~~~~li~~---~l~~~p~~Rp~~~~ll~  263 (267)
T cd06610         238 KSFRKMISL---CLQKDPSKRPTAEELLK  263 (267)
T ss_pred             HHHHHHHHH---HcCCChhhCcCHHHHhh
Confidence            444445444   99999999999999875


No 219
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=39.57  E-value=43  Score=29.33  Aligned_cols=26  Identities=23%  Similarity=0.433  Sum_probs=19.6

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++..   |+..+|..||++.+++.
T Consensus       297 ~~~~~li~~---~L~~dP~~Rps~~~~l~  322 (478)
T PTZ00267        297 SGMKALLDP---LLSKNPALRPTTQQLLH  322 (478)
T ss_pred             HHHHHHHHH---HhccChhhCcCHHHHHh
Confidence            444444444   89999999999999864


No 220
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=39.48  E-value=23  Score=27.86  Aligned_cols=26  Identities=23%  Similarity=0.515  Sum_probs=19.6

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++.   .|...+|..||+|.+|+.
T Consensus       243 ~~~~~li~---~~l~~~p~~Rps~~~il~  268 (272)
T cd06629         243 PVALDFLN---ACFTINPDNRPTARELLQ  268 (272)
T ss_pred             HHHHHHHH---HHhcCChhhCCCHHHHhh
Confidence            44444444   489999999999999875


No 221
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4. Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.
Probab=39.29  E-value=33  Score=26.77  Aligned_cols=19  Identities=21%  Similarity=0.454  Sum_probs=16.3

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|+..+|.+||++.+|.+
T Consensus       243 ~~~l~~~p~~Rp~~~~~l~  261 (265)
T cd06631         243 TSCLTRDQHERPSALQLLR  261 (265)
T ss_pred             HHHhcCCcccCCCHHHHhc
Confidence            3499999999999999864


No 222
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=38.88  E-value=58  Score=26.44  Aligned_cols=20  Identities=30%  Similarity=0.592  Sum_probs=17.5

Q ss_pred             hcccCCCCCCCCCHHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..|++.+|..||++.+|.+.
T Consensus       258 ~~~l~~~p~~Rpt~~~il~~  277 (317)
T cd06635         258 DSCLQKIPQDRPTSEELLKH  277 (317)
T ss_pred             HHHccCCcccCcCHHHHHhC
Confidence            35999999999999999874


No 223
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=38.36  E-value=24  Score=28.90  Aligned_cols=25  Identities=24%  Similarity=0.534  Sum_probs=19.3

Q ss_pred             HHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          183 KLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       183 ~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      .+.+++..   |++.+|.+||++.+|++
T Consensus       282 ~~~~li~~---~l~~dP~~Rpt~~ell~  306 (327)
T cd08227         282 HFHHFVEQ---CLQRNPDARPSASTLLN  306 (327)
T ss_pred             HHHHHHHH---HHhhCchhcCCHHHHhc
Confidence            34444444   99999999999999975


No 224
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=38.21  E-value=25  Score=27.61  Aligned_cols=19  Identities=26%  Similarity=0.489  Sum_probs=16.6

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|...+|.+||++.+|++
T Consensus       250 ~~~l~~~p~~Rpt~~~il~  268 (272)
T cd06637         250 ESCLVKNHSQRPTTEQLMK  268 (272)
T ss_pred             HHHcCCChhhCCCHHHHhh
Confidence            3599999999999999875


No 225
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning 
Probab=38.20  E-value=20  Score=28.41  Aligned_cols=23  Identities=26%  Similarity=0.384  Sum_probs=18.4

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHH
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ......|...+|.+||++++|+.
T Consensus       262 ~~li~~~l~~~p~~Rps~~~il~  284 (288)
T cd07833         262 LDFLKACLRMDPKERLTCDELLQ  284 (288)
T ss_pred             HHHHHHHhccCchhcccHHHHhc
Confidence            34444599999999999999875


No 226
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=37.50  E-value=28  Score=27.65  Aligned_cols=27  Identities=19%  Similarity=0.220  Sum_probs=19.4

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..+.+++..   |+..+|.+||+++++++.
T Consensus       224 ~~~~~li~~---~L~~~P~~R~~~~~~~~~  250 (277)
T cd05607         224 EESKDICRL---FLAKKPEDRLGSREKNDD  250 (277)
T ss_pred             HHHHHHHHH---HhccCHhhCCCCccchhh
Confidence            444444444   999999999999776644


No 227
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=37.47  E-value=26  Score=28.02  Aligned_cols=23  Identities=17%  Similarity=0.148  Sum_probs=18.7

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..-..|...+|.+||++++|+..
T Consensus       260 ~li~~~l~~~P~~R~s~~e~l~~  282 (298)
T cd07841         260 DLLQRLLTLNPNKRITARQALEH  282 (298)
T ss_pred             HHHHHHhcCCcccCcCHHHHhhC
Confidence            33444999999999999999864


No 228
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 11 (Nek11) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek11 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek11 is involved, through direct phosphorylation, in regulating the degradation of Cdc25A (Cell Division Cycle 25 homolog A), which plays a role in cell cycle progression and in activating cyclin dependent kinases. Nek11 is activated by CHK1 (CHeckpoint Kinase 1) and may be involved in the G2/M check
Probab=37.45  E-value=43  Score=26.04  Aligned_cols=18  Identities=28%  Similarity=0.534  Sum_probs=15.8

Q ss_pred             cccCCCCCCCCCHHHHHH
Q 035742          193 PCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       193 ~C~~~~p~~Rp~m~~V~~  210 (214)
                      .|...+|.+||++.++..
T Consensus       239 ~~l~~~p~~Rp~~~~il~  256 (260)
T cd08222         239 SMLNKDPSLRPSAAEILR  256 (260)
T ss_pred             HHhcCChhhCcCHHHHhh
Confidence            488999999999999864


No 229
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=37.40  E-value=21  Score=27.68  Aligned_cols=29  Identities=14%  Similarity=0.261  Sum_probs=21.2

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..+..++..   |.+.+|.+||++++|.+.|+
T Consensus       228 ~~~~~~i~~---~l~~~p~~Rpt~~~~~~~l~  256 (265)
T cd05579         228 DEAIDLISK---LLVPDPEKRLGAKSIEEIKN  256 (265)
T ss_pred             HHHHHHHHH---HhcCCHhhcCCCccHHHHhc
Confidence            444445544   88999999999977776654


No 230
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=37.29  E-value=22  Score=28.09  Aligned_cols=18  Identities=17%  Similarity=0.159  Sum_probs=16.1

Q ss_pred             cccCCCCCCCCCHHHHHH
Q 035742          193 PCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       193 ~C~~~~p~~Rp~m~~V~~  210 (214)
                      .|++.+|.+||++.+|++
T Consensus       264 ~~l~~dP~~Rpt~~~ll~  281 (285)
T cd07861         264 KMLIYDPAKRISAKKALN  281 (285)
T ss_pred             HHhcCChhhCCCHHHHhc
Confidence            499999999999999874


No 231
>cd00180 PKc Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which
Probab=37.29  E-value=25  Score=25.67  Aligned_cols=28  Identities=18%  Similarity=0.358  Sum_probs=21.9

Q ss_pred             HHHHHHhhcccCCCCCCCCCHHHHHHHh
Q 035742          185 ISIMGVAFPCLNESPVSRPTMQTVSQQL  212 (214)
Q Consensus       185 ~~l~~~~l~C~~~~p~~Rp~m~~V~~~L  212 (214)
                      ..+......|...+|.+||++.++++.+
T Consensus       188 ~~~~~~l~~~l~~~p~~R~~~~~l~~~~  215 (215)
T cd00180         188 PELKDLIRKMLQKDPEKRPSAKEILEHL  215 (215)
T ss_pred             HHHHHHHHHHhhCCcccCcCHHHHhhCC
Confidence            3555556669999999999999998653


No 232
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=37.13  E-value=28  Score=26.96  Aligned_cols=22  Identities=32%  Similarity=0.543  Sum_probs=17.9

Q ss_pred             HHhhcccCCCCCCCCCHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..-..|...+|.+||++.+|+.
T Consensus       238 ~li~~~l~~~p~~Rpt~~~il~  259 (262)
T cd06613         238 DFIKKCLTKDPKKRPTATKLLQ  259 (262)
T ss_pred             HHHHHHcCCChhhCCCHHHHhc
Confidence            3344599999999999999875


No 233
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops
Probab=37.11  E-value=35  Score=26.33  Aligned_cols=18  Identities=33%  Similarity=0.671  Sum_probs=16.0

Q ss_pred             cccCCCCCCCCCHHHHHH
Q 035742          193 PCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       193 ~C~~~~p~~Rp~m~~V~~  210 (214)
                      .|...+|..||++.+++.
T Consensus       237 ~~l~~~p~~Rp~~~~~l~  254 (258)
T cd06632         237 KCLQRDPSLRPTAAELLE  254 (258)
T ss_pred             HHhhcCcccCcCHHHHhc
Confidence            488999999999999875


No 234
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.
Probab=36.78  E-value=27  Score=27.47  Aligned_cols=22  Identities=18%  Similarity=0.102  Sum_probs=17.7

Q ss_pred             HHhhcccCCCCCCCCCHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      .+-..|+..+|.+||++.++..
T Consensus       257 ~li~~~l~~~P~~R~~~~~~l~  278 (282)
T cd07831         257 DLLKKLLAYDPDERITAKQALR  278 (282)
T ss_pred             HHHHHHhccCcccccCHHHHhh
Confidence            3334499999999999999875


No 235
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=36.72  E-value=18  Score=28.34  Aligned_cols=18  Identities=17%  Similarity=0.407  Sum_probs=15.4

Q ss_pred             cccCCCCCCCCCHHHHHH
Q 035742          193 PCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       193 ~C~~~~p~~Rp~m~~V~~  210 (214)
                      .|...+|.+||+|++|.+
T Consensus       243 ~~~~~~p~~Rp~~~eil~  260 (266)
T cd06651         243 GCIFVEARHRPSAEELLR  260 (266)
T ss_pred             HHhcCChhhCcCHHHHhc
Confidence            477789999999999975


No 236
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms]
Probab=36.68  E-value=38  Score=29.96  Aligned_cols=31  Identities=32%  Similarity=0.697  Sum_probs=24.2

Q ss_pred             hHHHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          180 VQEKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       180 ~~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .+..+..+..   .|...+|..||+|.+|++.|+
T Consensus       388 ~p~~~~~~~~---~c~~~~p~~R~tm~~i~~~l~  418 (474)
T KOG0194|consen  388 TPKELAKVMK---QCWKKDPEDRPTMSTIKKKLE  418 (474)
T ss_pred             CHHHHHHHHH---HhccCChhhccCHHHHHHHHH
Confidence            3454455555   499999999999999999876


No 237
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=36.38  E-value=22  Score=27.53  Aligned_cols=19  Identities=32%  Similarity=0.537  Sum_probs=16.6

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|...+|.+||++.+|.+
T Consensus       234 ~~~l~~~P~~Rps~~~il~  252 (256)
T cd06612         234 KKCLVKDPEERPSAIQLLQ  252 (256)
T ss_pred             HHHHhcChhhCcCHHHHhc
Confidence            3499999999999999875


No 238
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=36.07  E-value=63  Score=25.40  Aligned_cols=26  Identities=19%  Similarity=0.400  Sum_probs=20.0

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+..++..   |...+|.+||++.+|.+
T Consensus       235 ~~l~~li~~---~l~~~p~~Rp~~~~il~  260 (283)
T cd06617         235 PEFQDFVNK---CLKKNYKERPNYPELLQ  260 (283)
T ss_pred             HHHHHHHHH---HccCChhhCcCHHHHhc
Confidence            444444444   99999999999999875


No 239
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=36.06  E-value=38  Score=29.93  Aligned_cols=26  Identities=19%  Similarity=0.377  Sum_probs=19.9

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++..   |+..+|.+||++.++.+
T Consensus       271 ~~l~~li~~---~L~~dP~~RPs~~ell~  296 (496)
T PTZ00283        271 PEMQEIVTA---LLSSDPKRRPSSSKLLN  296 (496)
T ss_pred             HHHHHHHHH---HcccChhhCcCHHHHHh
Confidence            444444444   89999999999999875


No 240
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=35.79  E-value=28  Score=27.66  Aligned_cols=22  Identities=14%  Similarity=0.110  Sum_probs=18.8

Q ss_pred             hcccCCCCCCCCCHHHHHHHhc
Q 035742          192 FPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      ..|...+|..||++++|.+.|+
T Consensus       244 ~~~l~~~p~~R~t~~~~~~~l~  265 (288)
T cd05583         244 QKLLEKDPKKRLGANGADEIKN  265 (288)
T ss_pred             HHHhcCCHhhccCcchHHHHhc
Confidence            3489999999999999988765


No 241
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the 
Probab=35.25  E-value=27  Score=28.10  Aligned_cols=24  Identities=17%  Similarity=0.115  Sum_probs=19.4

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHH
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      +...-..|+..+|.+||++.++++
T Consensus       289 ~~~~i~~~l~~~P~~Rps~~eil~  312 (316)
T cd07842         289 GFDLLRKLLEYDPTKRITAEEALE  312 (316)
T ss_pred             HHHHHHHHhcCCcccCcCHHHHhc
Confidence            445555699999999999999875


No 242
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=35.25  E-value=33  Score=27.65  Aligned_cols=20  Identities=25%  Similarity=0.576  Sum_probs=17.4

Q ss_pred             hcccCCCCCCCCCHHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..|...+|.+||+|.+|+..
T Consensus       248 ~~~l~~~p~~Rp~~~~il~~  267 (307)
T cd06607         248 DSCLQKIPQDRPSSEELLKH  267 (307)
T ss_pred             HHHhcCChhhCcCHHHHhcC
Confidence            35999999999999999863


No 243
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They 
Probab=34.87  E-value=45  Score=25.55  Aligned_cols=26  Identities=23%  Similarity=0.510  Sum_probs=19.7

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++.   .|...+|.+||++.++.+
T Consensus       229 ~~~~~~i~---~~l~~~p~~Rp~~~~ll~  254 (258)
T cd08215         229 SELRNLVS---SLLQKDPEERPSIAQILQ  254 (258)
T ss_pred             HHHHHHHH---HHcCCChhhCcCHHHHhc
Confidence            44444444   499999999999999875


No 244
>TIGR00864 PCC polycystin cation channel protein. Note: this model has been restricted to the amino half because for technical reasons.
Probab=34.64  E-value=29  Score=37.16  Aligned_cols=32  Identities=31%  Similarity=0.297  Sum_probs=26.7

Q ss_pred             eCcCCcCcCCChhhhhCCcccceeeccccccc
Q 035742           78 DLSLNGFLGTIPSQIGNLSKLSYISLQSNQLS  109 (214)
Q Consensus        78 ~l~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~  109 (214)
                      ||++|+|+-.-+..|..+++|+.|+|++|.+.
T Consensus         1 DLSnN~LstLp~g~F~~L~sL~~LdLsgNPw~   32 (2740)
T TIGR00864         1 DISNNKISTIEEGICANLCNLSEIDLSGNPFE   32 (2740)
T ss_pred             CCCCCcCCccChHHhccCCCceEEEeeCCccc
Confidence            68899999555556888999999999999875


No 245
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=34.20  E-value=29  Score=27.35  Aligned_cols=22  Identities=18%  Similarity=0.348  Sum_probs=17.8

Q ss_pred             HHhhcccCCCCCCCCCHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..-..|.+.+|.+||++.+++.
T Consensus       261 ~li~~~l~~~p~~Rp~~~eil~  282 (286)
T cd07847         261 SFLKGCLQMDPTERLSCEELLE  282 (286)
T ss_pred             HHHHHHhcCCccccCCHHHHhc
Confidence            3444599999999999999875


No 246
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=34.15  E-value=40  Score=27.63  Aligned_cols=26  Identities=15%  Similarity=0.438  Sum_probs=20.3

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++..   |...+|.+||++.++.+
T Consensus       275 ~~l~~li~~---~L~~~P~~Rpt~~ell~  300 (331)
T cd06649         275 PDFQEFVNK---CLIKNPAERADLKMLMN  300 (331)
T ss_pred             HHHHHHHHH---HccCCcccCCCHHHHhc
Confidence            344455555   99999999999999875


No 247
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]
Probab=32.71  E-value=14  Score=31.78  Aligned_cols=62  Identities=21%  Similarity=0.112  Sum_probs=29.4

Q ss_pred             CCCCCcEEeCcCCc-CcCCChhhhhC-Ccccceeeccccc-cccCC-Cccccccccchhhhccccc
Q 035742           70 SFPQLVHLDLSLNG-FLGTIPSQIGN-LSKLSYISLQSNQ-LSGKI-PLEVGLLTHLKVLHFQFNQ  131 (214)
Q Consensus        70 ~l~~L~~L~l~~n~-l~~~~p~~~~~-l~~L~~L~ls~N~-l~g~~-p~~~~~l~~L~~L~l~~N~  131 (214)
                      .+..|+.|++++.. ++...-..+.. +++|+.|.+.++. ++..- -.....+++|++|+++.+.
T Consensus       241 ~~~~L~~l~l~~~~~isd~~l~~l~~~c~~L~~L~l~~c~~lt~~gl~~i~~~~~~L~~L~l~~c~  306 (482)
T KOG1947|consen  241 ICRKLKSLDLSGCGLVTDIGLSALASRCPNLETLSLSNCSNLTDEGLVSIAERCPSLRELDLSGCH  306 (482)
T ss_pred             hcCCcCccchhhhhccCchhHHHHHhhCCCcceEccCCCCccchhHHHHHHHhcCcccEEeeecCc
Confidence            44566666666655 44332233332 5666666654444 22111 1112334556666666543


No 248
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=32.67  E-value=34  Score=27.29  Aligned_cols=27  Identities=15%  Similarity=0.207  Sum_probs=20.6

Q ss_pred             HHHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          181 QEKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       181 ~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      +..+.+++..   |...+|.+||++.+|+.
T Consensus       272 ~~~~~~li~~---~l~~~P~~Rp~~~~il~  298 (302)
T cd07864         272 PTPALDLLDH---MLTLDPSKRCTAEEALN  298 (302)
T ss_pred             CHHHHHHHHH---HccCChhhCCCHHHHhc
Confidence            3444555555   99999999999999875


No 249
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=32.61  E-value=34  Score=27.01  Aligned_cols=23  Identities=13%  Similarity=0.086  Sum_probs=18.3

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHH
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ...-..|+..+|.+||++++++.
T Consensus       259 ~~li~~~l~~~p~~R~~~~~~l~  281 (286)
T cd07832         259 LDLLKGLLVYDPSKRLSAAEALR  281 (286)
T ss_pred             HHHHHHHhccChhhCCCHHHHhh
Confidence            33444599999999999999875


No 250
>KOG4308 consensus LRR-containing protein [Function unknown]
Probab=32.59  E-value=2.2  Score=37.62  Aligned_cols=38  Identities=21%  Similarity=0.176  Sum_probs=17.1

Q ss_pred             cccceeeccccccccCCC----ccccccccchhhhcccccce
Q 035742           96 SKLSYISLQSNQLSGKIP----LEVGLLTHLKVLHFQFNQLK  133 (214)
Q Consensus        96 ~~L~~L~ls~N~l~g~~p----~~~~~l~~L~~L~l~~N~l~  133 (214)
                      ..++.++++.|.|+..-.    ..+..+..++.+.++.|.+.
T Consensus       262 ~~l~~l~l~~nsi~~~~~~~L~~~l~~~~~l~~l~l~~n~l~  303 (478)
T KOG4308|consen  262 ETLRVLDLSRNSITEKGVRDLAEVLVSCRQLEELSLSNNPLT  303 (478)
T ss_pred             hhhhhhhhhcCCccccchHHHHHHHhhhHHHHHhhcccCccc
Confidence            344555555555543222    22333344555555555443


No 251
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=31.71  E-value=59  Score=25.68  Aligned_cols=19  Identities=37%  Similarity=0.646  Sum_probs=16.5

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|+..+|..||++.++.+
T Consensus       243 ~~~l~~~p~~Rp~~~~l~~  261 (286)
T cd06622         243 AKCLNKIPNRRPTYAQLLE  261 (286)
T ss_pred             HHHcccCcccCCCHHHHhc
Confidence            3489999999999999875


No 252
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification]
Probab=31.54  E-value=28  Score=31.21  Aligned_cols=66  Identities=26%  Similarity=0.222  Sum_probs=42.0

Q ss_pred             CCCeEEEEecCCCCccccCc--cccCCCCCCcEEeCcCCcCcCCChhhhhC--CcccceeeccccccccCC
Q 035742           46 AGRVINISLRNTGLSGTLSD--FSFSSFPQLVHLDLSLNGFLGTIPSQIGN--LSKLSYISLQSNQLSGKI  112 (214)
Q Consensus        46 ~~~L~~L~L~~n~l~g~~p~--~~~~~l~~L~~L~l~~n~l~~~~p~~~~~--l~~L~~L~ls~N~l~g~~  112 (214)
                      ...+.+++|++|+|. .+..  .--...++|..|+|++|...-....++..  ...|++|.+.+|.+...+
T Consensus       217 ~p~i~sl~lsnNrL~-~Ld~~sslsq~apklk~L~LS~N~~~~~~~~el~K~k~l~Leel~l~GNPlc~tf  286 (585)
T KOG3763|consen  217 FPEILSLSLSNNRLY-HLDALSSLSQIAPKLKTLDLSHNHSKISSESELDKLKGLPLEELVLEGNPLCTTF  286 (585)
T ss_pred             Ccceeeeecccchhh-chhhhhHHHHhcchhheeecccchhhhcchhhhhhhcCCCHHHeeecCCccccch
Confidence            346889999999986 3320  12235689999999999322122223332  234889999999887443


No 253
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=31.00  E-value=33  Score=27.73  Aligned_cols=23  Identities=17%  Similarity=0.507  Sum_probs=18.5

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..-..|+..+|.+||++.+|...
T Consensus       265 ~li~~~l~~~P~~Rpt~~~ll~~  287 (308)
T cd06615         265 DFVDKCLKKNPKERADLKELTKH  287 (308)
T ss_pred             HHHHHHccCChhhCcCHHHHhcC
Confidence            33345999999999999998754


No 254
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=30.85  E-value=34  Score=27.25  Aligned_cols=23  Identities=17%  Similarity=0.277  Sum_probs=18.5

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHH
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+...|...+|.+||++.++.+
T Consensus       264 ~~li~~~l~~~p~~Rps~~~il~  286 (291)
T cd06639         264 NHFISQCLIKDFEARPSVTHLLE  286 (291)
T ss_pred             HHHHHHHhhcChhhCcCHHHHhc
Confidence            34444599999999999999875


No 255
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=30.75  E-value=32  Score=27.22  Aligned_cols=20  Identities=20%  Similarity=0.582  Sum_probs=16.9

Q ss_pred             hcccCCCCCCCCCHHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..|.+.+|.+||++.++.+.
T Consensus       234 ~~~l~~~P~~Rp~~~eil~~  253 (279)
T cd06619         234 TQCMRKQPKERPAPENLMDH  253 (279)
T ss_pred             HHHhhCChhhCCCHHHHhcC
Confidence            34999999999999998753


No 256
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs),  (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast 
Probab=30.58  E-value=42  Score=25.75  Aligned_cols=20  Identities=25%  Similarity=0.604  Sum_probs=16.7

Q ss_pred             hhcccCCCCCCCCCHHHHHH
Q 035742          191 AFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       191 ~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      -..|+..+|.+||++.+++.
T Consensus       231 i~~~l~~~p~~R~~~~~~l~  250 (254)
T cd06627         231 LMQCFQKDPNLRPTAKQLLK  250 (254)
T ss_pred             HHHHHhCChhhCcCHHHHhc
Confidence            34588999999999999874


No 257
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=30.45  E-value=35  Score=27.08  Aligned_cols=26  Identities=15%  Similarity=0.452  Sum_probs=20.1

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++.   .|...+|.+||++.+|..
T Consensus       241 ~~l~~li~---~~l~~~p~~Rpt~~~i~~  266 (288)
T cd06616         241 PSFVNFIN---LCLIKDESKRPKYKELLE  266 (288)
T ss_pred             HHHHHHHH---HHccCChhhCcCHHHHhc
Confidence            44444444   499999999999999875


No 258
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=30.35  E-value=39  Score=27.22  Aligned_cols=22  Identities=27%  Similarity=0.481  Sum_probs=18.0

Q ss_pred             HHhhcccCCCCCCCCCHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..-..|.+.+|.+||++.++.+
T Consensus       273 ~li~~~l~~~P~~Rpt~~~ll~  294 (314)
T cd08216         273 QFVELCLQRDPESRPSASQLLN  294 (314)
T ss_pred             HHHHHHhhcCCCcCcCHHHHhc
Confidence            3444599999999999999875


No 259
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=29.56  E-value=57  Score=26.81  Aligned_cols=25  Identities=16%  Similarity=0.454  Sum_probs=19.3

Q ss_pred             HHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          183 KLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       183 ~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      .+.+++.-   |+..+|.+||++.++..
T Consensus       274 ~~~~li~~---~L~~~P~~Rpt~~ell~  298 (333)
T cd06650         274 EFQDFVNK---CLIKNPAERADLKQLMV  298 (333)
T ss_pred             HHHHHHHH---hccCCcccCcCHHHHhh
Confidence            34444444   99999999999999864


No 260
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=29.41  E-value=49  Score=26.30  Aligned_cols=25  Identities=12%  Similarity=0.197  Sum_probs=19.0

Q ss_pred             HHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          183 KLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       183 ~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      .+.+++..   |...+|.+||++.++++
T Consensus       265 ~~~~li~~---~l~~~p~~R~t~~ell~  289 (293)
T cd07843         265 NGFDLLNR---LLTYDPAKRISAEDALK  289 (293)
T ss_pred             HHHHHHHH---HhccCccccCCHHHHhc
Confidence            33444444   89999999999999874


No 261
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the 
Probab=29.22  E-value=45  Score=26.15  Aligned_cols=23  Identities=13%  Similarity=0.196  Sum_probs=18.3

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHH
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ...-..|+..+|.+||++.+|+.
T Consensus       256 ~~~i~~~l~~~P~~Rp~~~~~l~  278 (282)
T cd07829         256 IDLLSKMLQYNPAKRISAKEALK  278 (282)
T ss_pred             HHHHHHhhccCcccCCCHHHHhh
Confidence            33444499999999999999875


No 262
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=29.10  E-value=47  Score=26.19  Aligned_cols=19  Identities=26%  Similarity=0.197  Sum_probs=16.4

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|+..+|.+||++.++.+
T Consensus       262 ~~~l~~~P~~R~t~~~il~  280 (284)
T cd07839         262 QNLLVCNPVQRISAEEALQ  280 (284)
T ss_pred             HHHhcCChhhcCCHHHHhc
Confidence            3499999999999999864


No 263
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=29.04  E-value=44  Score=25.92  Aligned_cols=19  Identities=37%  Similarity=0.602  Sum_probs=16.4

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|...+|.+||++.++..
T Consensus       242 ~~~l~~~p~~R~~~~~i~~  260 (264)
T cd06626         242 DRCLESDPKKRPTASELLQ  260 (264)
T ss_pred             HHHccCCcccCCCHHHHhc
Confidence            3599999999999999864


No 264
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes 
Probab=28.59  E-value=50  Score=26.15  Aligned_cols=24  Identities=21%  Similarity=0.288  Sum_probs=18.9

Q ss_pred             HHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          184 LISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       184 L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      +.+++..   |+..+|.+||++.++.+
T Consensus       260 ~~dll~~---~L~~~P~~R~s~~~~l~  283 (287)
T cd07848         260 LLDLMKN---LLKLNPTDRYLTEQCLN  283 (287)
T ss_pred             HHHHHHH---HccCCcccCCCHHHHhc
Confidence            4445544   99999999999998864


No 265
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=28.48  E-value=42  Score=26.75  Aligned_cols=21  Identities=19%  Similarity=0.172  Sum_probs=17.4

Q ss_pred             HhhcccCCCCCCCCCHHHHHH
Q 035742          190 VAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       190 ~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      .-..|...+|.+||++.++++
T Consensus       263 ~i~~~l~~~P~~Rps~~~~l~  283 (294)
T PLN00009        263 LLSKMLRLDPSKRITARAALE  283 (294)
T ss_pred             HHHHHccCChhhCcCHHHHhc
Confidence            333499999999999999875


No 266
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=28.38  E-value=37  Score=27.16  Aligned_cols=27  Identities=22%  Similarity=0.438  Sum_probs=20.4

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..+.+++.   .|...+|.+||++.+++..
T Consensus       247 ~~l~~li~---~~l~~~p~~Rp~~~~il~~  273 (296)
T cd06618         247 PDFCSFVD---LCLTKDHRKRPKYRELLQH  273 (296)
T ss_pred             HHHHHHHH---HHccCChhhCCCHHHHhcC
Confidence            44444444   5999999999999998754


No 267
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=27.90  E-value=51  Score=25.88  Aligned_cols=27  Identities=22%  Similarity=0.471  Sum_probs=20.2

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..+.+++.   .|...+|.+||++.++...
T Consensus       229 ~~~~~~i~---~~l~~~p~~R~~~~~il~~  255 (277)
T cd06917         229 KLLREFVA---ACLDEEPKERLSAEELLKS  255 (277)
T ss_pred             HHHHHHHH---HHcCCCcccCcCHHHHhhC
Confidence            34444444   4999999999999998753


No 268
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=27.76  E-value=42  Score=26.80  Aligned_cols=22  Identities=18%  Similarity=0.083  Sum_probs=18.1

Q ss_pred             HHhhcccCCCCCCCCCHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      +.-..|+..+|.+||++.++.+
T Consensus       285 dli~~~l~~~P~~R~t~~e~l~  306 (310)
T cd07865         285 DLIDKLLVLDPAKRIDADTALN  306 (310)
T ss_pred             HHHHHHhcCChhhccCHHHHhc
Confidence            4445599999999999999874


No 269
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=27.66  E-value=86  Score=27.46  Aligned_cols=61  Identities=23%  Similarity=0.423  Sum_probs=35.2

Q ss_pred             hhhhcCCCCchhhhhhcccccchhhhhhhhcCCCCCCCcchhHHHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          139 LEVIKGKHPRDFLCSILSSSLTKDVALDEMLDPRLPTSSCSVQEKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       139 ~~~l~g~~p~~~~~~~~~~~~~~~~~~~~~l~~~lp~~~~~~~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ++..+|..|..-..-     ......+.....+.+... ++  ..|.+++..   |+..+|..||+..+...
T Consensus       202 iEla~GePP~s~~hP-----mrvlflIpk~~PP~L~~~-~S--~~~kEFV~~---CL~k~P~~RpsA~~LLK  262 (467)
T KOG0201|consen  202 IELAKGEPPHSKLHP-----MRVLFLIPKSAPPRLDGD-FS--PPFKEFVEA---CLDKNPEFRPSAKELLK  262 (467)
T ss_pred             HHHhcCCCCCcccCc-----ceEEEeccCCCCCccccc-cC--HHHHHHHHH---HhhcCcccCcCHHHHhh
Confidence            577788888743221     111112222333333332 22  345566666   99999999999998764


No 270
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=27.56  E-value=48  Score=27.14  Aligned_cols=23  Identities=17%  Similarity=0.093  Sum_probs=18.5

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..-..|...+|.+||++.++++.
T Consensus       273 ~li~~~l~~~P~~Rps~~~il~~  295 (337)
T cd07852         273 DLLKKLLVFNPNKRLTAEEALEH  295 (337)
T ss_pred             HHHHHhccCCcccccCHHHHhhC
Confidence            34445999999999999999863


No 271
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=27.45  E-value=52  Score=26.84  Aligned_cols=24  Identities=21%  Similarity=0.487  Sum_probs=19.3

Q ss_pred             HHHHhhcccCCCCCCCCCHHHHHH
Q 035742          187 IMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       187 l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      +..+-..|++.+|.+||++.++.+
T Consensus       284 ~~~li~~~l~~dP~~Rpta~e~l~  307 (328)
T cd08226         284 FQNLVELCLQQDPEKRPSASSLLS  307 (328)
T ss_pred             HHHHHHHHccCCcccCCCHHHHhh
Confidence            344555599999999999999874


No 272
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=27.11  E-value=41  Score=27.66  Aligned_cols=22  Identities=18%  Similarity=0.093  Sum_probs=18.0

Q ss_pred             HHhhcccCCCCCCCCCHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      .+-..|++.+|.+||+++++++
T Consensus       269 ~li~~~l~~~P~~Rps~~ell~  290 (337)
T cd07858         269 DLLEKMLVFDPSKRITVEEALA  290 (337)
T ss_pred             HHHHHHhcCChhhccCHHHHHc
Confidence            4444599999999999999875


No 273
>PF12661 hEGF:  Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A.
Probab=26.65  E-value=8.5  Score=15.85  Aligned_cols=6  Identities=50%  Similarity=1.575  Sum_probs=3.2

Q ss_pred             cceeee
Q 035742           38 WFGISC   43 (214)
Q Consensus        38 w~gv~c   43 (214)
                      |.|..|
T Consensus         8 ~~G~~C   13 (13)
T PF12661_consen    8 WTGPNC   13 (13)
T ss_dssp             EETTTT
T ss_pred             CcCCCC
Confidence            666443


No 274
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=26.52  E-value=45  Score=26.47  Aligned_cols=22  Identities=18%  Similarity=0.362  Sum_probs=18.0

Q ss_pred             HHhhcccCCCCCCCCCHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      .+-..|+..+|.+||++.++.+
T Consensus       265 ~li~~~l~~~P~~R~s~~~~l~  286 (290)
T cd07862         265 DLLLKCLTFNPAKRISAYSALS  286 (290)
T ss_pred             HHHHHHhccCchhcCCHHHHhc
Confidence            3444599999999999999874


No 275
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=26.42  E-value=48  Score=26.32  Aligned_cols=19  Identities=16%  Similarity=0.156  Sum_probs=16.3

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|+..+|.+||++.+++.
T Consensus       272 ~~~l~~~P~~R~~~~eil~  290 (295)
T cd07837         272 QKMLRYDPAKRISAKAALT  290 (295)
T ss_pred             HHHccCChhhcCCHHHHhc
Confidence            3489999999999999874


No 276
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=26.33  E-value=47  Score=26.19  Aligned_cols=26  Identities=27%  Similarity=0.548  Sum_probs=20.0

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++..   |...+|.+||+..++++
T Consensus       253 ~~~~~li~~---cl~~~p~~Rp~~~ell~  278 (282)
T cd06636         253 KKFIDFIEG---CLVKNYLSRPSTEQLLK  278 (282)
T ss_pred             HHHHHHHHH---HhCCChhhCcCHHHHhc
Confidence            444555554   99999999999998864


No 277
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=26.27  E-value=58  Score=25.70  Aligned_cols=26  Identities=19%  Similarity=0.280  Sum_probs=20.2

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++..   |...+|.+||++.++++
T Consensus       236 ~~~~~li~~---~l~~~p~~Rp~~~~il~  261 (282)
T cd06643         236 SEFKDFLKK---CLEKNVDARWTTTQLLQ  261 (282)
T ss_pred             HHHHHHHHH---HccCChhhCcCHHHHhc
Confidence            445555554   99999999999999875


No 278
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=26.07  E-value=44  Score=27.40  Aligned_cols=23  Identities=17%  Similarity=0.128  Sum_probs=18.4

Q ss_pred             HHhhcccCCCCCCCCCHHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..-..|+..+|.+||++.++++.
T Consensus       270 ~li~~~l~~dP~~Rpt~~e~l~h  292 (336)
T cd07849         270 DLLDKMLTFNPHKRITVEEALAH  292 (336)
T ss_pred             HHHHHHcCCChhhCcCHHHHhcC
Confidence            34445999999999999998753


No 279
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=25.76  E-value=55  Score=26.82  Aligned_cols=26  Identities=19%  Similarity=0.286  Sum_probs=19.7

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++..   |++.+|.+||++.+++.
T Consensus       268 ~~~~~li~~---~l~~~P~~Rpt~~~~l~  293 (334)
T cd07855         268 PEALDLLSQ---MLQFDPEERITVEQALQ  293 (334)
T ss_pred             HHHHHHHHH---HccCChhhCcCHHHHHh
Confidence            334444444   99999999999999876


No 280
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=25.68  E-value=57  Score=26.18  Aligned_cols=19  Identities=21%  Similarity=0.288  Sum_probs=16.8

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|...+|.+||++.++++
T Consensus       251 ~~~l~~~p~~Rpt~~eil~  269 (296)
T cd06654         251 NRCLDMDVEKRGSAKELLQ  269 (296)
T ss_pred             HHHCcCCcccCcCHHHHhh
Confidence            3499999999999999886


No 281
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=25.62  E-value=51  Score=26.16  Aligned_cols=23  Identities=17%  Similarity=0.190  Sum_probs=18.2

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHH
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ......|+..+|.+||++.++..
T Consensus       265 ~~li~~~L~~~p~~Rps~~e~l~  287 (291)
T cd07844         265 EELALKFLQYEPKKRISAAEAMK  287 (291)
T ss_pred             HHHHHHHhccCcccccCHHHHhc
Confidence            34445589999999999999864


No 282
>PHA03209 serine/threonine kinase US3; Provisional
Probab=25.60  E-value=34  Score=28.54  Aligned_cols=18  Identities=17%  Similarity=0.279  Sum_probs=16.2

Q ss_pred             cccCCCCCCCCCHHHHHH
Q 035742          193 PCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       193 ~C~~~~p~~Rp~m~~V~~  210 (214)
                      .|+..+|.+||++.+|++
T Consensus       333 ~mL~~dP~~Rpta~e~l~  350 (357)
T PHA03209        333 KMLTFDAAMRPSAEEILN  350 (357)
T ss_pred             HHHcCCcccCcCHHHHhc
Confidence            589999999999999874


No 283
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms]
Probab=25.59  E-value=1e+02  Score=28.98  Aligned_cols=38  Identities=18%  Similarity=0.412  Sum_probs=28.3

Q ss_pred             CCCCCcchhHHHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          172 RLPTSSCSVQEKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       172 ~lp~~~~~~~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      .+|+.- ...+.|..++..   |++.+|.+||.+-+|..++.
T Consensus       272 ~~P~~p-~ys~~l~~LI~~---mL~~nP~~RPnI~Qv~~~~~  309 (738)
T KOG1989|consen  272 SFPPFP-NYSDRLKDLIRT---MLQPNPDERPNIYQVLEEIF  309 (738)
T ss_pred             cCCCCc-cHHHHHHHHHHH---HhccCcccCCCHHHHHHHHH
Confidence            466652 233566666666   99999999999999998753


No 284
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=25.48  E-value=75  Score=25.64  Aligned_cols=19  Identities=32%  Similarity=0.704  Sum_probs=16.6

Q ss_pred             cccCCCCCCCCCHHHHHHH
Q 035742          193 PCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       193 ~C~~~~p~~Rp~m~~V~~~  211 (214)
                      .|...+|.+||++.+|...
T Consensus       249 ~cl~~~P~~Rp~~~~ll~~  267 (308)
T cd06634         249 SCLQKIPQDRPTSEVLLKH  267 (308)
T ss_pred             HHhhCCcccCCCHHHHhhC
Confidence            4999999999999998753


No 285
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=25.25  E-value=67  Score=25.04  Aligned_cols=25  Identities=24%  Similarity=0.457  Sum_probs=18.8

Q ss_pred             HHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          183 KLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       183 ~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      .+.+++..   |+..+|.+||++.+|.+
T Consensus       240 ~~~~li~~---~l~~~P~~R~~~~~ll~  264 (267)
T cd06645         240 SFHHFVKM---ALTKNPKKRPTAEKLLQ  264 (267)
T ss_pred             HHHHHHHH---HccCCchhCcCHHHHhc
Confidence            33444444   88999999999999875


No 286
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=25.04  E-value=56  Score=25.87  Aligned_cols=27  Identities=22%  Similarity=0.528  Sum_probs=20.3

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~  211 (214)
                      ..+.+++..   |...+|..||++.+|.+.
T Consensus       244 ~~l~~li~~---~l~~~p~~Rpt~~~il~~  270 (286)
T cd06614         244 PEFKDFLNK---CLVKDPEKRPSAEELLQH  270 (286)
T ss_pred             HHHHHHHHH---HhccChhhCcCHHHHhhC
Confidence            344444444   999999999999999753


No 287
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=24.93  E-value=54  Score=26.68  Aligned_cols=20  Identities=25%  Similarity=0.213  Sum_probs=16.9

Q ss_pred             hhcccCCCCCCCCCHHHHHH
Q 035742          191 AFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       191 ~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      -..|+..+|.+||++.++.+
T Consensus       270 i~~~l~~~P~~Rpt~~e~l~  289 (338)
T cd07859         270 LERLLAFDPKDRPTAEEALA  289 (338)
T ss_pred             HHHHcCcCcccCCCHHHHhc
Confidence            33489999999999999875


No 288
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=24.89  E-value=66  Score=25.78  Aligned_cols=18  Identities=33%  Similarity=0.396  Sum_probs=16.0

Q ss_pred             ccCCCCCCCCCHHHHHHH
Q 035742          194 CLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       194 C~~~~p~~Rp~m~~V~~~  211 (214)
                      |...+|.+||++.++++.
T Consensus       255 ~l~~~P~~Rpt~~~il~~  272 (292)
T cd06658         255 MLVREPSQRATAQELLQH  272 (292)
T ss_pred             HccCChhHCcCHHHHhhC
Confidence            788999999999999863


No 289
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms]
Probab=24.57  E-value=92  Score=28.55  Aligned_cols=30  Identities=13%  Similarity=0.327  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHhhcccCCCCCCCCCHHHHHHHhc
Q 035742          181 QEKLISIMGVAFPCLNESPVSRPTMQTVSQQLQ  213 (214)
Q Consensus       181 ~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~  213 (214)
                      +..+.+++..   |...++.+||...++.++|.
T Consensus       622 pk~mk~Ll~~---C~~~~~~eRP~F~~il~~l~  651 (678)
T KOG0193|consen  622 PKAMKRLLSD---CWKFDREERPLFPQLLSKLE  651 (678)
T ss_pred             HHHHHHHHHH---HHhcCcccCccHHHHHHHHH
Confidence            4566666666   99999999999999998653


No 290
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily.
Probab=24.46  E-value=58  Score=15.70  Aligned_cols=11  Identities=55%  Similarity=0.588  Sum_probs=5.8

Q ss_pred             CCCcEEeCcCC
Q 035742           72 PQLVHLDLSLN   82 (214)
Q Consensus        72 ~~L~~L~l~~n   82 (214)
                      ++|+.|+++++
T Consensus         2 ~~L~~L~l~~C   12 (26)
T smart00367        2 PNLRELDLSGC   12 (26)
T ss_pred             CCCCEeCCCCC
Confidence            34555555554


No 291
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=23.89  E-value=58  Score=26.10  Aligned_cols=19  Identities=11%  Similarity=-0.045  Sum_probs=16.5

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|++.+|.+||++.+|.+
T Consensus       267 ~~ml~~dp~~R~t~~eil~  285 (301)
T cd07873         267 SKLLQFEGRKRISAEEAMK  285 (301)
T ss_pred             HHHhcCCcccCcCHHHHhc
Confidence            3489999999999999875


No 292
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=23.70  E-value=67  Score=26.07  Aligned_cols=19  Identities=21%  Similarity=0.118  Sum_probs=16.5

Q ss_pred             cccCCCCCCCCCHHHHHHH
Q 035742          193 PCLNESPVSRPTMQTVSQQ  211 (214)
Q Consensus       193 ~C~~~~p~~Rp~m~~V~~~  211 (214)
                      .|++.+|.+||++.++...
T Consensus       271 ~~l~~~P~~Rpt~~~ll~~  289 (330)
T cd07834         271 KMLVFDPKKRITADEALAH  289 (330)
T ss_pred             HHccCChhhCCCHHHHHhC
Confidence            4899999999999998763


No 293
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=23.65  E-value=59  Score=25.95  Aligned_cols=23  Identities=17%  Similarity=0.174  Sum_probs=18.1

Q ss_pred             HHHhhcccCCCCCCCCCHHHHHH
Q 035742          188 MGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       188 ~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      .+.-..|+..+|.+||++.+++.
T Consensus       285 ~~~i~~~l~~~p~~R~t~~ell~  307 (311)
T cd07866         285 LDLLSKLLSLDPYKRLTASDALE  307 (311)
T ss_pred             HHHHHHHcccCcccCcCHHHHhc
Confidence            34444599999999999999874


No 294
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=23.56  E-value=56  Score=27.02  Aligned_cols=22  Identities=18%  Similarity=0.161  Sum_probs=18.0

Q ss_pred             HHhhcccCCCCCCCCCHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      .+-..|+..+|.+||++.++.+
T Consensus       289 ~li~~mL~~dP~~Rps~~ell~  310 (355)
T cd07874         289 DLLSKMLVIDPAKRISVDEALQ  310 (355)
T ss_pred             HHHHHHhcCCchhcCCHHHHhc
Confidence            3444589999999999999875


No 295
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=23.54  E-value=55  Score=26.97  Aligned_cols=22  Identities=18%  Similarity=0.018  Sum_probs=17.5

Q ss_pred             HHhhcccCCCCCCCCCHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..-..|+..+|.+||++.+|..
T Consensus       276 dli~~~l~~~P~~Rpt~~ell~  297 (343)
T cd07851         276 DLLEKMLVLDPDKRITAAEALA  297 (343)
T ss_pred             HHHHHhCCCChhhCCCHHHHhc
Confidence            3334499999999999999864


No 296
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=23.44  E-value=57  Score=26.18  Aligned_cols=19  Identities=21%  Similarity=0.242  Sum_probs=16.8

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|+..+|.+||++.+|++
T Consensus       250 ~~~l~~~p~~Rps~~~il~  268 (297)
T cd06656         250 NRCLEMDVDRRGSAKELLQ  268 (297)
T ss_pred             HHHccCChhhCcCHHHHhc
Confidence            3599999999999999976


No 297
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms]
Probab=23.07  E-value=71  Score=26.38  Aligned_cols=42  Identities=26%  Similarity=0.485  Sum_probs=30.5

Q ss_pred             hhcCCCCCCCcchhHHHHHHHHHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          167 EMLDPRLPTSSCSVQEKLISIMGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       167 ~~l~~~lp~~~~~~~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      +.+...||+.+....   .++...   |-.++|-+||....||-.|+|
T Consensus       404 eglrv~ippgis~hm---~klm~i---cmnedpgkrpkfdmivpilek  445 (448)
T KOG0195|consen  404 EGLRVHIPPGISRHM---NKLMNI---CMNEDPGKRPKFDMIVPILEK  445 (448)
T ss_pred             ccccccCCCCccHHH---HHHHHH---HhcCCCCcCCCcceehhhHHH
Confidence            456667888776433   344444   899999999998888877664


No 298
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=23.04  E-value=55  Score=25.78  Aligned_cols=18  Identities=33%  Similarity=0.660  Sum_probs=16.0

Q ss_pred             cccCCCCCCCCCHHHHHH
Q 035742          193 PCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       193 ~C~~~~p~~Rp~m~~V~~  210 (214)
                      .|...+|.+||++.+|++
T Consensus       244 ~~l~~~p~~Rps~~~il~  261 (280)
T cd06611         244 SCLVKDPDDRPTAAELLK  261 (280)
T ss_pred             HHhccChhhCcCHHHHhc
Confidence            489999999999999864


No 299
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their 
Probab=23.03  E-value=86  Score=24.32  Aligned_cols=22  Identities=27%  Similarity=0.588  Sum_probs=17.8

Q ss_pred             HHhhcccCCCCCCCCCHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..-..|+..+|.+||++.++.+
T Consensus       242 ~~i~~~l~~~p~~R~~~~~ll~  263 (268)
T cd06630         242 DVTLRCLELQPEDRPPSRELLK  263 (268)
T ss_pred             HHHHHHcCCCcccCcCHHHHhc
Confidence            3444599999999999999874


No 300
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=22.73  E-value=63  Score=25.66  Aligned_cols=21  Identities=24%  Similarity=0.093  Sum_probs=17.1

Q ss_pred             HhhcccCCCCCCCCCHHHHHH
Q 035742          190 VAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       190 ~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ....|+..+|.+||++.++..
T Consensus       267 ll~~~l~~dp~~R~t~~~~l~  287 (291)
T cd07870         267 LASQMLMMFPKDRISAQDALL  287 (291)
T ss_pred             HHHHHhCcCcccCcCHHHHhc
Confidence            334589999999999999864


No 301
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=22.64  E-value=66  Score=25.57  Aligned_cols=19  Identities=21%  Similarity=0.457  Sum_probs=16.4

Q ss_pred             hcccCCCCCCCCCHHHHHH
Q 035742          192 FPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       192 l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..|+..+|.+||++.+|++
T Consensus       250 ~~~l~~~p~~Rp~~~~il~  268 (292)
T cd06644         250 KTALDKHPETRPSAAQLLE  268 (292)
T ss_pred             HHHhcCCcccCcCHHHHhc
Confidence            3489999999999999875


No 302
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=22.12  E-value=64  Score=25.48  Aligned_cols=21  Identities=19%  Similarity=0.148  Sum_probs=17.0

Q ss_pred             HhhcccCCCCCCCCCHHHHHH
Q 035742          190 VAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       190 ~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      +-..|++.+|.+||++.++..
T Consensus       264 li~~~L~~dP~~R~t~~~~l~  284 (288)
T cd07863         264 LLLEMLTFNPHKRISAFRALQ  284 (288)
T ss_pred             HHHHHhccCcccCCCHHHHhc
Confidence            333489999999999998864


No 303
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=21.63  E-value=81  Score=26.05  Aligned_cols=22  Identities=18%  Similarity=0.132  Sum_probs=17.9

Q ss_pred             HHhhcccCCCCCCCCCHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..-..|++.+|.+||++.++++
T Consensus       289 ~li~~~L~~dP~~R~t~~eiL~  310 (353)
T cd07850         289 DLLSKMLVIDPEKRISVDDALQ  310 (353)
T ss_pred             HHHHHHcCCChhhCcCHHHHhc
Confidence            3344599999999999999874


No 304
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment. 
Probab=21.37  E-value=80  Score=24.81  Aligned_cols=18  Identities=22%  Similarity=0.165  Sum_probs=15.8

Q ss_pred             cccCCCCCCCCCHHHHHH
Q 035742          193 PCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       193 ~C~~~~p~~Rp~m~~V~~  210 (214)
                      .|.+.+|.+||++.+|++
T Consensus       263 ~~l~~~p~~R~~~~~~l~  280 (284)
T cd07836         263 RLLQLNPELRISAHDALQ  280 (284)
T ss_pred             HHhcCCcccCCCHHHHhc
Confidence            489999999999999874


No 305
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms]
Probab=21.21  E-value=1.3e+02  Score=27.79  Aligned_cols=65  Identities=20%  Similarity=0.355  Sum_probs=41.5

Q ss_pred             hhhhcCCCCchhhhhhcccccchhhhh-hhhcCCCCCCCcchhHHHHHHHHHHhhcccCCCCCCCCCHHHHHHHhcC
Q 035742          139 LEVIKGKHPRDFLCSILSSSLTKDVAL-DEMLDPRLPTSSCSVQEKLISIMGVAFPCLNESPVSRPTMQTVSQQLQI  214 (214)
Q Consensus       139 ~~~l~g~~p~~~~~~~~~~~~~~~~~~-~~~l~~~lp~~~~~~~~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~~L~~  214 (214)
                      +++|+|.+|.--....     .-...+ .|.|...+|....   +-|.-+++.   |....|.-||+.+++..-|+|
T Consensus       302 WEmLT~EiPYkdVdss-----AIIwGVGsNsL~LpvPstcP---~GfklL~Kq---cw~sKpRNRPSFrqil~HldI  367 (904)
T KOG4721|consen  302 WEMLTGEIPYKDVDSS-----AIIWGVGSNSLHLPVPSTCP---DGFKLLLKQ---CWNSKPRNRPSFRQILLHLDI  367 (904)
T ss_pred             HHHHhcCCCccccchh-----eeEEeccCCcccccCcccCc---hHHHHHHHH---HHhcCCCCCccHHHHHHHHhh
Confidence            6899999997422110     011111 3556666777664   444444555   999999999999999877654


No 306
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=21.14  E-value=1e+02  Score=24.77  Aligned_cols=18  Identities=28%  Similarity=0.364  Sum_probs=16.3

Q ss_pred             cccCCCCCCCCCHHHHHH
Q 035742          193 PCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       193 ~C~~~~p~~Rp~m~~V~~  210 (214)
                      .|+..+|.+||++.+|++
T Consensus       253 ~~l~~~P~~Rps~~~ll~  270 (297)
T cd06659         253 RMLTREPQERATAQELLD  270 (297)
T ss_pred             HHhcCCcccCcCHHHHhh
Confidence            488999999999999986


No 307
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=21.09  E-value=77  Score=25.89  Aligned_cols=22  Identities=14%  Similarity=0.141  Sum_probs=17.5

Q ss_pred             HHhhcccCCCCCCCCCHHHHHH
Q 035742          189 GVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       189 ~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      .+...|+..+|.+||++.++..
T Consensus       270 ~li~~~l~~~P~~R~t~~~ll~  291 (332)
T cd07857         270 DLLEKLLAFDPTKRISVEEALE  291 (332)
T ss_pred             HHHHHHccCCcccCCCHHHHhc
Confidence            4444599999999999998764


No 308
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=20.42  E-value=66  Score=25.60  Aligned_cols=26  Identities=23%  Similarity=0.315  Sum_probs=19.7

Q ss_pred             HHHHHHHHHhhcccCCCCCCCCCHHHHHH
Q 035742          182 EKLISIMGVAFPCLNESPVSRPTMQTVSQ  210 (214)
Q Consensus       182 ~~L~~l~~~~l~C~~~~p~~Rp~m~~V~~  210 (214)
                      ..+.+++..   |+..+|.+||++.++++
T Consensus       243 ~~l~~li~~---~l~~~p~~Rpt~~~il~  268 (285)
T cd06648         243 PRLRSFLDR---MLVRDPAQRATAAELLN  268 (285)
T ss_pred             HHHHHHHHH---HcccChhhCcCHHHHcc
Confidence            344444444   89999999999999875


Done!