Query         035757
Match_columns 68
No_of_seqs    116 out of 145
Neff          3.6 
Searched_HMMs 46136
Date          Fri Mar 29 06:07:49 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035757.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035757hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02601 beta-carotene hydroxy 100.0 1.2E-36 2.6E-41  228.7  -0.0   68    1-68    222-289 (303)
  2 PF04116 FA_hydroxylase:  Fatty  91.1   0.065 1.4E-06   32.3   0.0   31    3-38     84-114 (114)
  3 PLN02434 fatty acid hydroxylas  79.8     1.8   4E-05   32.0   2.7   19   20-38    188-206 (237)
  4 PF10890 DUF2741:  Protein of u  44.5      11 0.00023   23.9   0.8   22   32-53     31-52  (72)
  5 PF08352 oligo_HPY:  Oligopepti  37.0      18 0.00039   20.3   0.8   21   17-37      9-29  (64)
  6 COG3000 ERG3 Sterol desaturase  35.8     4.1 8.9E-05   29.6  -2.4   41    4-49    182-223 (271)
  7 PF03915 AIP3:  Actin interacti  28.8      19 0.00041   28.8   0.0   43   25-67    370-418 (424)
  8 COG3080 FrdD Fumarate reductas  25.4      25 0.00054   24.1   0.1    9   30-38     77-85  (118)
  9 PHA03293 deoxyribonuclease; Pr  17.5      86  0.0019   26.1   1.7   24   12-35    397-420 (523)
 10 KOG0476 Cl- channel CLC-2 and   17.5      78  0.0017   28.2   1.5   27    9-36    347-373 (931)

No 1  
>PLN02601 beta-carotene hydroxylase
Probab=100.00  E-value=1.2e-36  Score=228.66  Aligned_cols=68  Identities=81%  Similarity=1.405  Sum_probs=66.4

Q ss_pred             CeEEEEeceeeeccccCCccCCCHHHHHHHHHHHhhcCCCCCCeeeeEeeccchhhhhcccccccccC
Q 035757            1 MAYMFVHDGLVHRRFPVGPIAHVPYLRKVAAAHQLHHSEKFNGLPYGLFLGPQELEEVEGTEGLDKET   68 (68)
Q Consensus         1 iaYf~vHD~liH~R~~~~~~~~~~Y~rrl~~AH~~HH~~K~~g~~fGfl~~p~~l~~v~~~~~~~~~~   68 (68)
                      |+||||||||||||||+++++||||+|+|++|||+||++|++|||||||++|+|||+|||+||||||+
T Consensus       222 iaYffVHDgLVHqRfp~~~~a~~~Y~rrl~~AHklHHa~Ke~Gv~FGfll~P~e~e~vgg~~el~~~~  289 (303)
T PLN02601        222 MAYMFVHDGLVHKRFPVGPIANVPYLRKVAAAHQLHHTDKFKGVPYGLFLGPKEVEEVGGKEELEKEI  289 (303)
T ss_pred             HHHHHHhhhhhccccccCCCCCCHHHHHHHHHHHhhccCCcCCccceEEeccHHHHhcCCHHHHHHHH
Confidence            58999999999999999999999999999999999999999999999999999999999999999875


No 2  
>PF04116 FA_hydroxylase:  Fatty acid hydroxylase superfamily;  InterPro: IPR006694  This superfamily includes fatty acid and carotene hydroxylases and sterol desaturases. Beta-carotene hydroxylase is involved in zeaxanthin synthesis by hydroxylating beta-carotene, but the enzyme may be involved in other pathways []. This family includes C-5 sterol desaturase and C-4 sterol methyl oxidase. Members of this family are involved in cholesterol biosynthesis and biosynthesis a plant cuticular wax. These enzymes contain two copies of a HXHH motif. Members of this family are integral membrane proteins.; GO: 0005506 iron ion binding, 0016491 oxidoreductase activity, 0006633 fatty acid biosynthetic process, 0055114 oxidation-reduction process
Probab=91.11  E-value=0.065  Score=32.33  Aligned_cols=31  Identities=35%  Similarity=0.599  Sum_probs=22.4

Q ss_pred             EEEEeceeeeccccCCccCCCHHHHHHHHHHHhhcC
Q 035757            3 YMFVHDGLVHRRFPVGPIAHVPYLRKVAAAHQLHHS   38 (68)
Q Consensus         3 Yf~vHD~liH~R~~~~~~~~~~Y~rrl~~AH~~HH~   38 (68)
                      |.+.|+++     .....+..+|++...+.|++||+
T Consensus        84 ~~~~H~~~-----~~~~~~~~~~~~~~~~~H~~HH~  114 (114)
T PF04116_consen   84 YIFIHSGY-----HHRFPPRLRYLFVTPRHHDLHHS  114 (114)
T ss_pred             HHHhhcCc-----cCCCCCcchhHhcCHHHHHhhCc
Confidence            34556666     23334667899999999999995


No 3  
>PLN02434 fatty acid hydroxylase
Probab=79.83  E-value=1.8  Score=32.00  Aligned_cols=19  Identities=26%  Similarity=0.270  Sum_probs=17.0

Q ss_pred             cCCCHHHHHHHHHHHhhcC
Q 035757           20 IAHVPYLRKVAAAHQLHHS   38 (68)
Q Consensus        20 ~~~~~Y~rrl~~AH~~HH~   38 (68)
                      +++++|+|++.+-|..||-
T Consensus       188 ~p~~~~~r~lkr~H~~HHf  206 (237)
T PLN02434        188 QPSTDVLRNLKKYHLNHHF  206 (237)
T ss_pred             CcchHHHHHHHHHHHHHcC
Confidence            5668999999999999995


No 4  
>PF10890 DUF2741:  Protein of unknown function (DUF2741);  InterPro: IPR020101 This entry represents subunit 8 of the Cytochrome b-c1 complex. The ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone. In plants, the b-c1 complex contains 10 subunits: 3 respiratory subunits, 2 core proteins and 5 low-molecular weight proteins.
Probab=44.49  E-value=11  Score=23.92  Aligned_cols=22  Identities=32%  Similarity=0.395  Sum_probs=19.2

Q ss_pred             HHHhhcCCCCCCeeeeEeeccc
Q 035757           32 AHQLHHSEKFNGLPYGLFLGPQ   53 (68)
Q Consensus        32 AH~~HH~~K~~g~~fGfl~~p~   53 (68)
                      .+++||..+|+.++=++|++|-
T Consensus        31 p~ki~hk~~enwv~a~~~~~p~   52 (72)
T PF10890_consen   31 PKKIHHKFSENWVSATLFLVPL   52 (72)
T ss_pred             HHHHHHHHhhcceeeEEEeeee
Confidence            5899998889999999999874


No 5  
>PF08352 oligo_HPY:  Oligopeptide/dipeptide transporter, C-terminal region;  InterPro: IPR013563 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This entry features a region found towards the C terminus of oligopeptide ABC transporter ATP binding proteins, immediately following the ATP-binding domain (IPR003439 from INTERPRO). All characterised members appear able to be involved in the transport of oligopeptides or dipeptides. Some are important for sporulation or antibiotic resistance. Some dipeptide transporters also act on the haem precursor delta-aminolevulinic acid. ; GO: 0000166 nucleotide binding, 0005524 ATP binding, 0015833 peptide transport
Probab=37.00  E-value=18  Score=20.35  Aligned_cols=21  Identities=24%  Similarity=0.176  Sum_probs=16.1

Q ss_pred             CCccCCCHHHHHHHHHHHhhc
Q 035757           17 VGPIAHVPYLRKVAAAHQLHH   37 (68)
Q Consensus        17 ~~~~~~~~Y~rrl~~AH~~HH   37 (68)
                      ++..+.+||-|+|.+|.--..
T Consensus         9 i~~~P~HPYT~~Ll~a~p~~~   29 (64)
T PF08352_consen    9 IFDNPRHPYTRALLAAVPSID   29 (64)
T ss_pred             HHHCccCHHHHHHHHcCcchh
Confidence            346789999999999875443


No 6  
>COG3000 ERG3 Sterol desaturase [Lipid metabolism]
Probab=35.81  E-value=4.1  Score=29.56  Aligned_cols=41  Identities=29%  Similarity=0.555  Sum_probs=24.0

Q ss_pred             EEEeceeeeccccCCccCCCHHHHHHHHHHHhhcCCCC-CCeeeeEe
Q 035757            4 MFVHDGLVHRRFPVGPIAHVPYLRKVAAAHQLHHSEKF-NGLPYGLF   49 (68)
Q Consensus         4 f~vHD~liH~R~~~~~~~~~~Y~rrl~~AH~~HH~~K~-~g~~fGfl   49 (68)
                      ++.|.++.+. .+.+   ..+++-...+-|++||+. + ...|||..
T Consensus       182 ~~~H~~~~~~-~~~~---~~~~v~~~p~~H~lHH~~-~~~~~Nyg~~  223 (271)
T COG3000         182 VLIHSNLDLP-LPLG---WLRYVFNTPRHHRLHHSK-DPYDKNYGVT  223 (271)
T ss_pred             HHHhcCcccc-CCcc---cceeeecCchHHHHhccC-CCCCCcchhh
Confidence            3456666664 2222   223344556789999983 2 45889943


No 7  
>PF03915 AIP3:  Actin interacting protein 3;  InterPro: IPR022782 This entry represents a domain found in yeast actin interacting protein 3 and bud site selection protein 6. In these proteins it is typically found towards the C terminus. It is also found in metazoan proteins, such as the mouse enhancer trap locus 4 protein. ; PDB: 3ONX_B 3OKQ_A.
Probab=28.78  E-value=19  Score=28.79  Aligned_cols=43  Identities=21%  Similarity=0.318  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHhhcCCCC--C----CeeeeEeeccchhhhhccccccccc
Q 035757           25 YLRKVAAAHQLHHSEKF--N----GLPYGLFLGPQELEEVEGTEGLDKE   67 (68)
Q Consensus        25 Y~rrl~~AH~~HH~~K~--~----g~~fGfl~~p~~l~~v~~~~~~~~~   67 (68)
                      -+++|-+|=++==.+++  .    ..--|=|+.-++|-+.||.||+||.
T Consensus       370 RLeAIerAEKlRqkele~~~~~~f~~EL~~FV~~~kLKksGG~eEvER~  418 (424)
T PF03915_consen  370 RLEAIERAEKLRQKELEYRRVDEFQKELGNFVEEKKLKKSGGIEEVERL  418 (424)
T ss_dssp             -------------------------------------------------
T ss_pred             HHHHHHHHHHHHHHHHHhccccHHHHHHHHHhccCcccccCCHHHHHHH
Confidence            45566666555443211  0    1234668899999999999999984


No 8  
>COG3080 FrdD Fumarate reductase subunit D [Energy production and conversion]
Probab=25.38  E-value=25  Score=24.14  Aligned_cols=9  Identities=44%  Similarity=0.903  Sum_probs=7.1

Q ss_pred             HHHHHhhcC
Q 035757           30 AAAHQLHHS   38 (68)
Q Consensus        30 ~~AH~~HH~   38 (68)
                      -.+|++||.
T Consensus        77 ~a~HRihHg   85 (118)
T COG3080          77 CALHRIHHG   85 (118)
T ss_pred             HHHHHHHhh
Confidence            368999995


No 9  
>PHA03293 deoxyribonuclease; Provisional
Probab=17.51  E-value=86  Score=26.06  Aligned_cols=24  Identities=8%  Similarity=0.181  Sum_probs=19.8

Q ss_pred             eccccCCccCCCHHHHHHHHHHHh
Q 035757           12 HRRFPVGPIAHVPYLRKVAAAHQL   35 (68)
Q Consensus        12 H~R~~~~~~~~~~Y~rrl~~AH~~   35 (68)
                      .-+.|+|-||+++|+++|..-+.+
T Consensus       397 ~f~vpVFaNPRH~nFkQilvQ~YV  420 (523)
T PHA03293        397 ALEVPIFANPRHPNFKQILVQAYV  420 (523)
T ss_pred             eeecccccCCCCcchHHHHHHHHH
Confidence            357799999999999999876654


No 10 
>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism]
Probab=17.49  E-value=78  Score=28.19  Aligned_cols=27  Identities=22%  Similarity=0.241  Sum_probs=21.4

Q ss_pred             eeeeccccCCccCCCHHHHHHHHHHHhh
Q 035757            9 GLVHRRFPVGPIAHVPYLRKVAAAHQLH   36 (68)
Q Consensus         9 ~liH~R~~~~~~~~~~Y~rrl~~AH~~H   36 (68)
                      +.+|||+- +...||+|++++.+-|++=
T Consensus       347 VylhR~iv-lf~Rkn~~~~~~f~k~~ll  373 (931)
T KOG0476|consen  347 VYLHRRIV-LFLRKNRYAKKLFQKSRLL  373 (931)
T ss_pred             eeeeeeee-eeehhhHHHHHHHhhCccH
Confidence            46789984 4578999999999988753


Done!