BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035792
         (856 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2P4H|X Chain X, Crystal Structure Of Vestitone Reductase From Alfalfa
           (Medicago Sativa L.)
          Length = 322

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 29/67 (43%)

Query: 356 ICKWHILREGQERLAHIYLAHPSFYGELYSCINFCETIEEFESSWCSLLDKYDLQKNEWL 415
           + ++H++       AHIYL   S  G  Y+C  F   IEE      +   +Y +   + L
Sbjct: 219 VTRFHMVHVDDVARAHIYLLENSVPGGRYNCSPFIVPIEEMSQLLSAKYPEYQILTVDEL 278

Query: 416 HAVYNAR 422
             +  AR
Sbjct: 279 KEIKGAR 285


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.131    0.393 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 24,065,941
Number of Sequences: 62578
Number of extensions: 983894
Number of successful extensions: 1961
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1960
Number of HSP's gapped (non-prelim): 3
length of query: 856
length of database: 14,973,337
effective HSP length: 107
effective length of query: 749
effective length of database: 8,277,491
effective search space: 6199840759
effective search space used: 6199840759
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)