BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035795
(164 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2AFB|A Chain A, Crystal Structure Of 2-Dehydro-3- Deoxygluconokinase (Ec
2.7.1.45) (Tm0067) From Thermotoga Maritima At 2.05 A
Resolution
pdb|2AFB|B Chain B, Crystal Structure Of 2-Dehydro-3- Deoxygluconokinase (Ec
2.7.1.45) (Tm0067) From Thermotoga Maritima At 2.05 A
Resolution
Length = 351
Score = 28.1 bits (61), Expect = 2.5, Method: Compositional matrix adjust.
Identities = 14/42 (33%), Positives = 21/42 (50%)
Query: 14 NAQYHMFNWLKIVYMPLWFVHNGLDNPLFLALQRIIRRRLKI 55
A+ F+W KI+ WF +G+ PL L I+ LK+
Sbjct: 124 EAKREDFDWEKILDGARWFHFSGITPPLGKELPLILEDALKV 165
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.140 0.433
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,723,219
Number of Sequences: 62578
Number of extensions: 173328
Number of successful extensions: 422
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 421
Number of HSP's gapped (non-prelim): 1
length of query: 164
length of database: 14,973,337
effective HSP length: 91
effective length of query: 73
effective length of database: 9,278,739
effective search space: 677347947
effective search space used: 677347947
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 47 (22.7 bits)