BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035814
(422 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3UL3|B Chain B, Structural Insights Into Thioredoxin-2: A Component Of
Malaria Parasite Protein Secretion Machinery
pdb|3UL3|A Chain A, Structural Insights Into Thioredoxin-2: A Component Of
Malaria Parasite Protein Secretion Machinery
Length = 128
Score = 28.5 bits (62), Expect = 7.1, Method: Compositional matrix adjust.
Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 3/72 (4%)
Query: 299 VPKLQVTVQELEINPANQK--LYQFHWVMSWASAIPSSPNDFEEIRKWYKGWKDLLPQEL 356
VP+LQ + IN N K + ++ W A + ++++K+Y LL +L
Sbjct: 24 VPRLQQNGSNI-INGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDL 82
Query: 357 VANESIRAQLSI 368
NES+ + S+
Sbjct: 83 DKNESLARKFSV 94
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.133 0.424
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,203,948
Number of Sequences: 62578
Number of extensions: 536307
Number of successful extensions: 1285
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 1281
Number of HSP's gapped (non-prelim): 10
length of query: 422
length of database: 14,973,337
effective HSP length: 101
effective length of query: 321
effective length of database: 8,652,959
effective search space: 2777599839
effective search space used: 2777599839
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)