BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035814
         (422 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3UL3|B Chain B, Structural Insights Into Thioredoxin-2: A Component Of
           Malaria Parasite Protein Secretion Machinery
 pdb|3UL3|A Chain A, Structural Insights Into Thioredoxin-2: A Component Of
           Malaria Parasite Protein Secretion Machinery
          Length = 128

 Score = 28.5 bits (62), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 3/72 (4%)

Query: 299 VPKLQVTVQELEINPANQK--LYQFHWVMSWASAIPSSPNDFEEIRKWYKGWKDLLPQEL 356
           VP+LQ     + IN  N K  +   ++   W  A      + ++++K+Y     LL  +L
Sbjct: 24  VPRLQQNGSNI-INGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDL 82

Query: 357 VANESIRAQLSI 368
             NES+  + S+
Sbjct: 83  DKNESLARKFSV 94


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.133    0.424 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,203,948
Number of Sequences: 62578
Number of extensions: 536307
Number of successful extensions: 1285
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 1281
Number of HSP's gapped (non-prelim): 10
length of query: 422
length of database: 14,973,337
effective HSP length: 101
effective length of query: 321
effective length of database: 8,652,959
effective search space: 2777599839
effective search space used: 2777599839
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)