BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035821
         (126 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2WD7|B Chain B, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In
           Complex With Nadp And Ddd00066750
 pdb|2WD7|C Chain C, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In
           Complex With Nadp And Ddd00066750
 pdb|2WD7|D Chain D, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In
           Complex With Nadp And Ddd00066750
          Length = 268

 Score = 30.0 bits (66), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 3/33 (9%)

Query: 71  SNGKTVADFIAEFLGLPYAPPFL---SFKPRDK 100
           SNGKTV   +AE +G     PFL   SF  R K
Sbjct: 111 SNGKTVETQVAELIGTNAIAPFLLTMSFAQRQK 143


>pdb|2C7V|A Chain A, Structure Of Trypanosoma Brucei Pteridine Reductase (Ptr1)
           In Ternary Complex With Cofactor And The Antifolate
           Methotrexate
 pdb|2C7V|B Chain B, Structure Of Trypanosoma Brucei Pteridine Reductase (Ptr1)
           In Ternary Complex With Cofactor And The Antifolate
           Methotrexate
 pdb|2C7V|C Chain C, Structure Of Trypanosoma Brucei Pteridine Reductase (Ptr1)
           In Ternary Complex With Cofactor And The Antifolate
           Methotrexate
 pdb|2C7V|D Chain D, Structure Of Trypanosoma Brucei Pteridine Reductase (Ptr1)
           In Ternary Complex With Cofactor And The Antifolate
           Methotrexate
          Length = 268

 Score = 30.0 bits (66), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 3/33 (9%)

Query: 71  SNGKTVADFIAEFLGLPYAPPFL---SFKPRDK 100
           SNGKTV   +AE +G     PFL   SF  R K
Sbjct: 111 SNGKTVETQVAELIGTNAIAPFLLTMSFAQRQK 143


>pdb|2WD7|A Chain A, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In
           Complex With Nadp And Ddd00066750
 pdb|2WD8|A Chain A, Pteridine Reductase 1 (ptr1) From Trypanosoma Brucei In
           Complex With Nadp And Ddd00071204
 pdb|2WD8|B Chain B, Pteridine Reductase 1 (ptr1) From Trypanosoma Brucei In
           Complex With Nadp And Ddd00071204
 pdb|2WD8|C Chain C, Pteridine Reductase 1 (ptr1) From Trypanosoma Brucei In
           Complex With Nadp And Ddd00071204
 pdb|2WD8|D Chain D, Pteridine Reductase 1 (ptr1) From Trypanosoma Brucei In
           Complex With Nadp And Ddd00071204
 pdb|2VZ0|A Chain A, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In
           Complex With Nadp And Ddd00066641
 pdb|2VZ0|B Chain B, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In
           Complex With Nadp And Ddd00066641
 pdb|2VZ0|C Chain C, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In
           Complex With Nadp And Ddd00066641
 pdb|2VZ0|D Chain D, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In
           Complex With Nadp And Ddd00066641
          Length = 268

 Score = 30.0 bits (66), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 3/33 (9%)

Query: 71  SNGKTVADFIAEFLGLPYAPPFL---SFKPRDK 100
           SNGKTV   +AE +G     PFL   SF  R K
Sbjct: 111 SNGKTVETQVAELIGTNAIAPFLLTMSFAQRQK 143


>pdb|3JQ7|B Chain B, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 6- Phenylpteridine-2,4,7-Triamine
           (Dx2)
 pdb|3JQA|B Chain B, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-1,9-Dihydro-6h-Purine-6-Thione (Dx4)
 pdb|3JQA|C Chain C, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-1,9-Dihydro-6h-Purine-6-Thione (Dx4)
 pdb|3JQF|C Chain C, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 1,3,5- Triazine-2,4,6-Triamine
           (Ax2)
 pdb|3JQG|A Chain A, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 6-[(4-
           Methoxybenzyl)sulfanyl]pyrimidine-2,4-Diamine (Ax6)
 pdb|3JQG|C Chain C, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 6-[(4-
           Methoxybenzyl)sulfanyl]pyrimidine-2,4-Diamine (Ax6)
 pdb|2YHI|A Chain A, Trypanosoma Brucei Ptr1 In Complex With Inhibitor Wh16
 pdb|2YHI|C Chain C, Trypanosoma Brucei Ptr1 In Complex With Inhibitor Wh16
          Length = 288

 Score = 29.6 bits (65), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 3/33 (9%)

Query: 71  SNGKTVADFIAEFLGLPYAPPFL---SFKPRDK 100
           SNGKTV   +AE +G     PFL   SF  R K
Sbjct: 131 SNGKTVETQVAELIGTNAIAPFLLTMSFAQRQK 163


>pdb|3BMC|B Chain B, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Substrate (Folate)
 pdb|3BMC|C Chain C, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Substrate (Folate)
 pdb|3BMC|D Chain D, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Substrate (Folate)
 pdb|3BMN|B Chain B, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Compound Ax3)
 pdb|3BMN|C Chain C, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Compound Ax3)
 pdb|3BMN|D Chain D, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Compound Ax3)
 pdb|3BMO|A Chain A, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Compound Ax4)
 pdb|3BMO|C Chain C, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Compound Ax4)
 pdb|3BMO|D Chain D, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Compound Ax4)
 pdb|3BMQ|B Chain B, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Compound Ax5)
 pdb|3BMQ|C Chain C, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Compound Ax5)
 pdb|3JQ6|A Chain A, Crystal Structure Of Pteridine Reductase 1 (ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (nadp+) And Inhibitor 6,7-
           Bis(1-methylethyl)pteridine-2,4-diamine (dx1)
 pdb|3JQ6|B Chain B, Crystal Structure Of Pteridine Reductase 1 (ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (nadp+) And Inhibitor 6,7-
           Bis(1-methylethyl)pteridine-2,4-diamine (dx1)
 pdb|3JQ6|C Chain C, Crystal Structure Of Pteridine Reductase 1 (ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (nadp+) And Inhibitor 6,7-
           Bis(1-methylethyl)pteridine-2,4-diamine (dx1)
 pdb|3JQ6|D Chain D, Crystal Structure Of Pteridine Reductase 1 (ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (nadp+) And Inhibitor 6,7-
           Bis(1-methylethyl)pteridine-2,4-diamine (dx1)
 pdb|3JQ8|A Chain A, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 6,7,7-
           Trimethyl-7,8-Dihydropteridine-2,4-Diamine (Dx3)
 pdb|3JQ9|A Chain A, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor
           2-Amino-6-(1,3-Benzodioxol-5-Yl)-4-Oxo-4,7-
           Dihydro-3h-Pyrrolo[2,3-D]pyrimidine-5-Carbonitrile (Ax1)
 pdb|3JQ9|B Chain B, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor
           2-Amino-6-(1,3-Benzodioxol-5-Yl)-4-Oxo-4,7-
           Dihydro-3h-Pyrrolo[2,3-D]pyrimidine-5-Carbonitrile (Ax1)
 pdb|3JQA|A Chain A, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-1,9-Dihydro-6h-Purine-6-Thione (Dx4)
 pdb|3JQB|A Chain A, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor
           2-Amino-5-(2-Phenylethyl)-3,7-Dihydro-4h-
           Pyrrolo[2,3-D]pyrimidin-4-One (Dx6)
 pdb|3JQB|B Chain B, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor
           2-Amino-5-(2-Phenylethyl)-3,7-Dihydro-4h-
           Pyrrolo[2,3-D]pyrimidin-4-One (Dx6)
 pdb|3JQB|D Chain D, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor
           2-Amino-5-(2-Phenylethyl)-3,7-Dihydro-4h-
           Pyrrolo[2,3-D]pyrimidin-4-One (Dx6)
 pdb|3JQC|A Chain A, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-6-Bromo-4-Oxo-4,7-Dihydro-3h-Pyrrolo[2,
           3-D]pyrimidine-5- Carbonitrile (Ju2)
 pdb|3JQC|B Chain B, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-6-Bromo-4-Oxo-4,7-Dihydro-3h-Pyrrolo[2,
           3-D]pyrimidine-5- Carbonitrile (Ju2)
 pdb|3JQC|C Chain C, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-6-Bromo-4-Oxo-4,7-Dihydro-3h-Pyrrolo[2,
           3-D]pyrimidine-5- Carbonitrile (Ju2)
 pdb|3JQC|D Chain D, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-6-Bromo-4-Oxo-4,7-Dihydro-3h-Pyrrolo[2,
           3-D]pyrimidine-5- Carbonitrile (Ju2)
 pdb|3JQE|A Chain A, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-6-(4-Methoxyphenyl)-4-Oxo-4,
           7-Dihydro-3h-Pyrrolo[2,3- D]pyrimidine-5-Carbonitrile
           (Dx8)
 pdb|3JQE|B Chain B, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-6-(4-Methoxyphenyl)-4-Oxo-4,
           7-Dihydro-3h-Pyrrolo[2,3- D]pyrimidine-5-Carbonitrile
           (Dx8)
 pdb|3JQE|C Chain C, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-6-(4-Methoxyphenyl)-4-Oxo-4,
           7-Dihydro-3h-Pyrrolo[2,3- D]pyrimidine-5-Carbonitrile
           (Dx8)
 pdb|3JQE|D Chain D, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-6-(4-Methoxyphenyl)-4-Oxo-4,
           7-Dihydro-3h-Pyrrolo[2,3- D]pyrimidine-5-Carbonitrile
           (Dx8)
 pdb|3JQF|A Chain A, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 1,3,5- Triazine-2,4,6-Triamine
           (Ax2)
 pdb|3JQF|B Chain B, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 1,3,5- Triazine-2,4,6-Triamine
           (Ax2)
 pdb|3JQF|D Chain D, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 1,3,5- Triazine-2,4,6-Triamine
           (Ax2)
 pdb|3JQG|B Chain B, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 6-[(4-
           Methoxybenzyl)sulfanyl]pyrimidine-2,4-Diamine (Ax6)
 pdb|3JQG|D Chain D, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 6-[(4-
           Methoxybenzyl)sulfanyl]pyrimidine-2,4-Diamine (Ax6)
 pdb|3GN2|A Chain A, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Ddd00066730)
 pdb|3GN2|B Chain B, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Ddd00066730)
 pdb|3GN2|C Chain C, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Ddd00066730)
 pdb|3GN2|D Chain D, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Ddd00066730)
 pdb|3MCV|A Chain A, Structure Of Ptr1 From Trypanosoma Brucei In Ternary
           Complex With 2,4-
           Diamino-5-[2-(2,5-Dimethoxyphenyl)ethyl]thieno[2,
           3-D]-Pyrimidine And Nadp+
 pdb|3MCV|B Chain B, Structure Of Ptr1 From Trypanosoma Brucei In Ternary
           Complex With 2,4-
           Diamino-5-[2-(2,5-Dimethoxyphenyl)ethyl]thieno[2,
           3-D]-Pyrimidine And Nadp+
 pdb|3MCV|C Chain C, Structure Of Ptr1 From Trypanosoma Brucei In Ternary
           Complex With 2,4-
           Diamino-5-[2-(2,5-Dimethoxyphenyl)ethyl]thieno[2,
           3-D]-Pyrimidine And Nadp+
 pdb|3MCV|D Chain D, Structure Of Ptr1 From Trypanosoma Brucei In Ternary
           Complex With 2,4-
           Diamino-5-[2-(2,5-Dimethoxyphenyl)ethyl]thieno[2,
           3-D]-Pyrimidine And Nadp+
 pdb|2X9G|A Chain A, High Resolution Structure Of Tbptr1 In Complex With
           Pemetrexed
 pdb|2X9G|B Chain B, High Resolution Structure Of Tbptr1 In Complex With
           Pemetrexed
 pdb|2X9G|C Chain C, High Resolution Structure Of Tbptr1 In Complex With
           Pemetrexed
 pdb|2X9G|D Chain D, High Resolution Structure Of Tbptr1 In Complex With
           Pemetrexed
 pdb|2X9V|A Chain A, High Resolution Structure Of Tbptr1 With Trimetrexate
 pdb|2X9V|B Chain B, High Resolution Structure Of Tbptr1 With Trimetrexate
 pdb|2X9V|C Chain C, High Resolution Structure Of Tbptr1 With Trimetrexate
 pdb|2X9V|D Chain D, High Resolution Structure Of Tbptr1 With Trimetrexate
 pdb|2X9N|A Chain A, High Resolution Structure Of Tbptr1 In Complex With
           Cyromazine
 pdb|2X9N|B Chain B, High Resolution Structure Of Tbptr1 In Complex With
           Cyromazine
 pdb|2X9N|C Chain C, High Resolution Structure Of Tbptr1 In Complex With
           Cyromazine
 pdb|2X9N|D Chain D, High Resolution Structure Of Tbptr1 In Complex With
           Cyromazine
 pdb|2YHI|B Chain B, Trypanosoma Brucei Ptr1 In Complex With Inhibitor Wh16
 pdb|2YHI|D Chain D, Trypanosoma Brucei Ptr1 In Complex With Inhibitor Wh16
          Length = 288

 Score = 29.6 bits (65), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 3/33 (9%)

Query: 71  SNGKTVADFIAEFLGLPYAPPFL---SFKPRDK 100
           SNGKTV   +AE +G     PFL   SF  R K
Sbjct: 131 SNGKTVETQVAELIGTNAIAPFLLTMSFAQRQK 163


>pdb|3BMC|A Chain A, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Substrate (Folate)
 pdb|3BMN|A Chain A, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Compound Ax3)
 pdb|3BMO|B Chain B, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Compound Ax4)
 pdb|3BMQ|A Chain A, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Compound Ax5)
 pdb|3BMQ|D Chain D, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Compound Ax5)
 pdb|3JQ8|B Chain B, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 6,7,7-
           Trimethyl-7,8-Dihydropteridine-2,4-Diamine (Dx3)
 pdb|3JQ8|C Chain C, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 6,7,7-
           Trimethyl-7,8-Dihydropteridine-2,4-Diamine (Dx3)
 pdb|3JQ8|D Chain D, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 6,7,7-
           Trimethyl-7,8-Dihydropteridine-2,4-Diamine (Dx3)
 pdb|3JQ9|C Chain C, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor
           2-Amino-6-(1,3-Benzodioxol-5-Yl)-4-Oxo-4,7-
           Dihydro-3h-Pyrrolo[2,3-D]pyrimidine-5-Carbonitrile (Ax1)
 pdb|3JQ9|D Chain D, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor
           2-Amino-6-(1,3-Benzodioxol-5-Yl)-4-Oxo-4,7-
           Dihydro-3h-Pyrrolo[2,3-D]pyrimidine-5-Carbonitrile (Ax1)
 pdb|3JQB|C Chain C, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor
           2-Amino-5-(2-Phenylethyl)-3,7-Dihydro-4h-
           Pyrrolo[2,3-D]pyrimidin-4-One (Dx6)
 pdb|3JQD|A Chain A, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-4-Oxo-6-Phenyl-4,7-Dihydro-3h-Pyrrolo[2,
           3-D]pyrimidine-5- Carbonitrile (Dx7)
 pdb|3JQD|B Chain B, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-4-Oxo-6-Phenyl-4,7-Dihydro-3h-Pyrrolo[2,
           3-D]pyrimidine-5- Carbonitrile (Dx7)
 pdb|3JQD|C Chain C, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-4-Oxo-6-Phenyl-4,7-Dihydro-3h-Pyrrolo[2,
           3-D]pyrimidine-5- Carbonitrile (Dx7)
 pdb|3JQD|D Chain D, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-4-Oxo-6-Phenyl-4,7-Dihydro-3h-Pyrrolo[2,
           3-D]pyrimidine-5- Carbonitrile (Dx7)
 pdb|3GN1|A Chain A, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Ddd00067116)
 pdb|3GN1|B Chain B, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Ddd00067116)
 pdb|3GN1|C Chain C, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Ddd00067116)
 pdb|3GN1|D Chain D, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma
           Brucei In Ternary Complex With Cofactor (Nadp+) And
           Inhibitor (Ddd00067116)
 pdb|2YHU|A Chain A, Trypanosoma Brucei Ptr1 In Complex With Inhibitor Whf30
 pdb|2YHU|B Chain B, Trypanosoma Brucei Ptr1 In Complex With Inhibitor Whf30
 pdb|2YHU|C Chain C, Trypanosoma Brucei Ptr1 In Complex With Inhibitor Whf30
 pdb|2YHU|D Chain D, Trypanosoma Brucei Ptr1 In Complex With Inhibitor Whf30
          Length = 288

 Score = 29.6 bits (65), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 3/33 (9%)

Query: 71  SNGKTVADFIAEFLGLPYAPPFL---SFKPRDK 100
           SNGKTV   +AE +G     PFL   SF  R K
Sbjct: 131 SNGKTVETQVAELIGTNAIAPFLLTMSFAQRQK 163


>pdb|3JQ7|A Chain A, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 6- Phenylpteridine-2,4,7-Triamine
           (Dx2)
 pdb|3JQ7|C Chain C, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 6- Phenylpteridine-2,4,7-Triamine
           (Dx2)
 pdb|3JQ7|D Chain D, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 6- Phenylpteridine-2,4,7-Triamine
           (Dx2)
 pdb|3JQA|D Chain D, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From
           Trypanosoma Brucei In Ternary Complex With Cofactor
           (Nadp+) And Inhibitor 2-
           Amino-1,9-Dihydro-6h-Purine-6-Thione (Dx4)
          Length = 288

 Score = 29.6 bits (65), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 3/33 (9%)

Query: 71  SNGKTVADFIAEFLGLPYAPPFL---SFKPRDK 100
           SNGKTV   +AE +G     PFL   SF  R K
Sbjct: 131 SNGKTVETQVAELIGTNAIAPFLLTMSFAQRQK 163


>pdb|2F1Z|A Chain A, Crystal Structure Of Hausp
 pdb|2F1Z|B Chain B, Crystal Structure Of Hausp
          Length = 522

 Score = 28.9 bits (63), Expect = 0.69,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 6/50 (12%)

Query: 24  TSPLAPALYVLGDSLLDSGNNN------YLQTIIKANYSPYGEDFVNKCT 67
           T P  PA Y+L   L+ SG+N+      YL       +  + +D V++CT
Sbjct: 402 TDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCT 451


>pdb|1NB8|A Chain A, Structure Of The Catalytic Domain Of Usp7 (Hausp)
 pdb|1NB8|B Chain B, Structure Of The Catalytic Domain Of Usp7 (Hausp)
          Length = 353

 Score = 27.7 bits (60), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 6/50 (12%)

Query: 24  TSPLAPALYVLGDSLLDSGNNN------YLQTIIKANYSPYGEDFVNKCT 67
           T P  PA Y+L   L+ SG+N+      YL       +  + +D V++CT
Sbjct: 233 TDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCT 282


>pdb|1NBF|A Chain A, Crystal Structure Of A Ubp-Family Deubiquitinating Enzyme
           In Isolation And In Complex With Ubiquitin Aldehyde
 pdb|1NBF|B Chain B, Crystal Structure Of A Ubp-Family Deubiquitinating Enzyme
           In Isolation And In Complex With Ubiquitin Aldehyde
 pdb|1NBF|E Chain E, Crystal Structure Of A Ubp-Family Deubiquitinating Enzyme
           In Isolation And In Complex With Ubiquitin Aldehyde
          Length = 353

 Score = 27.7 bits (60), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 6/50 (12%)

Query: 24  TSPLAPALYVLGDSLLDSGNNN------YLQTIIKANYSPYGEDFVNKCT 67
           T P  PA Y+L   L+ SG+N+      YL       +  + +D V++CT
Sbjct: 233 TDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCT 282


>pdb|3MCP|A Chain A, Crystal Structure Of Glucokinase (Bdi_1628) From
          Parabactero Distasonis Atcc 8503 At 3.00 A Resolution
          Length = 366

 Score = 26.6 bits (57), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 12/64 (18%)

Query: 39 LDSGNNNYLQTIIKANYS-------PYGEDFVNKCTGRFSNGKTVADFIAEFLGLPYAPP 91
          LD+G  N++ + I+           P   D ++KC G    G     F A   GLP AP 
Sbjct: 14 LDAGGTNFVFSAIQGGKEIADPVVLPACADCLDKCLGNLVEG-----FKAIQAGLPEAPV 68

Query: 92 FLSF 95
           +SF
Sbjct: 69 AISF 72


>pdb|2W6C|X Chain X, Ache In Complex With A Bis-(-)-Nor-Meptazinol Derivative
 pdb|2W9I|A Chain A, Ache In Complex With Methylene Blue
          Length = 586

 Score = 25.4 bits (54), Expect = 7.9,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 58  YGEDFVNKCTGRFSNGKT--VADFIAEFLGLPYA-PPFLSF---KPRDKLPLTGLNYAS 110
           + E  VN  +G+    +   ++  I+ FLG+P+A PP  +    +P  K P +G+  AS
Sbjct: 24  HSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNAS 82


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.140    0.430 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,812,018
Number of Sequences: 62578
Number of extensions: 148588
Number of successful extensions: 337
Number of sequences better than 100.0: 15
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 329
Number of HSP's gapped (non-prelim): 15
length of query: 126
length of database: 14,973,337
effective HSP length: 87
effective length of query: 39
effective length of database: 9,529,051
effective search space: 371632989
effective search space used: 371632989
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)