Query 035821
Match_columns 126
No_of_seqs 120 out of 1054
Neff 6.1
Searched_HMMs 46136
Date Fri Mar 29 06:43:54 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035821.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035821hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PLN03156 GDSL esterase/lipase; 100.0 1.2E-32 2.6E-37 226.1 9.6 97 24-120 23-121 (351)
2 cd01837 SGNH_plant_lipase_like 99.9 3.1E-28 6.8E-33 195.1 6.7 91 29-120 1-92 (315)
3 PRK15381 pathogenicity island 99.8 4E-21 8.8E-26 161.2 5.3 71 26-117 140-210 (408)
4 cd01847 Triacylglycerol_lipase 99.8 7.1E-20 1.5E-24 144.6 5.7 75 28-120 1-75 (281)
5 cd01846 fatty_acyltransferase_ 99.7 4.3E-17 9.3E-22 127.0 5.7 71 30-119 1-71 (270)
6 COG3240 Phospholipase/lecithin 98.4 5.6E-07 1.2E-11 75.1 6.2 91 24-119 25-122 (370)
7 PF00657 Lipase_GDSL: GDSL-lik 97.1 8.1E-05 1.8E-09 55.0 -0.9 54 31-116 1-54 (234)
8 PF07172 GRP: Glycine rich pro 84.6 0.73 1.6E-05 31.7 2.0 24 1-24 1-25 (95)
9 cd01844 SGNH_hydrolase_like_6 81.7 1.9 4.2E-05 31.2 3.4 12 30-41 1-12 (177)
10 cd01832 SGNH_hydrolase_like_1 79.6 1.8 3.9E-05 31.1 2.6 11 30-40 1-11 (185)
11 cd01839 SGNH_arylesterase_like 78.4 2.8 6E-05 31.0 3.4 55 30-116 1-55 (208)
12 cd01823 SEST_like SEST_like. A 61.0 21 0.00047 27.1 5.0 33 73-119 31-63 (259)
13 PF14606 Lipase_GDSL_3: GDSL-l 58.8 6.2 0.00013 30.1 1.6 35 29-88 2-36 (178)
14 PRK09810 entericidin A; Provis 57.8 9.1 0.0002 22.6 1.8 8 1-8 1-8 (41)
15 PRK10081 entericidin B membran 52.1 14 0.0003 22.5 2.1 22 1-22 1-23 (48)
16 PRK15206 long polar fimbrial p 52.0 17 0.00037 30.7 3.3 44 1-44 1-54 (359)
17 cd01821 Rhamnogalacturan_acety 45.2 11 0.00025 27.5 1.1 15 29-43 1-15 (198)
18 PRK10528 multifunctional acyl- 44.1 15 0.00032 27.2 1.6 15 28-42 10-24 (191)
19 PF08282 Hydrolase_3: haloacid 43.8 10 0.00022 27.8 0.7 15 27-41 201-215 (254)
20 cd01830 XynE_like SGNH_hydrola 43.2 10 0.00023 28.0 0.7 13 30-42 1-13 (204)
21 COG5510 Predicted small secret 42.9 27 0.00059 20.9 2.3 36 1-43 1-37 (44)
22 COG5633 Predicted periplasmic 41.7 27 0.00058 25.3 2.5 39 2-40 1-39 (123)
23 cd01841 NnaC_like NnaC (CMP-Ne 38.4 16 0.00034 26.0 0.9 13 29-41 1-13 (174)
24 PRK03669 mannosyl-3-phosphogly 38.0 20 0.00044 27.9 1.6 16 27-42 205-220 (271)
25 cd01825 SGNH_hydrolase_peri1 S 37.6 15 0.00032 26.2 0.7 14 30-43 1-14 (189)
26 PF12710 HAD: haloacid dehalog 36.7 23 0.00051 25.2 1.6 16 26-41 173-188 (192)
27 cd00229 SGNH_hydrolase SGNH_hy 36.5 16 0.00035 24.5 0.7 15 31-45 1-15 (187)
28 TIGR01486 HAD-SF-IIB-MPGP mann 36.2 22 0.00047 27.4 1.5 17 28-44 194-210 (256)
29 TIGR02463 MPGP_rel mannosyl-3- 35.5 22 0.00047 26.5 1.4 15 27-41 194-208 (221)
30 cd01827 sialate_O-acetylestera 34.1 21 0.00045 25.6 1.0 11 30-40 2-12 (188)
31 cd01834 SGNH_hydrolase_like_2 33.7 25 0.00054 24.9 1.4 14 29-42 2-15 (191)
32 PF08139 LPAM_1: Prokaryotic m 32.3 30 0.00065 18.2 1.2 8 1-8 6-13 (25)
33 KOG3035 Isoamyl acetate-hydrol 32.2 23 0.0005 28.3 1.1 19 26-44 4-22 (245)
34 PRK10513 sugar phosphate phosp 31.7 17 0.00037 27.9 0.2 16 27-42 211-226 (270)
35 cd04501 SGNH_hydrolase_like_4 30.9 25 0.00055 25.1 1.0 11 30-40 2-12 (183)
36 TIGR01779 TonB-B12 TonB-depend 30.4 55 0.0012 28.2 3.1 37 1-37 1-37 (614)
37 PRK10976 putative hydrolase; P 30.2 18 0.0004 27.7 0.2 16 27-42 205-220 (266)
38 TIGR01488 HAD-SF-IB Haloacid D 29.8 18 0.0004 25.6 0.1 14 28-41 158-171 (177)
39 PRK01158 phosphoglycolate phos 29.5 20 0.00043 26.7 0.3 15 28-42 173-187 (230)
40 TIGR01487 SPP-like sucrose-pho 29.1 28 0.00061 25.9 1.0 15 28-42 163-177 (215)
41 cd01831 Endoglucanase_E_like E 28.3 25 0.00055 25.0 0.6 45 30-87 1-45 (169)
42 cd01824 Phospholipase_B_like P 28.3 1.6E+02 0.0034 23.6 5.3 92 25-119 7-98 (288)
43 PF03996 Hema_esterase: Hemagg 27.8 37 0.0008 27.3 1.5 17 29-45 45-64 (258)
44 cd01822 Lysophospholipase_L1_l 27.7 31 0.00067 24.2 1.0 11 30-40 2-12 (177)
45 COG4030 Uncharacterized protei 27.6 34 0.00074 27.9 1.3 16 26-42 205-220 (315)
46 TIGR01485 SPP_plant-cyano sucr 27.5 30 0.00064 26.5 0.9 17 27-43 182-198 (249)
47 cd01828 sialate_O-acetylestera 27.1 30 0.00064 24.4 0.8 12 30-41 1-12 (169)
48 cd04506 SGNH_hydrolase_YpmR_li 26.8 27 0.00059 25.4 0.6 12 30-41 1-12 (204)
49 cd01835 SGNH_hydrolase_like_3 26.7 37 0.00081 24.5 1.3 12 29-40 2-13 (193)
50 TIGR01482 SPP-subfamily Sucros 26.7 26 0.00056 25.9 0.4 15 27-41 164-178 (225)
51 PLN02954 phosphoserine phospha 26.6 33 0.00072 25.4 1.0 16 28-43 169-184 (224)
52 COG0561 Cof Predicted hydrolas 26.3 32 0.0007 26.4 0.9 17 28-44 205-221 (264)
53 PRK15126 thiamin pyrimidine py 25.8 25 0.00053 27.2 0.2 16 27-42 203-218 (272)
54 PRK10530 pyridoxal phosphate ( 25.7 25 0.00055 26.8 0.2 16 27-42 214-229 (272)
55 PRK10523 lipoprotein involved 25.2 98 0.0021 24.7 3.5 19 1-19 1-19 (234)
56 PF06316 Ail_Lom: Enterobacter 25.2 74 0.0016 24.8 2.7 12 2-13 1-12 (199)
57 PF05116 S6PP: Sucrose-6F-phos 24.4 33 0.00071 26.7 0.7 15 28-42 181-195 (247)
58 cd01838 Isoamyl_acetate_hydrol 23.9 37 0.0008 24.1 0.8 13 30-42 1-13 (199)
59 PRK00192 mannosyl-3-phosphogly 23.3 44 0.00095 26.0 1.2 17 27-43 205-222 (273)
60 PLN02382 probable sucrose-phos 23.2 38 0.00083 28.7 0.9 16 27-42 193-208 (413)
61 TIGR00099 Cof-subfamily Cof su 22.6 38 0.00082 25.8 0.7 16 27-42 203-218 (256)
62 cd01836 FeeA_FeeB_like SGNH_hy 22.5 43 0.00093 24.0 0.9 11 30-40 4-14 (191)
63 cd01427 HAD_like Haloacid deha 21.5 43 0.00092 21.6 0.7 15 27-41 112-126 (139)
64 cd01829 SGNH_hydrolase_peri2 S 21.3 43 0.00092 24.2 0.7 12 30-41 1-12 (200)
65 cd01820 PAF_acetylesterase_lik 21.3 52 0.0011 24.5 1.2 14 28-41 32-45 (214)
66 PF13956 Ibs_toxin: Toxin Ibs, 20.7 55 0.0012 16.1 0.8 7 1-7 1-7 (19)
67 PF10731 Anophelin: Thrombin i 20.6 1.2E+02 0.0026 19.4 2.5 12 1-12 1-12 (65)
68 TIGR02471 sucr_syn_bact_C sucr 20.5 47 0.001 25.1 0.8 15 28-42 175-189 (236)
No 1
>PLN03156 GDSL esterase/lipase; Provisional
Probab=99.98 E-value=1.2e-32 Score=226.12 Aligned_cols=97 Identities=42% Similarity=0.683 Sum_probs=85.9
Q ss_pred CCCCCCeEEEcCCchhccCCCCcchhhhhcCCCCCCCCCCC-CCCcCCCCCcchhhhHHHhcCC-CCCCCCCCCCCCCCC
Q 035821 24 TSPLAPALYVLGDSLLDSGNNNYLQTIIKANYSPYGEDFVN-KCTGRFSNGKTVADFIAEFLGL-PYAPPFLSFKPRDKL 101 (126)
Q Consensus 24 ~~~~~~~lfvFGDSlsDtGN~~~~~~~~~~~~~PyG~~~~~-~ptgRfsnG~~~~d~la~~lgl-~~~p~yl~~~~~~~~ 101 (126)
....+++||+||||++|+||++++.+..+++++|||++||+ +|+|||||||+|+||||+.||+ |.+|||+.+.....+
T Consensus 23 ~~~~~~aifvFGDSl~D~GN~~~l~~~~~~~~~pyG~~f~~~~ptGRfSnGr~~~D~iA~~lGl~p~~ppyl~~~~~~~~ 102 (351)
T PLN03156 23 TCAKVPAIIVFGDSSVDAGNNNQISTVAKSNFEPYGRDFPGGRPTGRFCNGRIAPDFISEAFGLKPAIPAYLDPSYNISD 102 (351)
T ss_pred ccCCCCEEEEecCcCccCCCccccccccccCCCCCCCCCCCCCCCccccCCChhhhhHHHHhCCCCCCCCCcCcccCchh
Confidence 35669999999999999999877665567899999999986 5999999999999999999999 799999987544567
Q ss_pred CCCcceeeeecceeccCCC
Q 035821 102 PLTGLNYASGACGILRDTG 120 (126)
Q Consensus 102 ~~~G~NFA~gGA~~~~~~~ 120 (126)
+.+|+|||+||+++++.+.
T Consensus 103 ~~~GvNFA~agag~~~~~~ 121 (351)
T PLN03156 103 FATGVCFASAGTGYDNATS 121 (351)
T ss_pred hcccceeecCCccccCCCc
Confidence 8999999999999988765
No 2
>cd01837 SGNH_plant_lipase_like SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=99.95 E-value=3.1e-28 Score=195.13 Aligned_cols=91 Identities=62% Similarity=1.031 Sum_probs=78.1
Q ss_pred CeEEEcCCchhccCCCCcchhhhhcCCCCCCCCCCCCCCcCCCCCcchhhhHHHhcCCCC-CCCCCCCCCCCCCCCCcce
Q 035821 29 PALYVLGDSLLDSGNNNYLQTIIKANYSPYGEDFVNKCTGRFSNGKTVADFIAEFLGLPY-APPFLSFKPRDKLPLTGLN 107 (126)
Q Consensus 29 ~~lfvFGDSlsDtGN~~~~~~~~~~~~~PyG~~~~~~ptgRfsnG~~~~d~la~~lgl~~-~p~yl~~~~~~~~~~~G~N 107 (126)
++||+||||++|+||+.++....+++.+|||++||++|+||||||++|+|+||+.||+|. +|||+.... ..++.+|+|
T Consensus 1 ~al~vFGDS~sD~Gn~~~~~~~~~~~~~PyG~~~~~~p~GRfSnG~~~~d~la~~lgl~~~~p~~~~~~~-~~~~~~G~N 79 (315)
T cd01837 1 PALFVFGDSLVDTGNNNYLPTLAKANFPPYGIDFPGRPTGRFSNGRLIIDFIAEALGLPLLPPPYLSPNG-SSDFLTGVN 79 (315)
T ss_pred CcEEEecCccccCCCccccccccccCCCCCcCcCCCCCCccccCCchhhhhhhhhccCCCCCCCccCccc-cchhhccce
Confidence 579999999999999876554445789999999999999999999999999999999996 777776532 246788999
Q ss_pred eeeecceeccCCC
Q 035821 108 YASGACGILRDTG 120 (126)
Q Consensus 108 FA~gGA~~~~~~~ 120 (126)
||+|||++++.+.
T Consensus 80 fA~gGA~~~~~~~ 92 (315)
T cd01837 80 FASGGAGILDSTG 92 (315)
T ss_pred ecccCCccccCCc
Confidence 9999999998764
No 3
>PRK15381 pathogenicity island 2 effector protein SseJ; Provisional
Probab=99.83 E-value=4e-21 Score=161.22 Aligned_cols=71 Identities=35% Similarity=0.501 Sum_probs=60.0
Q ss_pred CCCCeEEEcCCchhccCCCCcchhhhhcCCCCCCCCCCCCCCcCCCCCcchhhhHHHhcCCCCCCCCCCCCCCCCCCCCc
Q 035821 26 PLAPALYVLGDSLLDSGNNNYLQTIIKANYSPYGEDFVNKCTGRFSNGKTVADFIAEFLGLPYAPPFLSFKPRDKLPLTG 105 (126)
Q Consensus 26 ~~~~~lfvFGDSlsDtGN~~~~~~~~~~~~~PyG~~~~~~ptgRfsnG~~~~d~la~~lgl~~~p~yl~~~~~~~~~~~G 105 (126)
..+++||+||||++|+||+.+..+. ..+||||.+| +||||||++|+|||| .|||++. +|
T Consensus 140 ~~~~ai~vFGDSlsDtGnn~y~~t~--~~~PPyG~~f----tGRFSNG~v~~DfLA-------~~pyl~~--------~G 198 (408)
T PRK15381 140 GDITRLVFFGDSLSDSLGRMFEKTH--HILPSYGQYF----GGRFTNGFTWTEFLS-------SPHFLGK--------EM 198 (408)
T ss_pred CCCCeEEEeCCccccCCCccccccc--cCCCCCCCCC----CcccCCCchhhheec-------cccccCC--------CC
Confidence 5799999999999999887554322 4689999998 899999999999999 4678751 69
Q ss_pred ceeeeecceecc
Q 035821 106 LNYASGACGILR 117 (126)
Q Consensus 106 ~NFA~gGA~~~~ 117 (126)
+|||+|||+++.
T Consensus 199 ~NFA~GGA~~~t 210 (408)
T PRK15381 199 LNFAEGGSTSAS 210 (408)
T ss_pred ceEeeccccccc
Confidence 999999999973
No 4
>cd01847 Triacylglycerol_lipase_like Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
Probab=99.79 E-value=7.1e-20 Score=144.57 Aligned_cols=75 Identities=23% Similarity=0.203 Sum_probs=60.6
Q ss_pred CCeEEEcCCchhccCCCCcchhhhhcCCCCCCCCCCCCCCcCCCCCcchhhhHHHhcCCCCCCCCCCCCCCCCCCCCcce
Q 035821 28 APALYVLGDSLLDSGNNNYLQTIIKANYSPYGEDFVNKCTGRFSNGKTVADFIAEFLGLPYAPPFLSFKPRDKLPLTGLN 107 (126)
Q Consensus 28 ~~~lfvFGDSlsDtGN~~~~~~~~~~~~~PyG~~~~~~ptgRfsnG~~~~d~la~~lgl~~~p~yl~~~~~~~~~~~G~N 107 (126)
|++||+||||++|+||++++. + +.+|+||||||++++|++++.+|++.+ +.. ...+..+|+|
T Consensus 1 ~~~i~vFGDSl~D~Gn~~~~~--------~-----~~~~~gRFsnG~~~~d~~~~~~~~~~~---~~~--~~~~~~~G~N 62 (281)
T cd01847 1 FSRVVVFGDSLSDVGTYNRAG--------V-----GAAGGGRFTVNDGSIWSLGVAEGYGLT---TGT--ATPTTPGGTN 62 (281)
T ss_pred CCceEEecCcccccCCCCccc--------c-----CCCCCcceecCCcchHHHHHHHHcCCC---cCc--CcccCCCCce
Confidence 589999999999999987532 1 135899999999999999999999754 222 2346788999
Q ss_pred eeeecceeccCCC
Q 035821 108 YASGACGILRDTG 120 (126)
Q Consensus 108 FA~gGA~~~~~~~ 120 (126)
||+|||++++.+.
T Consensus 63 fA~gGa~~~~~~~ 75 (281)
T cd01847 63 YAQGGARVGDTNN 75 (281)
T ss_pred eeccCccccCCCC
Confidence 9999999998654
No 5
>cd01846 fatty_acyltransferase_like Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
Probab=99.68 E-value=4.3e-17 Score=126.99 Aligned_cols=71 Identities=37% Similarity=0.436 Sum_probs=54.6
Q ss_pred eEEEcCCchhccCCCCcchhhhhcCCCCCCCCCCCCCCcCCCCCcchhhhHHHhcCCCCCCCCCCCCCCCCCCCCcceee
Q 035821 30 ALYVLGDSLLDSGNNNYLQTIIKANYSPYGEDFVNKCTGRFSNGKTVADFIAEFLGLPYAPPFLSFKPRDKLPLTGLNYA 109 (126)
Q Consensus 30 ~lfvFGDSlsDtGN~~~~~~~~~~~~~PyG~~~~~~ptgRfsnG~~~~d~la~~lgl~~~p~yl~~~~~~~~~~~G~NFA 109 (126)
++|+||||++|+||...+... ..+|.+. ..|+||||||++|+|+||+.+|++. ...|+|||
T Consensus 1 ~l~vFGDS~sD~Gn~~~~~~~---~~~~~~~---~~~~grfsnG~~w~d~la~~lg~~~-------------~~~~~N~A 61 (270)
T cd01846 1 RLVVFGDSLSDTGNIFKLTGG---SNPPPSP---PYFGGRFSNGPVWVEYLAATLGLSG-------------LKQGYNYA 61 (270)
T ss_pred CeEEeeCccccCCcchhhcCC---CCCCCCC---CCCCCccCCchhHHHHHHHHhCCCc-------------cCCcceeE
Confidence 489999999999998543211 1223322 3478999999999999999999864 34689999
Q ss_pred eecceeccCC
Q 035821 110 SGACGILRDT 119 (126)
Q Consensus 110 ~gGA~~~~~~ 119 (126)
++||++.+..
T Consensus 62 ~~Ga~~~~~~ 71 (270)
T cd01846 62 VGGATAGAYN 71 (270)
T ss_pred ecccccCCcc
Confidence 9999998764
No 6
>COG3240 Phospholipase/lecithinase/hemolysin [Lipid metabolism / General function prediction only]
Probab=98.41 E-value=5.6e-07 Score=75.11 Aligned_cols=91 Identities=22% Similarity=0.188 Sum_probs=53.6
Q ss_pred CCCCCCeEEEcCCchhccCCCCcchhhhhcCCCCCCCCCCCCCCcCCCC--CcchhhhHHHhcC---CC--CCCCCCCCC
Q 035821 24 TSPLAPALYVLGDSLLDSGNNNYLQTIIKANYSPYGEDFVNKCTGRFSN--GKTVADFIAEFLG---LP--YAPPFLSFK 96 (126)
Q Consensus 24 ~~~~~~~lfvFGDSlsDtGN~~~~~~~~~~~~~PyG~~~~~~ptgRfsn--G~~~~d~la~~lg---l~--~~p~yl~~~ 96 (126)
..+++..++|||||+||+|+...... ... .| ..|-..|-.++++ |.+|++..++.|| ++ ..-...+++
T Consensus 25 ~~~~~~~l~vfGDSlSDsg~~~~~a~--~~~-~~--~~~~~~~gp~~~~G~~~~~~~~~p~~lg~l~~~~~~~~~~~~~~ 99 (370)
T COG3240 25 SLAPFQRLVVFGDSLSDSGNYYRPAG--HHG-DP--GSYGTIPGPSYQNGNGYTYVTVVPETLGQLGVNHDFTYAAADPN 99 (370)
T ss_pred cccccceEEEeccchhhcccccCccc--ccC-Cc--cccccccCCcccCCCceeeeccchhhhccccccccccccccCcc
Confidence 34789999999999999999853210 111 11 1222224445555 6778888888888 11 110111121
Q ss_pred CCCCCCCCcceeeeecceeccCC
Q 035821 97 PRDKLPLTGLNYASGACGILRDT 119 (126)
Q Consensus 97 ~~~~~~~~G~NFA~gGA~~~~~~ 119 (126)
....-...|.|||+||+++....
T Consensus 100 ~~~~~~a~gnd~A~gga~~~~~~ 122 (370)
T COG3240 100 GLYIHWAGGNDLAVGGARSTEPN 122 (370)
T ss_pred cccCcccccccHhhhcccccccc
Confidence 11111257999999999876554
No 7
>PF00657 Lipase_GDSL: GDSL-like Lipase/Acylhydrolase; InterPro: IPR001087 A variety of lipolytic enzymes with serine as part of the active site have been identified []. Members of this entry include; Aeromonas hydrophila lipase, Vibrio mimicus arylesterase, Vibrio parahaemolyticus thermolabile haemolysin, rabbit phospholipase (AdRab-B), and Brassica napus anter-specific proline-rich protein.; GO: 0016788 hydrolase activity, acting on ester bonds, 0006629 lipid metabolic process; PDB: 2WAO_A 2WAB_A 1V2G_A 1U8U_A 1JRL_A 1IVN_A 1J00_A 1DEO_A 1K7C_A 1PP4_A ....
Probab=97.10 E-value=8.1e-05 Score=54.99 Aligned_cols=54 Identities=28% Similarity=0.215 Sum_probs=34.4
Q ss_pred EEEcCCchhccCCCCcchhhhhcCCCCCCCCCCCCCCcCCCCCcchhhhHHHhcCCCCCCCCCCCCCCCCCCCCcceeee
Q 035821 31 LYVLGDSLLDSGNNNYLQTIIKANYSPYGEDFVNKCTGRFSNGKTVADFIAEFLGLPYAPPFLSFKPRDKLPLTGLNYAS 110 (126)
Q Consensus 31 lfvFGDSlsDtGN~~~~~~~~~~~~~PyG~~~~~~ptgRfsnG~~~~d~la~~lgl~~~p~yl~~~~~~~~~~~G~NFA~ 110 (126)
|++||||++|. +|+++|..|.+.+++.+.-.....+ ........|+|.
T Consensus 1 i~~fGDS~td~--------------------------~~~~~~~~~~~~~~~~l~~~~~~~~------~~~~~~~~n~a~ 48 (234)
T PF00657_consen 1 IVVFGDSLTDG--------------------------GGDSNGGGWPEGLANNLSSCLGANQ------RNSGVDVSNYAI 48 (234)
T ss_dssp EEEEESHHHHT--------------------------TTSSTTCTHHHHHHHHCHHCCHHHH------HCTTEEEEEEE-
T ss_pred CEEEeehhccc--------------------------CCCCCCcchhhhHHHHHhhcccccc------CCCCCCeecccc
Confidence 68999999997 4668889999999887732210000 011345779999
Q ss_pred ecceec
Q 035821 111 GACGIL 116 (126)
Q Consensus 111 gGA~~~ 116 (126)
+|+++.
T Consensus 49 ~G~~~~ 54 (234)
T PF00657_consen 49 SGATSD 54 (234)
T ss_dssp TT--CC
T ss_pred CCCccc
Confidence 998853
No 8
>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=84.56 E-value=0.73 Score=31.73 Aligned_cols=24 Identities=29% Similarity=0.321 Sum_probs=15.2
Q ss_pred CcchhhHHHHH-HHHHHHHhhcCCC
Q 035821 1 MISKYCITSSF-IFLLFIISSTNGT 24 (126)
Q Consensus 1 m~~~~~~~~~~-~~~~~~l~~~~~~ 24 (126)
|.||..++..| ++++|++|+.+++
T Consensus 1 MaSK~~llL~l~LA~lLlisSevaa 25 (95)
T PF07172_consen 1 MASKAFLLLGLLLAALLLISSEVAA 25 (95)
T ss_pred CchhHHHHHHHHHHHHHHHHhhhhh
Confidence 88888655433 4456667766654
No 9
>cd01844 SGNH_hydrolase_like_6 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=81.68 E-value=1.9 Score=31.21 Aligned_cols=12 Identities=17% Similarity=0.263 Sum_probs=10.0
Q ss_pred eEEEcCCchhcc
Q 035821 30 ALYVLGDSLLDS 41 (126)
Q Consensus 30 ~lfvFGDSlsDt 41 (126)
+|++||||++.-
T Consensus 1 ~iv~~GDSit~G 12 (177)
T cd01844 1 PWVFYGTSISQG 12 (177)
T ss_pred CEEEEeCchhcC
Confidence 478999999884
No 10
>cd01832 SGNH_hydrolase_like_1 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.
Probab=79.57 E-value=1.8 Score=31.12 Aligned_cols=11 Identities=36% Similarity=0.610 Sum_probs=9.6
Q ss_pred eEEEcCCchhc
Q 035821 30 ALYVLGDSLLD 40 (126)
Q Consensus 30 ~lfvFGDSlsD 40 (126)
+|.+||||+++
T Consensus 1 ~i~~~GDSit~ 11 (185)
T cd01832 1 RYVALGDSITE 11 (185)
T ss_pred CeeEecchhhc
Confidence 47899999998
No 11
>cd01839 SGNH_arylesterase_like SGNH_hydrolase subfamily, similar to arylesterase (7-aminocephalosporanic acid-deacetylating enzyme) of A. tumefaciens. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=78.35 E-value=2.8 Score=31.05 Aligned_cols=55 Identities=16% Similarity=0.133 Sum_probs=32.8
Q ss_pred eEEEcCCchhccCCCCcchhhhhcCCCCCCCCCCCCCCcCCCCCcchhhhHHHhcCCCCCCCCCCCCCCCCCCCCcceee
Q 035821 30 ALYVLGDSLLDSGNNNYLQTIIKANYSPYGEDFVNKCTGRFSNGKTVADFIAEFLGLPYAPPFLSFKPRDKLPLTGLNYA 109 (126)
Q Consensus 30 ~lfvFGDSlsDtGN~~~~~~~~~~~~~PyG~~~~~~ptgRfsnG~~~~d~la~~lgl~~~p~yl~~~~~~~~~~~G~NFA 109 (126)
.|+.||||++. |-. +-+ .+|+..+..|+..|++.|+-.. +.+ .=+|.+
T Consensus 1 ~I~~~GDSiT~-G~~------------~~~-------~~~~~~~~~w~~~L~~~l~~~~-~~~-----------~viN~G 48 (208)
T cd01839 1 TILCFGDSNTW-GII------------PDT-------GGRYPFEDRWPGVLEKALGANG-ENV-----------RVIEDG 48 (208)
T ss_pred CEEEEecCccc-CCC------------CCC-------CCcCCcCCCCHHHHHHHHccCC-CCe-----------EEEecC
Confidence 37889999975 321 000 1245556679999999876432 111 124777
Q ss_pred eecceec
Q 035821 110 SGACGIL 116 (126)
Q Consensus 110 ~gGA~~~ 116 (126)
.+|.+..
T Consensus 49 v~G~tt~ 55 (208)
T cd01839 49 LPGRTTV 55 (208)
T ss_pred cCCccee
Confidence 7777653
No 12
>cd01823 SEST_like SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
Probab=60.97 E-value=21 Score=27.10 Aligned_cols=33 Identities=15% Similarity=0.139 Sum_probs=23.5
Q ss_pred CcchhhhHHHhcCCCCCCCCCCCCCCCCCCCCcceeeeecceeccCC
Q 035821 73 GKTVADFIAEFLGLPYAPPFLSFKPRDKLPLTGLNYASGACGILRDT 119 (126)
Q Consensus 73 G~~~~d~la~~lgl~~~p~yl~~~~~~~~~~~G~NFA~gGA~~~~~~ 119 (126)
.+.|++++++.|+.. + ..=.|+|..|+++.+..
T Consensus 31 ~~~y~~~la~~l~~~---~-----------~~~~n~a~sGa~~~~~~ 63 (259)
T cd01823 31 SNSYPTLLARALGDE---T-----------LSFTDVACSGATTTDGI 63 (259)
T ss_pred CccHHHHHHHHcCCC---C-----------ceeeeeeecCccccccc
Confidence 366899999998864 1 11248999999877654
No 13
>PF14606 Lipase_GDSL_3: GDSL-like Lipase/Acylhydrolase family; PDB: 3SKV_B.
Probab=58.80 E-value=6.2 Score=30.09 Aligned_cols=35 Identities=20% Similarity=0.271 Sum_probs=20.9
Q ss_pred CeEEEcCCchhccCCCCcchhhhhcCCCCCCCCCCCCCCcCCCCCcchhhhHHHhcCCCC
Q 035821 29 PALYVLGDSLLDSGNNNYLQTIIKANYSPYGEDFVNKCTGRFSNGKTVADFIAEFLGLPY 88 (126)
Q Consensus 29 ~~lfvFGDSlsDtGN~~~~~~~~~~~~~PyG~~~~~~ptgRfsnG~~~~d~la~~lgl~~ 88 (126)
+.+++.|+|++..+... +.|..|+-.+++.+|+++
T Consensus 2 k~~v~YGsSItqG~~As-------------------------rpg~~~~~~~aR~l~~~~ 36 (178)
T PF14606_consen 2 KRWVAYGSSITQGACAS-------------------------RPGMAYPAILARRLGLDV 36 (178)
T ss_dssp -EEEEEE-TT-TTTT-S-------------------------SGGGSHHHHHHHHHT-EE
T ss_pred CeEEEECChhhcCCCCC-------------------------CCcccHHHHHHHHcCCCe
Confidence 46788888888765431 224568888888888753
No 14
>PRK09810 entericidin A; Provisional
Probab=57.79 E-value=9.1 Score=22.56 Aligned_cols=8 Identities=13% Similarity=0.430 Sum_probs=6.3
Q ss_pred CcchhhHH
Q 035821 1 MISKYCIT 8 (126)
Q Consensus 1 m~~~~~~~ 8 (126)
||||..++
T Consensus 1 mMkk~~~l 8 (41)
T PRK09810 1 MMKRLIVL 8 (41)
T ss_pred ChHHHHHH
Confidence 89987765
No 15
>PRK10081 entericidin B membrane lipoprotein; Provisional
Probab=52.14 E-value=14 Score=22.51 Aligned_cols=22 Identities=23% Similarity=0.326 Sum_probs=11.3
Q ss_pred CcchhhHH-HHHHHHHHHHhhcC
Q 035821 1 MISKYCIT-SSFIFLLFIISSTN 22 (126)
Q Consensus 1 m~~~~~~~-~~~~~~~~~l~~~~ 22 (126)
||||.... .+++++++.++.++
T Consensus 1 MmKk~i~~i~~~l~~~~~l~~Cn 23 (48)
T PRK10081 1 MVKKTIAAIFSVLVLSTVLTACN 23 (48)
T ss_pred ChHHHHHHHHHHHHHHHHHhhhh
Confidence 88886643 23334444455443
No 16
>PRK15206 long polar fimbrial protein LpfD; Provisional
Probab=52.02 E-value=17 Score=30.66 Aligned_cols=44 Identities=14% Similarity=0.197 Sum_probs=23.2
Q ss_pred CcchhhHHHHHHHHHHHHhhcC--CC--CCC------CCeEEEcCCchhccCCC
Q 035821 1 MISKYCITSSFIFLLFIISSTN--GT--SPL------APALYVLGDSLLDSGNN 44 (126)
Q Consensus 1 m~~~~~~~~~~~~~~~~l~~~~--~~--~~~------~~~lfvFGDSlsDtGN~ 44 (126)
||+|+.+.+.+++.+++++..+ ++ ..| +.--+.|.+.+.|.=++
T Consensus 1 ~~~k~~~~~~~l~~~~~~~~~a~~a~~~G~C~~~gGt~~y~~~~~~~~~~~~~N 54 (359)
T PRK15206 1 MLKKLMMFTGLLGGSVLFSGQALAAADWGPCTPEGGTHIFSATINKTISDTSKN 54 (359)
T ss_pred ChHHHHHHHHHHHHHHHhccchhhcccCCcccCCCCcEEEEEeccceecccccC
Confidence 8899865544444444333333 21 123 33445677877776444
No 17
>cd01821 Rhamnogalacturan_acetylesterase_like Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
Probab=45.16 E-value=11 Score=27.49 Aligned_cols=15 Identities=27% Similarity=0.647 Sum_probs=12.0
Q ss_pred CeEEEcCCchhccCC
Q 035821 29 PALYVLGDSLLDSGN 43 (126)
Q Consensus 29 ~~lfvFGDSlsDtGN 43 (126)
++|++||||++.-..
T Consensus 1 ~~i~~~GDS~t~G~~ 15 (198)
T cd01821 1 PTIFLAGDSTVADYD 15 (198)
T ss_pred CEEEEEecCCcccCC
Confidence 578999999988543
No 18
>PRK10528 multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1; Provisional
Probab=44.12 E-value=15 Score=27.15 Aligned_cols=15 Identities=47% Similarity=0.554 Sum_probs=12.7
Q ss_pred CCeEEEcCCchhccC
Q 035821 28 APALYVLGDSLLDSG 42 (126)
Q Consensus 28 ~~~lfvFGDSlsDtG 42 (126)
-..|++||||+++-.
T Consensus 10 ~~~iv~~GDSit~G~ 24 (191)
T PRK10528 10 ADTLLILGDSLSAGY 24 (191)
T ss_pred CCEEEEEeCchhhcC
Confidence 579999999999753
No 19
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification []. This HAD domain is found in several distinct enzymes including: Phospholipid-transporting ATPase 1 (3.6.3.1 from EC), a putative lipid-flipping enzyme involved in cold tolerance in Arabidopsis [] 3-deoxy-D-manno-octulosonate (KDO) 8-phosphate phosphatase (3.1.3.45 from EC), which catalyses the final step in the biosynthesis of KDO - a component of lipopolysaccharide in Gram-negative bacteria [] Mannosyl-3-phosphoglycerate phosphatase (3.1.3.70 from EC), which hydrolyzes mannosyl-3-phosphoglycerate to form the osmolyte mannosylglycerate [] Phosphoglycolate phopshatase (3.1.3.18 from EC), which catalyses the dephosphorylation of 2-phosphoglycolate [] ; PDB: 2B30_B 3R4C_A 1XVI_B 3IJ5_B 3MMZ_C 3L7Y_A 1XPJ_C 1RLT_B 1RLM_B 2HF2_A ....
Probab=43.83 E-value=10 Score=27.79 Aligned_cols=15 Identities=27% Similarity=0.273 Sum_probs=12.8
Q ss_pred CCCeEEEcCCchhcc
Q 035821 27 LAPALYVLGDSLLDS 41 (126)
Q Consensus 27 ~~~~lfvFGDSlsDt 41 (126)
..+.+++||||.+|.
T Consensus 201 ~~~~~~~~GD~~ND~ 215 (254)
T PF08282_consen 201 SPEDIIAFGDSENDI 215 (254)
T ss_dssp SGGGEEEEESSGGGH
T ss_pred ccceeEEeecccccH
Confidence 347899999999995
No 20
>cd01830 XynE_like SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=43.24 E-value=10 Score=27.99 Aligned_cols=13 Identities=38% Similarity=0.641 Sum_probs=10.6
Q ss_pred eEEEcCCchhccC
Q 035821 30 ALYVLGDSLLDSG 42 (126)
Q Consensus 30 ~lfvFGDSlsDtG 42 (126)
.|+.||||+++-.
T Consensus 1 ~iv~~GDSiT~G~ 13 (204)
T cd01830 1 SVVALGDSITDGR 13 (204)
T ss_pred CEEEEecccccCC
Confidence 3789999999954
No 21
>COG5510 Predicted small secreted protein [Function unknown]
Probab=42.89 E-value=27 Score=20.86 Aligned_cols=36 Identities=14% Similarity=0.305 Sum_probs=18.0
Q ss_pred CcchhhHHHHH-HHHHHHHhhcCCCCCCCCeEEEcCCchhccCC
Q 035821 1 MISKYCITSSF-IFLLFIISSTNGTSPLAPALYVLGDSLLDSGN 43 (126)
Q Consensus 1 m~~~~~~~~~~-~~~~~~l~~~~~~~~~~~~lfvFGDSlsDtGN 43 (126)
||||..++..+ ++..+.+++++- +=-+|.-+.+.|.
T Consensus 1 mmk~t~l~i~~vll~s~llaaCNT-------~rG~G~DIq~~G~ 37 (44)
T COG5510 1 MMKKTILLIALVLLASTLLAACNT-------MRGAGKDIQSGGK 37 (44)
T ss_pred CchHHHHHHHHHHHHHHHHHHhhh-------hhccchhHHHHHH
Confidence 78886654433 334455554432 2334555555543
No 22
>COG5633 Predicted periplasmic lipoprotein [General function prediction only]
Probab=41.73 E-value=27 Score=25.27 Aligned_cols=39 Identities=26% Similarity=0.220 Sum_probs=17.4
Q ss_pred cchhhHHHHHHHHHHHHhhcCCCCCCCCeEEEcCCchhc
Q 035821 2 ISKYCITSSFIFLLFIISSTNGTSPLAPALYVLGDSLLD 40 (126)
Q Consensus 2 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~lfvFGDSlsD 40 (126)
|+|+|++..-++++..+++-.+....-.+-++|-||.--
T Consensus 1 Mrk~~~~~l~~~lLvGCsS~~~i~~~~~q~vvm~~s~l~ 39 (123)
T COG5633 1 MRKLCLLSLALLLLVGCSSHQEILVNDEQSVVMETSVLI 39 (123)
T ss_pred CceehHHHHHHHHhhccCCCCCccccccceeeeccccee
Confidence 789997421111222223222222223455666665443
No 23
>cd01841 NnaC_like NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.
Probab=38.39 E-value=16 Score=25.97 Aligned_cols=13 Identities=31% Similarity=0.675 Sum_probs=10.7
Q ss_pred CeEEEcCCchhcc
Q 035821 29 PALYVLGDSLLDS 41 (126)
Q Consensus 29 ~~lfvFGDSlsDt 41 (126)
+.|++||||++.-
T Consensus 1 ~~iv~~GdS~t~~ 13 (174)
T cd01841 1 KNIVFIGDSLFEG 13 (174)
T ss_pred CCEEEEcchhhhc
Confidence 4688999999974
No 24
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed
Probab=37.95 E-value=20 Score=27.87 Aligned_cols=16 Identities=31% Similarity=0.341 Sum_probs=13.5
Q ss_pred CCCeEEEcCCchhccC
Q 035821 27 LAPALYVLGDSLLDSG 42 (126)
Q Consensus 27 ~~~~lfvFGDSlsDtG 42 (126)
....++.||||.+|.-
T Consensus 205 ~~~~viafGDs~NDi~ 220 (271)
T PRK03669 205 TRPTTLGLGDGPNDAP 220 (271)
T ss_pred CCceEEEEcCCHHHHH
Confidence 4578999999999953
No 25
>cd01825 SGNH_hydrolase_peri1 SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=37.65 E-value=15 Score=26.24 Aligned_cols=14 Identities=29% Similarity=0.335 Sum_probs=11.1
Q ss_pred eEEEcCCchhccCC
Q 035821 30 ALYVLGDSLLDSGN 43 (126)
Q Consensus 30 ~lfvFGDSlsDtGN 43 (126)
+|+++|||+++.+.
T Consensus 1 ~iv~~GDS~t~g~~ 14 (189)
T cd01825 1 RIAQLGDSHIAGDF 14 (189)
T ss_pred CeeEecCccccccc
Confidence 47889999999644
No 26
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B.
Probab=36.71 E-value=23 Score=25.22 Aligned_cols=16 Identities=25% Similarity=0.258 Sum_probs=13.5
Q ss_pred CCCCeEEEcCCchhcc
Q 035821 26 PLAPALYVLGDSLLDS 41 (126)
Q Consensus 26 ~~~~~lfvFGDSlsDt 41 (126)
.....++.+|||.+|.
T Consensus 173 ~~~~~~~~iGDs~~D~ 188 (192)
T PF12710_consen 173 IDPDRVIAIGDSINDL 188 (192)
T ss_dssp HTCCEEEEEESSGGGH
T ss_pred CCCCeEEEEECCHHHH
Confidence 3578899999999995
No 27
>cd00229 SGNH_hydrolase SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=36.53 E-value=16 Score=24.50 Aligned_cols=15 Identities=27% Similarity=0.470 Sum_probs=12.4
Q ss_pred EEEcCCchhccCCCC
Q 035821 31 LYVLGDSLLDSGNNN 45 (126)
Q Consensus 31 lfvFGDSlsDtGN~~ 45 (126)
|.++|||+++..+..
T Consensus 1 i~~~GDS~~~g~~~~ 15 (187)
T cd00229 1 ILVIGDSITAGYGAS 15 (187)
T ss_pred CeeeccccccccCCC
Confidence 578999999988763
No 28
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family. This small group of proteins is a member of the IIB subfamily (TIGR01484) of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. Several members of this family from thermophiles (and from Dehalococcoides ethenogenes) are now known to act as mannosyl-3-phosphoglycerate (MPG) phosphatase. In these cases, the enzyme acts after MPG synthase to make the compatible solute mannosylglycerate. We propose that other mesophilic members of this family do not act as mannosyl-3-phosphoglycerate phosphatase. A member of this family is found in Escherichia coli, which appears to lack MPG synthase. Mannosylglycerate is imported in E. coli by phosphoenolpyruvate-dependent transporter (PubMed:14645248), but it appears the phosphorylation is not on the glycerate moiety, that the phosphorylated import is degraded by an alpha-mannosidase from an adjacent gene, and that E. coli would have no pathway to obta
Probab=36.16 E-value=22 Score=27.35 Aligned_cols=17 Identities=35% Similarity=0.081 Sum_probs=14.1
Q ss_pred CCeEEEcCCchhccCCC
Q 035821 28 APALYVLGDSLLDSGNN 44 (126)
Q Consensus 28 ~~~lfvFGDSlsDtGN~ 44 (126)
...++.||||.+|..=.
T Consensus 194 ~~~~~a~GD~~ND~~Ml 210 (256)
T TIGR01486 194 AIKVVGLGDSPNDLPLL 210 (256)
T ss_pred CceEEEEcCCHhhHHHH
Confidence 67899999999996543
No 29
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein. This family consists of members of the HAD superfamily, subfamily IIB. All members are closely related to mannosyl-3-phosphoglycerate phosphatase, the second enzyme in a two-step pathway for biosynthesis of mannosylglycerate, a compatible solute present in some thermophiles and in Dehalococcoides ethenogenes. However, members of this family are separable in a neighbor-joining tree constructed from a multiple sequence alignment and are found only in mesophiles that lack the companion mannosyl-3-phosphoglycerate synthase (TIGR02460). Members of this family are like to act on a compound related to yet distinct from mannosyl-3-phosphoglycerate.
Probab=35.47 E-value=22 Score=26.49 Aligned_cols=15 Identities=27% Similarity=0.082 Sum_probs=12.9
Q ss_pred CCCeEEEcCCchhcc
Q 035821 27 LAPALYVLGDSLLDS 41 (126)
Q Consensus 27 ~~~~lfvFGDSlsDt 41 (126)
....++.||||.+|.
T Consensus 194 ~~~~vi~~GD~~NDi 208 (221)
T TIGR02463 194 PDVKTLGLGDGPNDL 208 (221)
T ss_pred CCCcEEEECCCHHHH
Confidence 457899999999995
No 30
>cd01827 sialate_O-acetylesterase_like1 sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=34.09 E-value=21 Score=25.60 Aligned_cols=11 Identities=18% Similarity=0.492 Sum_probs=9.6
Q ss_pred eEEEcCCchhc
Q 035821 30 ALYVLGDSLLD 40 (126)
Q Consensus 30 ~lfvFGDSlsD 40 (126)
+|.++|||+++
T Consensus 2 ~i~~~GDSit~ 12 (188)
T cd01827 2 KVACVGNSITE 12 (188)
T ss_pred eEEEEeccccc
Confidence 57899999988
No 31
>cd01834 SGNH_hydrolase_like_2 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=33.68 E-value=25 Score=24.87 Aligned_cols=14 Identities=29% Similarity=0.641 Sum_probs=11.9
Q ss_pred CeEEEcCCchhccC
Q 035821 29 PALYVLGDSLLDSG 42 (126)
Q Consensus 29 ~~lfvFGDSlsDtG 42 (126)
++|.++|||++...
T Consensus 2 ~~v~~~GDSit~g~ 15 (191)
T cd01834 2 DRIVFIGNSITDRG 15 (191)
T ss_pred CEEEEeCCChhhcc
Confidence 47899999999955
No 32
>PF08139 LPAM_1: Prokaryotic membrane lipoprotein lipid attachment site; InterPro: IPR012640 In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognises a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached [,]. This lipid attachment site is found in homologues of the VirB proteins of type IV secretion systems (T4SS). Conjugal transfer across the cell envelope of Gram-negative bacteria is mediated by a supramolecular structure termed mating pair formation (Mpf) complex. Collectively, secretion pathways ancestrally related to bacterial conjugation systems are now known as T4SS. T4SS are involved in the delivery of effector molecules to eukaryotic target cells; each of these systems exports distinct DNA or protein substrates to effect a myriad of changes in host cell physiology during infection [].
Probab=32.30 E-value=30 Score=18.23 Aligned_cols=8 Identities=25% Similarity=0.376 Sum_probs=4.1
Q ss_pred CcchhhHH
Q 035821 1 MISKYCIT 8 (126)
Q Consensus 1 m~~~~~~~ 8 (126)
||||..+.
T Consensus 6 mmKkil~~ 13 (25)
T PF08139_consen 6 MMKKILFP 13 (25)
T ss_pred HHHHHHHH
Confidence 45665543
No 33
>KOG3035 consensus Isoamyl acetate-hydrolyzing esterase [Lipid transport and metabolism]
Probab=32.23 E-value=23 Score=28.35 Aligned_cols=19 Identities=26% Similarity=0.583 Sum_probs=15.8
Q ss_pred CCCCeEEEcCCchhccCCC
Q 035821 26 PLAPALYVLGDSLLDSGNN 44 (126)
Q Consensus 26 ~~~~~lfvFGDSlsDtGN~ 44 (126)
+-+++|+.||||++.-+..
T Consensus 4 ~~rp~i~LFGdSItq~sF~ 22 (245)
T KOG3035|consen 4 PMRPRIVLFGDSITQFSFT 22 (245)
T ss_pred cccccEEEecchhhhhccc
Confidence 3579999999999987665
No 34
>PRK10513 sugar phosphate phosphatase; Provisional
Probab=31.68 E-value=17 Score=27.90 Aligned_cols=16 Identities=19% Similarity=0.237 Sum_probs=13.2
Q ss_pred CCCeEEEcCCchhccC
Q 035821 27 LAPALYVLGDSLLDSG 42 (126)
Q Consensus 27 ~~~~lfvFGDSlsDtG 42 (126)
..+.+++||||.+|.-
T Consensus 211 ~~~~v~afGD~~NDi~ 226 (270)
T PRK10513 211 KPEEVMAIGDQENDIA 226 (270)
T ss_pred CHHHEEEECCchhhHH
Confidence 3568999999999953
No 35
>cd04501 SGNH_hydrolase_like_4 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=30.87 E-value=25 Score=25.07 Aligned_cols=11 Identities=36% Similarity=0.495 Sum_probs=9.7
Q ss_pred eEEEcCCchhc
Q 035821 30 ALYVLGDSLLD 40 (126)
Q Consensus 30 ~lfvFGDSlsD 40 (126)
+|.++|||+++
T Consensus 2 ~i~~~GDSi~~ 12 (183)
T cd04501 2 RVVCLGDSITY 12 (183)
T ss_pred eEEEEcccccc
Confidence 57899999998
No 36
>TIGR01779 TonB-B12 TonB-dependent vitamin B12 receptor. This model represents the TonB-dependent outer membrane receptor found in gamma proteobacteria responsible for translocating the cobalt-containing vitamin B12 (cobalamin).
Probab=30.35 E-value=55 Score=28.18 Aligned_cols=37 Identities=8% Similarity=-0.014 Sum_probs=20.1
Q ss_pred CcchhhHHHHHHHHHHHHhhcCCCCCCCCeEEEcCCc
Q 035821 1 MISKYCITSSFIFLLFIISSTNGTSPLAPALYVLGDS 37 (126)
Q Consensus 1 m~~~~~~~~~~~~~~~~l~~~~~~~~~~~~lfvFGDS 37 (126)
|.||.|+.+++-++++|.+..+..+...+.|+|=|..
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~eVvVta~r 37 (614)
T TIGR01779 1 MQKSALAPALASLLTLCSALHANEAQPLDTVVVTANR 37 (614)
T ss_pred CcchhhhHHHHHhhhhhhhhcccccCCcCcEEEEeec
Confidence 8899998854434444433222222335777776543
No 37
>PRK10976 putative hydrolase; Provisional
Probab=30.15 E-value=18 Score=27.71 Aligned_cols=16 Identities=19% Similarity=0.256 Sum_probs=13.2
Q ss_pred CCCeEEEcCCchhccC
Q 035821 27 LAPALYVLGDSLLDSG 42 (126)
Q Consensus 27 ~~~~lfvFGDSlsDtG 42 (126)
..+.+++||||.+|..
T Consensus 205 ~~~~viafGD~~NDi~ 220 (266)
T PRK10976 205 SLKDCIAFGDGMNDAE 220 (266)
T ss_pred CHHHeEEEcCCcccHH
Confidence 3478999999999954
No 38
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like. Subfamily IA includes the enzyme phosphoserine phosphatase (TIGR00338) as well as three hypothetical equivalogs. Many members of these hypothetical equivalogs have been annotated as PSPase-like or PSPase-family proteins. In particular, the hypothetical equivalog which appears to be most closely related to PSPase contains only Archaea (while TIGR00338 contains only eukaryotes and bacteria) of which some are annotated as PSPases. Although this is a reasonable conjecture, none of these sequences has sufficient evidence for this assignment. If such should be found, this model should be retired while the PSPase model should be broadened to include these sequences.
Probab=29.80 E-value=18 Score=25.56 Aligned_cols=14 Identities=29% Similarity=0.399 Sum_probs=12.0
Q ss_pred CCeEEEcCCchhcc
Q 035821 28 APALYVLGDSLLDS 41 (126)
Q Consensus 28 ~~~lfvFGDSlsDt 41 (126)
...++.+|||.+|.
T Consensus 158 ~~~~~~iGDs~~D~ 171 (177)
T TIGR01488 158 LKKIIAVGDSVNDL 171 (177)
T ss_pred HHHEEEEeCCHHHH
Confidence 56789999999994
No 39
>PRK01158 phosphoglycolate phosphatase; Provisional
Probab=29.47 E-value=20 Score=26.70 Aligned_cols=15 Identities=27% Similarity=0.264 Sum_probs=12.7
Q ss_pred CCeEEEcCCchhccC
Q 035821 28 APALYVLGDSLLDSG 42 (126)
Q Consensus 28 ~~~lfvFGDSlsDtG 42 (126)
.+.+++||||.+|..
T Consensus 173 ~~~~i~~GD~~NDi~ 187 (230)
T PRK01158 173 PEEVAAIGDSENDLE 187 (230)
T ss_pred HHHEEEECCchhhHH
Confidence 468999999999954
No 40
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal. TIGR01482, in turn, is a member of the IIB subfamily (TIGR01484) of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases.
Probab=29.13 E-value=28 Score=25.88 Aligned_cols=15 Identities=27% Similarity=0.291 Sum_probs=12.4
Q ss_pred CCeEEEcCCchhccC
Q 035821 28 APALYVLGDSLLDSG 42 (126)
Q Consensus 28 ~~~lfvFGDSlsDtG 42 (126)
...+++||||..|.-
T Consensus 163 ~~~~i~iGDs~ND~~ 177 (215)
T TIGR01487 163 PEEVAAIGDSENDID 177 (215)
T ss_pred HHHEEEECCCHHHHH
Confidence 457999999999954
No 41
>cd01831 Endoglucanase_E_like Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
Probab=28.27 E-value=25 Score=25.01 Aligned_cols=45 Identities=18% Similarity=0.214 Sum_probs=24.3
Q ss_pred eEEEcCCchhccCCCCcchhhhhcCCCCCCCCCCCCCCcCCCCCcchhhhHHHhcCCC
Q 035821 30 ALYVLGDSLLDSGNNNYLQTIIKANYSPYGEDFVNKCTGRFSNGKTVADFIAEFLGLP 87 (126)
Q Consensus 30 ~lfvFGDSlsDtGN~~~~~~~~~~~~~PyG~~~~~~ptgRfsnG~~~~d~la~~lgl~ 87 (126)
+|.++|||++. |-... ....+..+| .+......|...+++.++..
T Consensus 1 ~i~~iGDSit~-G~~~~--~~~~~~~~~----------~~~~~~~~~~~~la~~l~~~ 45 (169)
T cd01831 1 KIEFIGDSITC-GYGVT--GKSRCDFSA----------ATEDPSLSYAALLARALNAE 45 (169)
T ss_pred CEEEEeccccc-cCccC--CCCCCCCcc----------cccchhhhHHHHHHHHhCCc
Confidence 47899999987 43210 000011111 12223456888888888764
No 42
>cd01824 Phospholipase_B_like Phospholipase-B_like. This subgroup of the SGNH-family of lipolytic enzymes may have both esterase and phospholipase-A/lysophospholipase activity. It's members may be involved in the conversion of phosphatidylcholine to fatty acids and glycerophosphocholine, perhaps in the context of dietary lipid uptake. Members may be membrane proteins. The tertiary fold of the SGNH-hydrolases is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; Its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases.
Probab=28.26 E-value=1.6e+02 Score=23.64 Aligned_cols=92 Identities=18% Similarity=0.142 Sum_probs=42.3
Q ss_pred CCCCCeEEEcCCchhccCCCCcchhhhhcCCCCCCCCCCCCCCcCCCCCcchhhhHHHhcCCCCCCCCCCCCCCCCCCCC
Q 035821 25 SPLAPALYVLGDSLLDSGNNNYLQTIIKANYSPYGEDFVNKCTGRFSNGKTVADFIAEFLGLPYAPPFLSFKPRDKLPLT 104 (126)
Q Consensus 25 ~~~~~~lfvFGDSlsDtGN~~~~~~~~~~~~~PyG~~~~~~ptgRfsnG~~~~d~la~~lgl~~~p~yl~~~~~~~~~~~ 104 (126)
+..++-|-.+|||++= ||.............--|.+|...-.+.+.+=.+++.+|-+. + |-+.=|-...........
T Consensus 7 p~DI~viaA~GDSlta-g~ga~~~~~~~~~~e~rG~s~~~Gg~~~~~~~~Tlpnil~~f-n-p~l~G~s~~~~~~~~~~~ 83 (288)
T cd01824 7 PGDIKVIAALGDSLTA-GNGAGSANNLDLLTEYRGLSWSIGGDSTLRGLTTLPNILREF-N-PSLYGYSVGTGDETLPDS 83 (288)
T ss_pred cccCeEEeeccccccc-cCCCCCCCccccccccCCceEecCCcccccccccHHHHHHHh-C-CCcccccCCCCCCCCccc
Confidence 4678899999999973 443210000000000014444221112233335666766432 2 111111111011112235
Q ss_pred cceeeeecceeccCC
Q 035821 105 GLNYASGACGILRDT 119 (126)
Q Consensus 105 G~NFA~gGA~~~~~~ 119 (126)
..|.|+.|+++.+..
T Consensus 84 ~~N~av~Ga~s~dL~ 98 (288)
T cd01824 84 GFNVAEPGAKSEDLP 98 (288)
T ss_pred ceeecccCcchhhHH
Confidence 789999999987644
No 43
>PF03996 Hema_esterase: Hemagglutinin esterase; InterPro: IPR007142 Haemagglutinin-esterase fusion glycoprotein (HEF) is a multi-functional protein embedded in the viral envelope of several viruses, including influenza C virus, coronaviruses and toroviruses [, ]. HEF is required for infectivity, and functions to recognise the host cell surface receptor, to fuse the viral and host cell membranes, and to destroy the receptor upon host cell infection. The haemagglutinin region of HEF is responsible for receptor recognition and membrane fusion, and bears a strong resemblance to the sialic acid-binding haemagglutinin found in influenza A and B viruses, except that it binds 9-O-acetylsialic acid. The esterase region of HEF is responsible for the destruction of the receptor, an action that is carried out by neuraminidase in influenza A and B viruses. The esterase domain is similar in structure to Streptomyces scabies esterase, and to acetylhydrolase, thioesterase I and rhamnogalacturonan acetylesterase. The haemagglutinin-esterase glycoprotein HEF must be cleaved by the host's trypsin-like proteases to produce two peptides (HEF1 and HEF2) in order for the virus to be infectious. Once HEF is cleaved, the newly exposed N-terminal of the HEF2 peptide then acts to fuse the viral envelope to the cellular membrane of the host cell, which allows the virus to infect the host cell. The haemagglutinin-esterase glycoprotein is a trimer, where each monomer is composed of three domains: an elongated stem active in membrane fusion, an esterase domain, and a receptor-binding domain, where the stem and receptor-binding domains together resemble influenza A virus haemagglutinin. Two of these domains are composed of non-contiguous sequence: the receptor-binding haemagglutinin domain is inserted into a surface loop of the esterase domain, and the esterase domain is inserted into a surface loop of the haemagglutinin stem. This entry represents the core of the haemagglutinin-esterase glycoprotein, including the haemagglutinin receptor-binding domain and the esterase domain. More information about haemagglutinin proteins can be found at Protein of the Month: Bird Flu, Haemagglutinin [].; GO: 0016788 hydrolase activity, acting on ester bonds, 0046789 host cell surface receptor binding, 0019064 viral envelope fusion with host membrane, 0019031 viral envelope; PDB: 3CL5_A 3CL4_A 3I26_D 3I27_C 1FLC_E 3I1L_C 3I1K_C.
Probab=27.78 E-value=37 Score=27.32 Aligned_cols=17 Identities=29% Similarity=0.552 Sum_probs=13.6
Q ss_pred CeEEEcCCchhcc---CCCC
Q 035821 29 PALYVLGDSLLDS---GNNN 45 (126)
Q Consensus 29 ~~lfvFGDSlsDt---GN~~ 45 (126)
...+-||||-||+ .|..
T Consensus 45 ~dW~lFGDSRSDC~~~~N~~ 64 (258)
T PF03996_consen 45 SDWFLFGDSRSDCNHINNSQ 64 (258)
T ss_dssp SSEEEEESGGG-TGGGTSTT
T ss_pred cceeEecCccccccccCCCC
Confidence 5789999999999 7764
No 44
>cd01822 Lysophospholipase_L1_like Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.
Probab=27.75 E-value=31 Score=24.22 Aligned_cols=11 Identities=45% Similarity=0.709 Sum_probs=9.2
Q ss_pred eEEEcCCchhc
Q 035821 30 ALYVLGDSLLD 40 (126)
Q Consensus 30 ~lfvFGDSlsD 40 (126)
+|.++|||++.
T Consensus 2 ~i~~~GDSit~ 12 (177)
T cd01822 2 TILALGDSLTA 12 (177)
T ss_pred eEEEEcccccc
Confidence 57899999984
No 45
>COG4030 Uncharacterized protein conserved in archaea [Function unknown]
Probab=27.60 E-value=34 Score=27.88 Aligned_cols=16 Identities=38% Similarity=0.326 Sum_probs=11.9
Q ss_pred CCCCeEEEcCCchhccC
Q 035821 26 PLAPALYVLGDSLLDSG 42 (126)
Q Consensus 26 ~~~~~lfvFGDSlsDtG 42 (126)
.++++ .+.|||++|.-
T Consensus 205 ~d~sa-~~VGDSItDv~ 220 (315)
T COG4030 205 IDFSA-VVVGDSITDVK 220 (315)
T ss_pred CCcce-eEecCcccchH
Confidence 56774 55599999974
No 46
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase. Sucrose phosphate synthase (SPS), the prior step in the biosynthesis of sucrose contains a domain which exhibits considerable similarity to SPP albeit without conservation of the catalytic residues. The catalytic machinery of the synthase resides in another domain. It seems likely that the phosphatase-like domain is involved in substrate binding, possibly binding both substrates in a "product-like" orientation prior to ligation by the synthase catalytic domain.
Probab=27.49 E-value=30 Score=26.53 Aligned_cols=17 Identities=29% Similarity=0.071 Sum_probs=14.0
Q ss_pred CCCeEEEcCCchhccCC
Q 035821 27 LAPALYVLGDSLLDSGN 43 (126)
Q Consensus 27 ~~~~lfvFGDSlsDtGN 43 (126)
..+.+++||||.+|..=
T Consensus 182 ~~~~~i~~GD~~ND~~m 198 (249)
T TIGR01485 182 EPSQTLVCGDSGNDIEL 198 (249)
T ss_pred CccCEEEEECChhHHHH
Confidence 46789999999999643
No 47
>cd01828 sialate_O-acetylesterase_like2 sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=27.14 E-value=30 Score=24.42 Aligned_cols=12 Identities=58% Similarity=0.797 Sum_probs=10.0
Q ss_pred eEEEcCCchhcc
Q 035821 30 ALYVLGDSLLDS 41 (126)
Q Consensus 30 ~lfvFGDSlsDt 41 (126)
+|+++|||++.-
T Consensus 1 ~v~~~GdSi~~~ 12 (169)
T cd01828 1 ALVFLGDSLTEG 12 (169)
T ss_pred CEEEecchhhcc
Confidence 478999999974
No 48
>cd04506 SGNH_hydrolase_YpmR_like Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
Probab=26.75 E-value=27 Score=25.44 Aligned_cols=12 Identities=42% Similarity=0.686 Sum_probs=10.1
Q ss_pred eEEEcCCchhcc
Q 035821 30 ALYVLGDSLLDS 41 (126)
Q Consensus 30 ~lfvFGDSlsDt 41 (126)
++.++|||++.-
T Consensus 1 ~i~~~GDSit~G 12 (204)
T cd04506 1 KIVALGDSLTEG 12 (204)
T ss_pred CEeEEeccccCc
Confidence 478999999984
No 49
>cd01835 SGNH_hydrolase_like_3 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=26.73 E-value=37 Score=24.47 Aligned_cols=12 Identities=50% Similarity=0.661 Sum_probs=10.5
Q ss_pred CeEEEcCCchhc
Q 035821 29 PALYVLGDSLLD 40 (126)
Q Consensus 29 ~~lfvFGDSlsD 40 (126)
.+|.++|||++.
T Consensus 2 ~~i~~lGDSit~ 13 (193)
T cd01835 2 KRLIVVGDSLVY 13 (193)
T ss_pred cEEEEEcCcccc
Confidence 478999999997
No 50
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily. catalyze the same reaction as SPP.
Probab=26.67 E-value=26 Score=25.93 Aligned_cols=15 Identities=33% Similarity=0.175 Sum_probs=12.5
Q ss_pred CCCeEEEcCCchhcc
Q 035821 27 LAPALYVLGDSLLDS 41 (126)
Q Consensus 27 ~~~~lfvFGDSlsDt 41 (126)
..+.+++||||.+|.
T Consensus 164 ~~~~~i~~GD~~NDi 178 (225)
T TIGR01482 164 KPGETLVCGDSENDI 178 (225)
T ss_pred CHHHEEEECCCHhhH
Confidence 347899999999994
No 51
>PLN02954 phosphoserine phosphatase
Probab=26.62 E-value=33 Score=25.43 Aligned_cols=16 Identities=19% Similarity=0.306 Sum_probs=13.1
Q ss_pred CCeEEEcCCchhccCC
Q 035821 28 APALYVLGDSLLDSGN 43 (126)
Q Consensus 28 ~~~lfvFGDSlsDtGN 43 (126)
.+.++++|||.+|.-.
T Consensus 169 ~~~~i~iGDs~~Di~a 184 (224)
T PLN02954 169 YKTMVMIGDGATDLEA 184 (224)
T ss_pred CCceEEEeCCHHHHHh
Confidence 4678899999999655
No 52
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only]
Probab=26.34 E-value=32 Score=26.37 Aligned_cols=17 Identities=24% Similarity=0.151 Sum_probs=14.1
Q ss_pred CCeEEEcCCchhccCCC
Q 035821 28 APALYVLGDSLLDSGNN 44 (126)
Q Consensus 28 ~~~lfvFGDSlsDtGN~ 44 (126)
...+++||||.+|..-.
T Consensus 205 ~~~v~afGD~~ND~~Ml 221 (264)
T COG0561 205 LEEVIAFGDSTNDIEML 221 (264)
T ss_pred HHHeEEeCCccccHHHH
Confidence 45899999999997654
No 53
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional
Probab=25.76 E-value=25 Score=27.20 Aligned_cols=16 Identities=19% Similarity=0.272 Sum_probs=13.2
Q ss_pred CCCeEEEcCCchhccC
Q 035821 27 LAPALYVLGDSLLDSG 42 (126)
Q Consensus 27 ~~~~lfvFGDSlsDtG 42 (126)
..+.+++||||.+|.-
T Consensus 203 ~~~~v~afGD~~NDi~ 218 (272)
T PRK15126 203 SLADCMAFGDAMNDRE 218 (272)
T ss_pred CHHHeEEecCCHHHHH
Confidence 3468999999999953
No 54
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional
Probab=25.67 E-value=25 Score=26.80 Aligned_cols=16 Identities=19% Similarity=0.285 Sum_probs=13.2
Q ss_pred CCCeEEEcCCchhccC
Q 035821 27 LAPALYVLGDSLLDSG 42 (126)
Q Consensus 27 ~~~~lfvFGDSlsDtG 42 (126)
..+.+++||||.+|.-
T Consensus 214 ~~~e~i~~GD~~NDi~ 229 (272)
T PRK10530 214 SMKNVVAFGDNFNDIS 229 (272)
T ss_pred CHHHeEEeCCChhhHH
Confidence 4568999999999954
No 55
>PRK10523 lipoprotein involved with copper homeostasis and adhesion; Provisional
Probab=25.23 E-value=98 Score=24.67 Aligned_cols=19 Identities=32% Similarity=0.252 Sum_probs=11.1
Q ss_pred CcchhhHHHHHHHHHHHHh
Q 035821 1 MISKYCITSSFIFLLFIIS 19 (126)
Q Consensus 1 m~~~~~~~~~~~~~~~~l~ 19 (126)
||||..+...+.+.++.|.
T Consensus 1 ~mkk~~~~~~~a~~l~~l~ 19 (234)
T PRK10523 1 MMKKAIITALAAAGLFTLM 19 (234)
T ss_pred CchHHHHHHHHHHHHHHhh
Confidence 8999976643333344443
No 56
>PF06316 Ail_Lom: Enterobacterial Ail/Lom protein; InterPro: IPR000758 Virulence-related outer membrane proteins are expressed in Gram-negative bacteria and are essential to bacterial survival within macrophages and for eukaryotic cell invasion. Members of this group include: PagC, required by Salmonella typhimurium for survival in macrophages and for virulence in mice [] Rck outer membrane protein of the S. typhimurium virulence plasmid [] Ail, a product of the Yersinia enterocolitica chromosome capable of mediating bacterial adherence to and invasion of epithelial cell lines [] OmpX from Escherichia coli that promotes adhesion to and entry into mammalian cells. It also has a role in the resistance against attack by the human complement system [] a Bacteriophage lambda outer membrane protein, Lom [] The crystal structure of OmpX from E. coli reveals that OmpX consists of an eight-stranded antiparallel all-next-neighbour beta barrel []. The structure shows two girdles of aromatic amino acid residues and a ribbon of nonpolar residues that attach to the membrane interior. The core of the barrel consists of an extended hydrogen-bonding network of highly conserved residues. OmpX thus resembles an inverse micelle. The OmpX structure shows that the membrane-spanning part of the protein is much better conserved than the extracellular loops. Moreover, these loops form a protruding beta sheet, the edge of which presumably binds to external proteins. It is suggested that this type of binding promotes cell adhesion and invasion and helps defend against the complement system. Although OmpX has the same beta-sheet topology as the structurally related outer membrane protein A (OmpA) IPR000498 from INTERPRO, their barrels differ with respect to the shear numbers and internal hydrogen-bonding networks.; GO: 0009279 cell outer membrane
Probab=25.18 E-value=74 Score=24.84 Aligned_cols=12 Identities=17% Similarity=0.196 Sum_probs=7.3
Q ss_pred cchhhHHHHHHH
Q 035821 2 ISKYCITSSFIF 13 (126)
Q Consensus 2 ~~~~~~~~~~~~ 13 (126)
|+|.|.+++..+
T Consensus 1 mr~~~~~ils~~ 12 (199)
T PF06316_consen 1 MRKLCAAILSAA 12 (199)
T ss_pred ChhHHHHHHHHH
Confidence 788886543333
No 57
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria []. SPP is a member of the Class IIB subfamily of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. SPP catalyzes the final step in the biosynthesis of sucrose, a critically important molecule for plants. Sucrose phosphate synthase (SPS), the prior step in the biosynthesis of sucrose contains a domain which exhibits considerable similarity to SPP albeit without conservation of the catalytic residues. The catalytic machinery of the synthase resides in another domain. It seems likely that the phosphatase-like domain is involved in substrate binding, possibly binding both substrates in a "product-like" orientation prior to ligation by the synthase catalytic domain.; PDB: 1TJ5_A 2B1Q_A 1TJ4_A 1S2O_A 1U2T_A 2D2V_A 1TJ3_A 1U2S_A 2B1R_A 3GYG_B ....
Probab=24.39 E-value=33 Score=26.72 Aligned_cols=15 Identities=33% Similarity=0.257 Sum_probs=12.4
Q ss_pred CCeEEEcCCchhccC
Q 035821 28 APALYVLGDSLLDSG 42 (126)
Q Consensus 28 ~~~lfvFGDSlsDtG 42 (126)
..+++++|||-+|..
T Consensus 181 ~~~vl~aGDSgND~~ 195 (247)
T PF05116_consen 181 PEQVLVAGDSGNDLE 195 (247)
T ss_dssp GGGEEEEESSGGGHH
T ss_pred HHHEEEEeCCCCcHH
Confidence 468899999999953
No 58
>cd01838 Isoamyl_acetate_hydrolase_like Isoamyl-acetate hydrolyzing esterase-like proteins. SGNH_hydrolase subfamily similar to the Saccharomyces cerevisiae IAH1. IAH1 may be the major esterase that hydrolyses isoamyl acetate in sake mash. The SGNH-family of hydrolases is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases
Probab=23.86 E-value=37 Score=24.13 Aligned_cols=13 Identities=23% Similarity=0.478 Sum_probs=10.3
Q ss_pred eEEEcCCchhccC
Q 035821 30 ALYVLGDSLLDSG 42 (126)
Q Consensus 30 ~lfvFGDSlsDtG 42 (126)
+|.++|||++.-.
T Consensus 1 ~i~~~GDSit~g~ 13 (199)
T cd01838 1 KIVLFGDSITQFS 13 (199)
T ss_pred CEEEecCcccccc
Confidence 4789999998643
No 59
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed
Probab=23.29 E-value=44 Score=26.01 Aligned_cols=17 Identities=29% Similarity=0.108 Sum_probs=13.9
Q ss_pred CC-CeEEEcCCchhccCC
Q 035821 27 LA-PALYVLGDSLLDSGN 43 (126)
Q Consensus 27 ~~-~~lfvFGDSlsDtGN 43 (126)
.. ..+++||||.+|..-
T Consensus 205 ~~~~~v~~~GDs~NDi~m 222 (273)
T PRK00192 205 QDGVETIALGDSPNDLPM 222 (273)
T ss_pred cCCceEEEEcCChhhHHH
Confidence 35 889999999999543
No 60
>PLN02382 probable sucrose-phosphatase
Probab=23.17 E-value=38 Score=28.69 Aligned_cols=16 Identities=31% Similarity=0.183 Sum_probs=13.1
Q ss_pred CCCeEEEcCCchhccC
Q 035821 27 LAPALYVLGDSLLDSG 42 (126)
Q Consensus 27 ~~~~lfvFGDSlsDtG 42 (126)
....+++||||.+|..
T Consensus 193 ~~~~~iafGDs~NDle 208 (413)
T PLN02382 193 APVNTLVCGDSGNDAE 208 (413)
T ss_pred ChhcEEEEeCCHHHHH
Confidence 3568899999999954
No 61
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily. The members of this subfamily are restricted almost exclusively to bacteria (one sequences from S. pombe scores above trusted, while another is between trusted and noise). It is notable that no archaea are found in this group, the closest relations to the archaea found here being two Deinococcus sequences.
Probab=22.55 E-value=38 Score=25.84 Aligned_cols=16 Identities=19% Similarity=0.266 Sum_probs=13.3
Q ss_pred CCCeEEEcCCchhccC
Q 035821 27 LAPALYVLGDSLLDSG 42 (126)
Q Consensus 27 ~~~~lfvFGDSlsDtG 42 (126)
....+++||||.+|..
T Consensus 203 ~~~~~~~~GD~~nD~~ 218 (256)
T TIGR00099 203 SLEDVIAFGDGMNDIE 218 (256)
T ss_pred CHHHEEEeCCcHHhHH
Confidence 4578999999999954
No 62
>cd01836 FeeA_FeeB_like SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=22.51 E-value=43 Score=24.04 Aligned_cols=11 Identities=55% Similarity=0.652 Sum_probs=9.4
Q ss_pred eEEEcCCchhc
Q 035821 30 ALYVLGDSLLD 40 (126)
Q Consensus 30 ~lfvFGDSlsD 40 (126)
++.++|||++.
T Consensus 4 ~i~~~GDSit~ 14 (191)
T cd01836 4 RLLVLGDSTAA 14 (191)
T ss_pred EEEEEeccccc
Confidence 68899999993
No 63
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others, all of which use a nucleophilic aspartate in their phosphoryl transfer reaction. All members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. Members of this superfamily are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.
Probab=21.53 E-value=43 Score=21.60 Aligned_cols=15 Identities=33% Similarity=0.410 Sum_probs=12.7
Q ss_pred CCCeEEEcCCchhcc
Q 035821 27 LAPALYVLGDSLLDS 41 (126)
Q Consensus 27 ~~~~lfvFGDSlsDt 41 (126)
....++.+|||.+|.
T Consensus 112 ~~~~~~~igD~~~d~ 126 (139)
T cd01427 112 DPEEVLMVGDSLNDI 126 (139)
T ss_pred ChhhEEEeCCCHHHH
Confidence 468899999999884
No 64
>cd01829 SGNH_hydrolase_peri2 SGNH_peri2; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=21.32 E-value=43 Score=24.19 Aligned_cols=12 Identities=42% Similarity=0.695 Sum_probs=9.7
Q ss_pred eEEEcCCchhcc
Q 035821 30 ALYVLGDSLLDS 41 (126)
Q Consensus 30 ~lfvFGDSlsDt 41 (126)
+|.++|||++..
T Consensus 1 ril~iGDS~~~g 12 (200)
T cd01829 1 RVLVIGDSLAQG 12 (200)
T ss_pred CEEEEechHHHH
Confidence 367889999974
No 65
>cd01820 PAF_acetylesterase_like PAF_acetylhydrolase (PAF-AH)_like subfamily of SGNH-hydrolases. Platelet-activating factor (PAF) and PAF-AH are key players in inflammation and in atherosclerosis. PAF-AH is a calcium independent phospholipase A2 which exhibits strong substrate specificity towards PAF, hydrolyzing an acetyl ester at the sn-2 position. PAF-AH also degrades a family of oxidized PAF-like phospholipids with short sn-2 residues. In addition, PAF and PAF-AH are associated with neural migration and mammalian reproduction.
Probab=21.31 E-value=52 Score=24.46 Aligned_cols=14 Identities=29% Similarity=0.660 Sum_probs=11.8
Q ss_pred CCeEEEcCCchhcc
Q 035821 28 APALYVLGDSLLDS 41 (126)
Q Consensus 28 ~~~lfvFGDSlsDt 41 (126)
-..|+.||||++.-
T Consensus 32 ~~~iv~lGDSit~g 45 (214)
T cd01820 32 EPDVVFIGDSITQN 45 (214)
T ss_pred CCCEEEECchHhhh
Confidence 36799999999983
No 66
>PF13956 Ibs_toxin: Toxin Ibs, type I toxin-antitoxin system
Probab=20.71 E-value=55 Score=16.07 Aligned_cols=7 Identities=29% Similarity=0.316 Sum_probs=3.4
Q ss_pred CcchhhH
Q 035821 1 MISKYCI 7 (126)
Q Consensus 1 m~~~~~~ 7 (126)
||+-..+
T Consensus 1 MMk~vII 7 (19)
T PF13956_consen 1 MMKLVII 7 (19)
T ss_pred CceehHH
Confidence 5654443
No 67
>PF10731 Anophelin: Thrombin inhibitor from mosquito; InterPro: IPR018932 Members of this family are all inhibitors of thrombin, the peptidase that is at the end of the blood coagulation cascade and which creates the clot by cleaving fibrinogen. The interaction between thrombin and fibrinogen involves two different areas of contact - via the thrombin active site and via a second substrate-binding site known as an exosite. The inhibitor acts by blocking the exosite, rather than by interacting with the active site. The inhibitors are from mosquitoes that feed on human blood and which, by inhibiting thrombin, prevent the blood from clotting and keep it flowing.
Probab=20.64 E-value=1.2e+02 Score=19.45 Aligned_cols=12 Identities=25% Similarity=0.285 Sum_probs=7.8
Q ss_pred CcchhhHHHHHH
Q 035821 1 MISKYCITSSFI 12 (126)
Q Consensus 1 m~~~~~~~~~~~ 12 (126)
|.+|.++++.|+
T Consensus 1 MA~Kl~vialLC 12 (65)
T PF10731_consen 1 MASKLIVIALLC 12 (65)
T ss_pred CcchhhHHHHHH
Confidence 788887664333
No 68
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial. Sucrose phosphate synthase (SPS) and sucrose phosphate phosphatase (SPP) are the last two enzymes of sucrose biosynthesis. In cyanobacteria and plants, the C-terminal region of most or all versions of SPS has a domain homologous to the known SPP. This domain may serve a binding or regulatory rather than catalytic function. Sequences in this family are bacterial C-terminal regions found in all but two of the putative bacterial sucrose phosphate synthases described by TIGR02472.
Probab=20.47 E-value=47 Score=25.06 Aligned_cols=15 Identities=33% Similarity=0.297 Sum_probs=12.5
Q ss_pred CCeEEEcCCchhccC
Q 035821 28 APALYVLGDSLLDSG 42 (126)
Q Consensus 28 ~~~lfvFGDSlsDtG 42 (126)
.+.++.||||.+|.-
T Consensus 175 ~~~~i~~GD~~nD~~ 189 (236)
T TIGR02471 175 LEQILVAGDSGNDEE 189 (236)
T ss_pred HHHEEEEcCCccHHH
Confidence 457899999999964
Done!