BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035867
(362 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3NAH|A Chain A, Crystal Structures And Functional Analysis Of Murine
Norovirus Rna- Dependent Rna Polymerase
pdb|3NAH|B Chain B, Crystal Structures And Functional Analysis Of Murine
Norovirus Rna- Dependent Rna Polymerase
pdb|3NAH|C Chain C, Crystal Structures And Functional Analysis Of Murine
Norovirus Rna- Dependent Rna Polymerase
pdb|3NAI|A Chain A, Crystal Structures And Functional Analysis Of Murine
Norovirus Rna- Dependent Rna Polymerase
pdb|3NAI|B Chain B, Crystal Structures And Functional Analysis Of Murine
Norovirus Rna- Dependent Rna Polymerase
pdb|3NAI|C Chain C, Crystal Structures And Functional Analysis Of Murine
Norovirus Rna- Dependent Rna Polymerase
pdb|3QID|A Chain A, Crystal Structures And Functional Analysis Of Murine
Norovirus Rna- Dependent Rna Polymerase
pdb|3QID|B Chain B, Crystal Structures And Functional Analysis Of Murine
Norovirus Rna- Dependent Rna Polymerase
pdb|3QID|C Chain C, Crystal Structures And Functional Analysis Of Murine
Norovirus Rna- Dependent Rna Polymerase
pdb|3SFG|A Chain A, Crystal Structure Of Murine Norovirus Rna Dependent Rna
Polymerase In Complex With 2thiouridine(2tu)
pdb|3SFG|B Chain B, Crystal Structure Of Murine Norovirus Rna Dependent Rna
Polymerase In Complex With 2thiouridine(2tu)
pdb|3SFG|C Chain C, Crystal Structure Of Murine Norovirus Rna Dependent Rna
Polymerase In Complex With 2thiouridine(2tu)
pdb|3SFU|A Chain A, Crystal Structure Of Murine Norovirus Rna Dependent Rna
Polymerase In Complex With Ribavirin
pdb|3SFU|B Chain B, Crystal Structure Of Murine Norovirus Rna Dependent Rna
Polymerase In Complex With Ribavirin
pdb|3SFU|C Chain C, Crystal Structure Of Murine Norovirus Rna Dependent Rna
Polymerase In Complex With Ribavirin
Length = 517
Score = 30.4 bits (67), Expect = 1.4, Method: Compositional matrix adjust.
Identities = 16/49 (32%), Positives = 23/49 (46%)
Query: 23 LQALFGRMTDSGERCYRTLSSASDKTCSFESTRKMVLKFQEVSPWTTFG 71
L AL G GE+ YRT++S K + +V + + V W FG
Sbjct: 440 LMALLGEAAMHGEKYYRTVASRVSKEAAQSGIEMVVPRHRSVLRWVRFG 488
>pdb|3UQS|A Chain A, Crystal Structures Of Murine Norovirus Rna-Dependent Rna
Polymerase
pdb|3UQS|B Chain B, Crystal Structures Of Murine Norovirus Rna-Dependent Rna
Polymerase
pdb|3UQS|C Chain C, Crystal Structures Of Murine Norovirus Rna-Dependent Rna
Polymerase
pdb|3UR0|A Chain A, Crystal Structures Of Murine Norovirus Rna-Dependent Rna
Polymerase In Complex With Suramin
pdb|3UR0|B Chain B, Crystal Structures Of Murine Norovirus Rna-Dependent Rna
Polymerase In Complex With Suramin
pdb|3UR0|C Chain C, Crystal Structures Of Murine Norovirus Rna-Dependent Rna
Polymerase In Complex With Suramin
Length = 515
Score = 30.4 bits (67), Expect = 1.5, Method: Compositional matrix adjust.
Identities = 16/49 (32%), Positives = 23/49 (46%)
Query: 23 LQALFGRMTDSGERCYRTLSSASDKTCSFESTRKMVLKFQEVSPWTTFG 71
L AL G GE+ YRT++S K + +V + + V W FG
Sbjct: 440 LMALLGEAAMHGEKYYRTVASRVSKEAAQSGIEMVVPRHRSVLRWVRFG 488
>pdb|3UPF|A Chain A, Crystal Structure Of Murine Norovirus Rna-Dependent Rna
Polymerase Bound To Nf023
pdb|3UPF|B Chain B, Crystal Structure Of Murine Norovirus Rna-Dependent Rna
Polymerase Bound To Nf023
pdb|3UPF|C Chain C, Crystal Structure Of Murine Norovirus Rna-Dependent Rna
Polymerase Bound To Nf023
Length = 525
Score = 30.4 bits (67), Expect = 1.5, Method: Compositional matrix adjust.
Identities = 16/49 (32%), Positives = 23/49 (46%)
Query: 23 LQALFGRMTDSGERCYRTLSSASDKTCSFESTRKMVLKFQEVSPWTTFG 71
L AL G GE+ YRT++S K + +V + + V W FG
Sbjct: 450 LMALLGEAAMHGEKYYRTVASRVSKEAAQSGIEMVVPRHRSVLRWVRFG 498
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.134 0.416
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,257,969
Number of Sequences: 62578
Number of extensions: 384234
Number of successful extensions: 730
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 727
Number of HSP's gapped (non-prelim): 4
length of query: 362
length of database: 14,973,337
effective HSP length: 100
effective length of query: 262
effective length of database: 8,715,537
effective search space: 2283470694
effective search space used: 2283470694
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)