BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035867
         (362 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3NAH|A Chain A, Crystal Structures And Functional Analysis Of Murine
           Norovirus Rna- Dependent Rna Polymerase
 pdb|3NAH|B Chain B, Crystal Structures And Functional Analysis Of Murine
           Norovirus Rna- Dependent Rna Polymerase
 pdb|3NAH|C Chain C, Crystal Structures And Functional Analysis Of Murine
           Norovirus Rna- Dependent Rna Polymerase
 pdb|3NAI|A Chain A, Crystal Structures And Functional Analysis Of Murine
           Norovirus Rna- Dependent Rna Polymerase
 pdb|3NAI|B Chain B, Crystal Structures And Functional Analysis Of Murine
           Norovirus Rna- Dependent Rna Polymerase
 pdb|3NAI|C Chain C, Crystal Structures And Functional Analysis Of Murine
           Norovirus Rna- Dependent Rna Polymerase
 pdb|3QID|A Chain A, Crystal Structures And Functional Analysis Of Murine
           Norovirus Rna- Dependent Rna Polymerase
 pdb|3QID|B Chain B, Crystal Structures And Functional Analysis Of Murine
           Norovirus Rna- Dependent Rna Polymerase
 pdb|3QID|C Chain C, Crystal Structures And Functional Analysis Of Murine
           Norovirus Rna- Dependent Rna Polymerase
 pdb|3SFG|A Chain A, Crystal Structure Of Murine Norovirus Rna Dependent Rna
           Polymerase In Complex With 2thiouridine(2tu)
 pdb|3SFG|B Chain B, Crystal Structure Of Murine Norovirus Rna Dependent Rna
           Polymerase In Complex With 2thiouridine(2tu)
 pdb|3SFG|C Chain C, Crystal Structure Of Murine Norovirus Rna Dependent Rna
           Polymerase In Complex With 2thiouridine(2tu)
 pdb|3SFU|A Chain A, Crystal Structure Of Murine Norovirus Rna Dependent Rna
           Polymerase In Complex With Ribavirin
 pdb|3SFU|B Chain B, Crystal Structure Of Murine Norovirus Rna Dependent Rna
           Polymerase In Complex With Ribavirin
 pdb|3SFU|C Chain C, Crystal Structure Of Murine Norovirus Rna Dependent Rna
           Polymerase In Complex With Ribavirin
          Length = 517

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 23  LQALFGRMTDSGERCYRTLSSASDKTCSFESTRKMVLKFQEVSPWTTFG 71
           L AL G     GE+ YRT++S   K  +      +V + + V  W  FG
Sbjct: 440 LMALLGEAAMHGEKYYRTVASRVSKEAAQSGIEMVVPRHRSVLRWVRFG 488


>pdb|3UQS|A Chain A, Crystal Structures Of Murine Norovirus Rna-Dependent Rna
           Polymerase
 pdb|3UQS|B Chain B, Crystal Structures Of Murine Norovirus Rna-Dependent Rna
           Polymerase
 pdb|3UQS|C Chain C, Crystal Structures Of Murine Norovirus Rna-Dependent Rna
           Polymerase
 pdb|3UR0|A Chain A, Crystal Structures Of Murine Norovirus Rna-Dependent Rna
           Polymerase In Complex With Suramin
 pdb|3UR0|B Chain B, Crystal Structures Of Murine Norovirus Rna-Dependent Rna
           Polymerase In Complex With Suramin
 pdb|3UR0|C Chain C, Crystal Structures Of Murine Norovirus Rna-Dependent Rna
           Polymerase In Complex With Suramin
          Length = 515

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 23  LQALFGRMTDSGERCYRTLSSASDKTCSFESTRKMVLKFQEVSPWTTFG 71
           L AL G     GE+ YRT++S   K  +      +V + + V  W  FG
Sbjct: 440 LMALLGEAAMHGEKYYRTVASRVSKEAAQSGIEMVVPRHRSVLRWVRFG 488


>pdb|3UPF|A Chain A, Crystal Structure Of Murine Norovirus Rna-Dependent Rna
           Polymerase Bound To Nf023
 pdb|3UPF|B Chain B, Crystal Structure Of Murine Norovirus Rna-Dependent Rna
           Polymerase Bound To Nf023
 pdb|3UPF|C Chain C, Crystal Structure Of Murine Norovirus Rna-Dependent Rna
           Polymerase Bound To Nf023
          Length = 525

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 23  LQALFGRMTDSGERCYRTLSSASDKTCSFESTRKMVLKFQEVSPWTTFG 71
           L AL G     GE+ YRT++S   K  +      +V + + V  W  FG
Sbjct: 450 LMALLGEAAMHGEKYYRTVASRVSKEAAQSGIEMVVPRHRSVLRWVRFG 498


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.134    0.416 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,257,969
Number of Sequences: 62578
Number of extensions: 384234
Number of successful extensions: 730
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 727
Number of HSP's gapped (non-prelim): 4
length of query: 362
length of database: 14,973,337
effective HSP length: 100
effective length of query: 262
effective length of database: 8,715,537
effective search space: 2283470694
effective search space used: 2283470694
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)