Citrus Sinensis ID: 035867


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--
MWMLNELSSPYGDTDQKLSSYFLQALFGRMTDSGERCYRTLSSASDKTCSFESTRKMVLKFQEVSPWTTFGHVACNGAIMEAFEGESKLHIVDISNTYCTQWPTLLEALATRTDDTPHLRLTTVVTSKPVGGSGAGGLAAVQKVMKEIGNRMEKFARLMGVPFEFNVIHHVGDLCDLNLAELDVRSDEALAINCIGALHTIAAVDDRRDVLISNLRSLQPRIITVVEEEVDLDVGIDGLEFVKGFQECLRWFRVYFESLDESFTKTSNERLMLERAAGRAIVDLVACQPSESTERRETATRWSGRLHGAGFSPFMFSDEVCDDVRALLRRYKEGWSMAQCPDAGIFLSWKDHTVVWASAWRP
cccHHccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHccccccccEEEEECcccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccEEEEEccccccccccccHHHHHHHHHHcccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccEEEECcccEEEEECcccEEEEEEEEcc
MWMLNELSSPYGDTDQKLSSYFLQALFGRMTDSGERCYRTLS****KTCSFESTRKMVLKFQEVSPWTTFGHVACNGAIMEAFEGESKLHIVDISNTYCTQWPTLLEALATRTDDTPHLRLTTVVTSKPVG*SGAGGLAAVQKVMKEIGNRMEKFARLMGVPFEFNVIHHVGDLCDLNLAELDVRSDEALAINCIGALHTIAAVDDRRDVLISNLRSLQPRIITVVEEEVDLDVGIDGLEFVKGFQECLRWFRVYFESLDESFTKTSNERLMLERAAGRAIVDLVACQPSESTERRETATRWSGRLHGAGFSPFMFSDEVCDDVRALLRRYKEGWSMAQCPDAGIFLSWKDHTVVWASAWRP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWMLNELSSPYGDTDQKLSSYFLQALFGRMTDSGERCYRTLSSASDKTCSFESTRKMVLKFQEVSPWTTFGHVACNGAIMEAFEGESKLHIVDISNTYCTQWPTLLEALATRTDDTPHLRLTTVVTSKPVGGSGAGGLAAVQKVMKEIGNRMEKFARLMGVPFEFNVIHHVGDLCDLNLAELDVRSDEALAINCIGALHTIAAVDDRRDVLISNLRSLQPRIITVVEEEVDLDVGIDGLEFVKGFQECLRWFRVYFESLDESFTKTSNERLMLERAAGRAIVDLVACQPSESTERRETATRWSGRLHGAGFSPFMFSDEVCDDVRALLRRYKEGWSMAQCPDAGIFLSWKDHTVVWASAWRP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein SHORT-ROOT Transcription factor required for quiescent center cells specification and maintenance of surrounding stem cells, and for the asymmetric cell division involved in radial pattern formation in roots. Essential for both cell division and cell specification. Regulates the radial organization of the shoot axial organs and is required for normal shoot gravitropism. Directly controls the transcription of SCR, and when associated with SCR, of MGP, RLK, TRI, NUC and SCL3.probableQ9SZF7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KKZ, chain A
Confidence level:probable
Coverage over the Query: 61-128,143-226
View the alignment between query and template
View the model in PyMOL
Template: 3BKX, chain A
Confidence level:probable
Coverage over the Query: 77-229
View the alignment between query and template
View the model in PyMOL
Template: 3LCV, chain B
Confidence level:probable
Coverage over the Query: 78-128,143-230,242-260
View the alignment between query and template
View the model in PyMOL