Query         035876
Match_columns 117
No_of_seqs    98 out of 107
Neff          3.6 
Searched_HMMs 46136
Date          Fri Mar 29 07:15:02 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035876.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035876hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01102 Glycophorin_A:  Glycop  87.3    0.62 1.3E-05   34.7   2.9   35   23-58     60-94  (122)
  2 PF02439 Adeno_E3_CR2:  Adenovi  86.7     1.5 3.2E-05   27.2   3.8   29   31-59      8-36  (38)
  3 PF07204 Orthoreo_P10:  Orthore  85.4    0.55 1.2E-05   34.3   1.7   37   22-58     36-72  (98)
  4 PF12273 RCR:  Chitin synthesis  71.6     4.2 9.1E-05   29.3   2.7   15   41-55     11-25  (130)
  5 PF13214 DUF4022:  Protein of u  70.0     4.5 9.8E-05   28.5   2.5   17   34-50      8-24  (83)
  6 PF15347 PAG:  Phosphoprotein a  65.7     5.1 0.00011   35.6   2.5   23   31-53     17-39  (428)
  7 PF05454 DAG1:  Dystroglycan (D  65.3     2.1 4.5E-05   36.0   0.0    7   86-92    209-215 (290)
  8 TIGR00847 ccoS cytochrome oxid  64.2      13 0.00027   24.1   3.5   23   28-50      3-25  (51)
  9 PRK09757 PTS system N-acetylga  64.1     9.2  0.0002   31.6   3.6   28   27-54    206-238 (267)
 10 PF05283 MGC-24:  Multi-glycosy  62.8     7.8 0.00017   30.8   2.8   21   30-50    162-182 (186)
 11 PF14575 EphA2_TM:  Ephrin type  62.2     8.8 0.00019   25.9   2.6   24   35-58      7-30  (75)
 12 TIGR00822 EII-Sor PTS system,   61.4      17 0.00038   30.1   4.7   27   27-53    205-235 (265)
 13 PF11174 DUF2970:  Protein of u  60.7      15 0.00032   24.0   3.4   19   25-43     28-46  (56)
 14 PF03597 CcoS:  Cytochrome oxid  60.1      17 0.00036   22.8   3.5   22   29-50      3-24  (45)
 15 PF05151 PsbM:  Photosystem II   59.4     7.8 0.00017   23.0   1.7   14   39-52      6-19  (31)
 16 PRK13592 ubiA prenyltransferas  58.5      12 0.00027   31.6   3.5   29   25-53    232-261 (299)
 17 PF15048 OSTbeta:  Organic solu  57.6      13 0.00028   28.2   3.1   26   26-51     33-58  (125)
 18 PF06667 PspB:  Phage shock pro  56.2      17 0.00036   25.1   3.2   28   30-57      3-30  (75)
 19 PF02480 Herpes_gE:  Alphaherpe  54.6     4.1 8.9E-05   35.7   0.0   35   22-56    345-383 (439)
 20 TIGR02976 phageshock_pspB phag  53.5      19 0.00042   24.7   3.2   29   30-58      3-31  (75)
 21 PF01299 Lamp:  Lysosome-associ  52.9      12 0.00026   30.4   2.5   27   31-58    275-301 (306)
 22 PF12273 RCR:  Chitin synthesis  51.9       6 0.00013   28.5   0.5   24   37-60      4-27  (130)
 23 PF02480 Herpes_gE:  Alphaherpe  51.8     4.8  0.0001   35.2   0.0   41   22-62    339-386 (439)
 24 PF14914 LRRC37AB_C:  LRRC37A/B  50.6      22 0.00048   27.9   3.4   28   31-58    121-151 (154)
 25 PF15345 TMEM51:  Transmembrane  49.0      16 0.00035   30.2   2.6   30   21-50     53-82  (233)
 26 PF09928 DUF2160:  Predicted sm  48.1      20 0.00044   25.7   2.7   22   23-44      3-24  (88)
 27 PF05399 EVI2A:  Ectropic viral  47.9      18 0.00039   29.9   2.7   19   35-53    128-146 (227)
 28 PF12911 OppC_N:  N-terminal TM  47.7      22 0.00048   21.5   2.6   13   38-50     19-31  (56)
 29 PF10215 Ost4:  Oligosaccaryltr  47.0      33 0.00072   20.7   3.1   17   33-49      8-24  (35)
 30 COG4594 FecB ABC-type Fe3+-cit  46.4      40 0.00087   29.0   4.6   23   35-57      6-28  (310)
 31 PRK09458 pspB phage shock prot  45.9      30 0.00065   24.1   3.2   30   30-59      3-32  (75)
 32 COG5416 Uncharacterized integr  45.8      29 0.00063   25.4   3.2   29   21-49     54-82  (98)
 33 PHA02909 hypothetical protein;  45.8      24 0.00052   24.2   2.6    9   46-54     49-57  (72)
 34 PF11980 DUF3481:  Domain of un  45.5      32 0.00069   24.7   3.3   26   30-55     18-44  (87)
 35 PF04277 OAD_gamma:  Oxaloaceta  45.5      19 0.00042   23.4   2.2   16   39-54     17-32  (79)
 36 PRK05419 putative sulfite oxid  44.4      30 0.00065   27.2   3.4   30   27-56    113-142 (205)
 37 CHL00080 psbM photosystem II p  44.2      24 0.00051   21.5   2.2   13   38-50      5-17  (34)
 38 PF06800 Sugar_transport:  Suga  43.8      38 0.00083   28.2   4.1   34   21-58     94-127 (269)
 39 COG3715 ManY Phosphotransferas  42.2      60  0.0013   27.3   5.0   14   25-38    203-216 (265)
 40 TIGR03038 PS_II_psbM photosyst  42.0      27 0.00058   21.1   2.2   13   38-50      5-17  (33)
 41 PRK14094 psbM photosystem II r  41.9      25 0.00054   23.0   2.1   13   38-50      5-17  (50)
 42 PHA03283 envelope glycoprotein  41.7      51  0.0011   30.4   4.8   30   22-53    393-424 (542)
 43 PF06305 DUF1049:  Protein of u  41.4      45 0.00098   20.8   3.3   29   21-49     11-40  (68)
 44 PF15339 Afaf:  Acrosome format  40.8      37 0.00081   27.6   3.4   23   31-53    132-154 (200)
 45 PF12259 DUF3609:  Protein of u  40.5      30 0.00065   29.7   3.1   23   34-57    302-324 (361)
 46 PF13295 DUF4077:  Domain of un  40.2      11 0.00024   29.3   0.4   27   30-56    114-140 (175)
 47 PRK11486 flagellar biosynthesi  39.7      77  0.0017   23.7   4.8   17   79-95     60-76  (124)
 48 COG4961 TadG Flp pilus assembl  39.0      31 0.00068   26.1   2.7   20   33-52     21-40  (185)
 49 PRK04989 psbM photosystem II r  38.3      33  0.0007   21.0   2.1   12   39-50      6-17  (35)
 50 PF15330 SIT:  SHP2-interacting  38.2      47   0.001   24.0   3.4   26   32-57      3-28  (107)
 51 PF14991 MLANA:  Protein melan-  37.8      11 0.00023   28.4   0.0   19   39-57     32-50  (118)
 52 PF05568 ASFV_J13L:  African sw  37.1      48   0.001   26.5   3.5   21   36-56     37-57  (189)
 53 PF07172 GRP:  Glycine rich pro  37.0      44 0.00096   23.6   3.0    7   50-56     22-28  (95)
 54 PF03229 Alpha_GJ:  Alphavirus   36.3 1.4E+02   0.003   22.8   5.7   36   21-57     74-117 (126)
 55 PF01102 Glycophorin_A:  Glycop  36.2      56  0.0012   24.3   3.6   31   31-61     70-100 (122)
 56 PF14241 DUF4341:  Domain of un  35.7      59  0.0013   21.1   3.3   22   26-49      1-22  (62)
 57 PF09049 SNN_transmemb:  Stanni  35.1   1E+02  0.0022   18.5   4.3   27   25-54      6-33  (33)
 58 PF01998 DUF131:  Protein of un  34.3      23 0.00049   23.7   1.1   25   26-50     32-59  (64)
 59 PF06596 PsbX:  Photosystem II   34.1      67  0.0015   19.9   3.1   20   31-50     12-31  (39)
 60 PF11143 DUF2919:  Protein of u  34.0      51  0.0011   25.0   3.1   23   34-57     57-79  (149)
 61 PF06103 DUF948:  Bacterial pro  33.5      39 0.00085   22.5   2.2   13   41-53      5-17  (90)
 62 PF10873 DUF2668:  Protein of u  33.3      44 0.00096   26.3   2.7   28   32-60     67-94  (155)
 63 PRK13726 conjugal transfer pil  33.0      83  0.0018   24.7   4.2   34   25-58      7-43  (188)
 64 PF01794 Ferric_reduct:  Ferric  32.4      93   0.002   20.6   3.9   27   27-53     76-102 (125)
 65 PRK13415 flagella biosynthesis  31.5 1.6E+02  0.0035   24.2   5.8   19   82-101   120-138 (219)
 66 PF05255 UPF0220:  Uncharacteri  31.2      62  0.0013   25.0   3.2   27   30-56    102-128 (166)
 67 PRK05696 fliL flagellar basal   29.9 1.8E+02  0.0038   21.9   5.5   23   82-104    71-93  (170)
 68 TIGR03054 photo_alph_chp1 puta  29.3 1.8E+02  0.0038   22.1   5.3   26   34-59      3-28  (135)
 69 PF01034 Syndecan:  Syndecan do  28.9      22 0.00048   24.1   0.4   12   42-53     24-35  (64)
 70 PF13903 Claudin_2:  PMP-22/EMP  28.9      91   0.002   21.7   3.5   25   31-55     73-97  (172)
 71 cd02435 CCC1 CCC1. CCC1: This   28.3      93   0.002   25.1   3.9   30   28-57    173-207 (241)
 72 PF13807 GNVR:  G-rich domain o  28.3 1.2E+02  0.0025   20.0   3.8   20   25-44     54-73  (82)
 73 PF15470 DUF4637:  Domain of un  28.2      15 0.00033   29.1  -0.6   17   19-36     90-106 (173)
 74 PF13798 PCYCGC:  Protein of un  28.1      40 0.00086   26.4   1.7   22   38-59      1-22  (158)
 75 PF15240 Pro-rich:  Proline-ric  28.0      41 0.00088   26.8   1.8   13   38-50      2-14  (179)
 76 PTZ00260 dolichyl-phosphate be  28.0 1.4E+02   0.003   24.5   4.9   19   82-100    67-85  (333)
 77 COG4736 CcoQ Cbb3-type cytochr  27.7 1.1E+02  0.0024   20.4   3.5   27   31-57      5-31  (60)
 78 PF04906 Tweety:  Tweety;  Inte  27.3 1.1E+02  0.0024   26.4   4.4   12   41-52    371-382 (406)
 79 PF10883 DUF2681:  Protein of u  27.1      70  0.0015   22.7   2.7   20   38-57      7-26  (87)
 80 PRK10081 entericidin B membran  26.7      80  0.0017   20.4   2.6   21   35-55      6-26  (48)
 81 PF04976 DmsC:  DMSO reductase   26.6      93   0.002   25.1   3.6   28   19-46    140-168 (276)
 82 PHA00736 hypothetical protein   26.5      59  0.0013   22.8   2.2   14   31-44     57-70  (79)
 83 PRK15065 PTS system mannose-sp  26.3   1E+02  0.0023   25.5   3.9   27   27-53    206-236 (262)
 84 PF06697 DUF1191:  Protein of u  25.6      26 0.00056   29.5   0.3   59   19-96    208-267 (278)
 85 PF04133 Vps55:  Vacuolar prote  25.6      75  0.0016   23.4   2.7   18   39-56      7-24  (120)
 86 PF15144 DUF4576:  Domain of un  25.3      89  0.0019   22.4   2.9   11   42-52     12-22  (88)
 87 PF14851 FAM176:  FAM176 family  25.3 2.1E+02  0.0045   22.1   5.2   23   30-53     25-47  (153)
 88 cd07387 MPP_PolD2_C PolD2 (DNA  25.2      44 0.00095   27.3   1.5   18   88-105    97-114 (257)
 89 cd01059 CCC1_like CCC1-related  25.1 1.4E+02  0.0029   21.8   4.0   30   28-57     79-114 (143)
 90 PF10717 ODV-E18:  Occlusion-de  25.0 1.2E+02  0.0026   21.8   3.5   23   38-60     28-50  (85)
 91 COG0813 DeoD Purine-nucleoside  24.9      24 0.00052   29.4  -0.0   16   88-103    16-32  (236)
 92 PF06365 CD34_antigen:  CD34/Po  24.8      67  0.0015   25.9   2.5   18   31-48    101-120 (202)
 93 PF07589 VPEP:  PEP-CTERM motif  24.7      96  0.0021   17.0   2.4   11   41-51     10-20  (25)
 94 PF03381 CDC50:  LEM3 (ligand-e  24.7 1.5E+02  0.0033   24.2   4.6   33   24-56    241-273 (278)
 95 KOG3626 Organic anion transpor  24.1 1.3E+02  0.0028   28.6   4.5   27   29-55    673-699 (735)
 96 PRK12785 fliL flagellar basal   24.1      97  0.0021   23.4   3.1   21   82-103    70-92  (166)
 97 TIGR03007 pepcterm_ChnLen poly  24.0 1.3E+02  0.0029   25.5   4.2   31   27-57    411-441 (498)
 98 PF10826 DUF2551:  Protein of u  23.9      60  0.0013   23.1   1.8   18   33-50     44-61  (83)
 99 PF10577 UPF0560:  Uncharacteri  23.6   1E+02  0.0022   29.8   3.8   24   29-52    273-296 (807)
100 PRK13792 lysozyme inhibitor; P  23.1      44 0.00096   25.1   1.1   22   36-57      4-25  (127)
101 CHL00066 psbH photosystem II p  22.7 1.2E+02  0.0026   21.2   3.1   21   35-55     43-63  (73)
102 PF11353 DUF3153:  Protein of u  22.7   1E+02  0.0022   23.8   3.1    7   19-25    177-183 (209)
103 PF06814 Lung_7-TM_R:  Lung sev  22.5 1.4E+02  0.0031   23.8   4.0   38   19-56     38-75  (295)
104 PF11153 DUF2931:  Protein of u  22.4      72  0.0016   24.6   2.2   19   40-58      5-23  (216)
105 TIGR01167 LPXTG_anchor LPXTG-m  22.0 1.4E+02   0.003   16.3   2.8    6   30-35     13-18  (34)
106 PLN00085 photosystem II reacti  21.7      77  0.0017   24.5   2.2   13   38-50     82-94  (149)
107 COG4885 Uncharacterized protei  21.6      78  0.0017   27.3   2.4   23   34-56    289-311 (312)
108 TIGR03363 VI_chp_8 type VI sec  21.6      45 0.00099   28.0   1.0    9   25-33    313-321 (353)
109 PF01940 DUF92:  Integral membr  21.4      92   0.002   25.2   2.7   31   29-59     33-63  (226)
110 PF00974 Rhabdo_glycop:  Rhabdo  21.4      31 0.00068   30.7   0.0    8   19-26    446-453 (501)
111 TIGR03501 gamma_C_targ gammapr  21.3   1E+02  0.0022   17.3   2.1   17   39-55      5-21  (26)
112 PRK10884 SH3 domain-containing  21.1      85  0.0019   24.9   2.4   17   30-47    174-190 (206)
113 PF01594 UPF0118:  Domain of un  21.0 1.5E+02  0.0031   23.3   3.7   26   30-55    302-327 (327)
114 PF06387 Calcyon:  D1 dopamine   20.9      72  0.0016   25.8   1.9   14   39-52     85-98  (186)
115 PF13623 SurA_N_2:  SurA N-term  20.9      90   0.002   23.3   2.4   17   37-53     10-26  (145)
116 KOG4671 Brain cell membrane pr  20.3      96  0.0021   25.3   2.5   27   23-53     12-39  (201)
117 PF12606 RELT:  Tumour necrosis  20.2 2.5E+02  0.0055   18.0   4.2   18   42-59     12-29  (50)

No 1  
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=87.30  E-value=0.62  Score=34.69  Aligned_cols=35  Identities=26%  Similarity=0.404  Sum_probs=23.7

Q ss_pred             CCCCChhHHHHHHHHHHHHHHHHHHHHHhhhcccCC
Q 035876           23 HWNSPLPYLFGGLGLMMGLITVALMILACSYRKSSS   58 (117)
Q Consensus        23 ~W~SPvPYLFgGLA~MLgLIAvALLILaCSy~K~ss   58 (117)
                      .+..|+= ...-|++|.|+|++.|||+-|-||+...
T Consensus        60 ~fs~~~i-~~Ii~gv~aGvIg~Illi~y~irR~~Kk   94 (122)
T PF01102_consen   60 RFSEPAI-IGIIFGVMAGVIGIILLISYCIRRLRKK   94 (122)
T ss_dssp             SSS-TCH-HHHHHHHHHHHHHHHHHHHHHHHHHS--
T ss_pred             Cccccce-eehhHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            4445542 4456889999999999998888765543


No 2  
>PF02439 Adeno_E3_CR2:  Adenovirus E3 region protein CR2;  InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D adenovirus) 49 kDa protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=86.66  E-value=1.5  Score=27.16  Aligned_cols=29  Identities=21%  Similarity=0.505  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcccCCC
Q 035876           31 LFGGLGLMMGLITVALMILACSYRKSSSN   59 (117)
Q Consensus        31 LFgGLA~MLgLIAvALLILaCSy~K~ss~   59 (117)
                      ...|..+-|.+|.+..+.-+|-|||..++
T Consensus         8 IIv~V~vg~~iiii~~~~YaCcykk~~~~   36 (38)
T PF02439_consen    8 IIVAVVVGMAIIIICMFYYACCYKKHRRQ   36 (38)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHcccccc
Confidence            56778888888999999999999997653


No 3  
>PF07204 Orthoreo_P10:  Orthoreovirus membrane fusion protein p10;  InterPro: IPR009854 This family consists of several Orthoreovirus membrane fusion protein p10 sequences. p10 is thought to be a multifunctional protein that plays a key role in virus-host interaction [].
Probab=85.35  E-value=0.55  Score=34.30  Aligned_cols=37  Identities=32%  Similarity=0.468  Sum_probs=29.6

Q ss_pred             cCCCCChhHHHHHHHHHHHHHHHHHHHHHhhhcccCC
Q 035876           22 GHWNSPLPYLFGGLGLMMGLITVALMILACSYRKSSS   58 (117)
Q Consensus        22 ~~W~SPvPYLFgGLA~MLgLIAvALLILaCSy~K~ss   58 (117)
                      +..-+=.|||-+|=+++|.||-++|+.-.|.+||.+.
T Consensus        36 S~~~ayWpyLA~GGG~iLilIii~Lv~CC~~K~K~~~   72 (98)
T PF07204_consen   36 SSFVAYWPYLAAGGGLILILIIIALVCCCRAKHKTSA   72 (98)
T ss_pred             ehHHhhhHHhhccchhhhHHHHHHHHHHhhhhhhhHh
Confidence            4556677999999899998888888887788888653


No 4  
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=71.55  E-value=4.2  Score=29.29  Aligned_cols=15  Identities=27%  Similarity=0.589  Sum_probs=5.8

Q ss_pred             HHHHHHHHHHhhhcc
Q 035876           41 LITVALMILACSYRK   55 (117)
Q Consensus        41 LIAvALLILaCSy~K   55 (117)
                      +|.|.|++.+|-.+|
T Consensus        11 ~i~l~~~~~~~~~rR   25 (130)
T PF12273_consen   11 AILLFLFLFYCHNRR   25 (130)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            333333344443333


No 5  
>PF13214 DUF4022:  Protein of unknown function (DUF4022)
Probab=69.99  E-value=4.5  Score=28.46  Aligned_cols=17  Identities=41%  Similarity=0.761  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 035876           34 GLGLMMGLITVALMILA   50 (117)
Q Consensus        34 GLA~MLgLIAvALLILa   50 (117)
                      |+--+|.++++||++||
T Consensus         8 gm~~imsistlalllla   24 (83)
T PF13214_consen    8 GMNHIMSISTLALLLLA   24 (83)
T ss_pred             chhHHHHHHHHHHHHHH
Confidence            44445666666666554


No 6  
>PF15347 PAG:  Phosphoprotein associated with glycosphingolipid-enriched
Probab=65.66  E-value=5.1  Score=35.64  Aligned_cols=23  Identities=26%  Similarity=0.680  Sum_probs=19.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhh
Q 035876           31 LFGGLGLMMGLITVALMILACSY   53 (117)
Q Consensus        31 LFgGLA~MLgLIAvALLILaCSy   53 (117)
                      |.|+||++-.++-|.+|||.||-
T Consensus        17 lwgsLaav~~f~lis~LifLCsS   39 (428)
T PF15347_consen   17 LWGSLAAVTTFLLISFLIFLCSS   39 (428)
T ss_pred             eehHHHHHHHHHHHHHHHHHhhc
Confidence            67899998888888899999876


No 7  
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=65.25  E-value=2.1  Score=35.99  Aligned_cols=7  Identities=43%  Similarity=0.449  Sum_probs=0.0

Q ss_pred             eeEEEec
Q 035876           86 KIVVIMA   92 (117)
Q Consensus        86 ~v~ViMa   92 (117)
                      +..|||-
T Consensus       209 ~~P~Ilk  215 (290)
T PF05454_consen  209 KSPVILK  215 (290)
T ss_dssp             -------
T ss_pred             CCCeeec
Confidence            6677774


No 8  
>TIGR00847 ccoS cytochrome oxidase maturation protein, cbb3-type. CcoS from Rhodobacter capsulatus has been shown essential for incorporation of redox-active prosthetic groups (heme, Cu) into cytochrome cbb(3) oxidase. FixS of Bradyrhizobium japonicum appears to have the same function. Members of this family are found so far in organisms with a cbb3-type cytochrome oxidase, including Neisseria meningitidis, Helicobacter pylori, Campylobacter jejuni, Caulobacter crescentus, Bradyrhizobium japonicum, and Rhodobacter capsulatus.
Probab=64.17  E-value=13  Score=24.07  Aligned_cols=23  Identities=9%  Similarity=0.288  Sum_probs=18.1

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHH
Q 035876           28 LPYLFGGLGLMMGLITVALMILA   50 (117)
Q Consensus        28 vPYLFgGLA~MLgLIAvALLILa   50 (117)
                      +-|+..++++++|+++++.++.+
T Consensus         3 il~~LIpiSl~l~~~~l~~f~Wa   25 (51)
T TIGR00847         3 ILTILIPISLLLGGVGLVAFLWS   25 (51)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHH
Confidence            45888889998888887777665


No 9  
>PRK09757 PTS system N-acetylgalactosamine-specific transporter subunit IIC; Provisional
Probab=64.08  E-value=9.2  Score=31.56  Aligned_cols=28  Identities=25%  Similarity=0.470  Sum_probs=19.2

Q ss_pred             ChhHHHHHHHHH--HH---HHHHHHHHHHhhhc
Q 035876           27 PLPYLFGGLGLM--MG---LITVALMILACSYR   54 (117)
Q Consensus        27 PvPYLFgGLA~M--Lg---LIAvALLILaCSy~   54 (117)
                      =.||+|.|+.+.  ++   +|++|++-++|.+.
T Consensus       206 ~~~ff~lGF~l~ayl~~~~~i~iaiig~~iA~~  238 (267)
T PRK09757        206 YIPYLIAGFLFVCYIQVSNLLPVAVLGAGFAVY  238 (267)
T ss_pred             hHHHHHHHHHHHHHhCCccHHHHHHHHHHHHHH
Confidence            469999998764  22   57777766666553


No 10 
>PF05283 MGC-24:  Multi-glycosylated core protein 24 (MGC-24);  InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor. Its functions include mediating, or regulating, haematopoietic progenitor cell adhesion and the negative regulation of their growth and/or-differentiation. It exists in the native state as a disulphide- linked homodimer of two 80-85kDa subunits. It is usually expressed by CD34+ and CD341o/- haematopoietic stem cells and associated microenvironmental cells. It contains, in its extracellular region, two mucin domains (I and II) linked by a non-mucin domain, which has been predicted to contain intra- disulphide bridges. This receptor may play a key role in haematopoiesis by facilitating the adhesion of human CD34+ cells to bone marrow stroma and by negatively regulating CD34+ CD341o/- haematopoietic progenitor cell proliferation. These effects involve the CD164 class I and/or II epitopes recognised by the monoclonal antibodies (mAbs) 105A5 and 103B2/9E10. These epitopes are carbohydrate-dependent and are located on the N-terminal mucin domain I [, ]. It has been found that murine MGC-24v and rat endolyn share significant sequence similarities with human CD164. However, CD164 lacks the consensus glycosaminoglycan (GAG)-attachment site found in MGC-24; it is possible that GAG-association is responsible for the high molecular weight of the epithelial-derived MGC-24 glycoprotein [].  Genomic structure studies have placed CD164 within the mucin-subgroup that comprises multiple exons, and demonstrate the diverse chromosomal distribution of this family of molecules. Molecules with such multiple exons may have sophisticated regulatory mechanisms that involve not only post-translational modifications of the oligosaccharide side chains, but also differential exon usage. Although differences in the intron and exon sizes are seen between the mouse and human genes, the predicted proteins are similar in size and structure, maintaining functionally important motifs that regulate cell proliferation or subcellular distribution [].  CD164 is a gene whose expression depends on differential usage of poly- adenylation sites within the 3'-UTR. The conserved distribution of the 3.2- and 1.2-kb CD164 transcripts between mouse and human suggests that (i) a mechanism may exist to regulate tissue-specific polyadenylation, and (ii) differences in polyadenylation are important for the expression and function of CD164 in different tissues. Two other aspects of the structure of CD164 are of particular interest. First, it shares one of several conserved features of a cytokine-binding pocket - in this respect, it is notable that evidence exists for a class of cell-surface sialomucin modulators that directly interact with growth factor receptors to regulate their response to physiological ligands. Second, its cytoplasmic tail contains a C-terminal YHTL motif found in many endocytic membrane proteins or receptors. These Tyr-based motifs bind to adaptor proteins, which mediate the sorting of membrane proteins into transport vesicles from the plasma membrane to the endosomes, and between intracellular compartments. 
Probab=62.82  E-value=7.8  Score=30.77  Aligned_cols=21  Identities=19%  Similarity=0.637  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q 035876           30 YLFGGLGLMMGLITVALMILA   50 (117)
Q Consensus        30 YLFgGLA~MLgLIAvALLILa   50 (117)
                      -++||+.+.|||+||++.++-
T Consensus       162 SFiGGIVL~LGv~aI~ff~~K  182 (186)
T PF05283_consen  162 SFIGGIVLTLGVLAIIFFLYK  182 (186)
T ss_pred             hhhhHHHHHHHHHHHHHHHhh
Confidence            389999999999999887653


No 11 
>PF14575 EphA2_TM:  Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A ....
Probab=62.17  E-value=8.8  Score=25.91  Aligned_cols=24  Identities=17%  Similarity=0.339  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHHHHHHHhhhcccCC
Q 035876           35 LGLMMGLITVALMILACSYRKSSS   58 (117)
Q Consensus        35 LA~MLgLIAvALLILaCSy~K~ss   58 (117)
                      ++.++.|+++.++++.|.+|+..+
T Consensus         7 ~~g~~~ll~~v~~~~~~~rr~~~~   30 (75)
T PF14575_consen    7 IVGVLLLLVLVIIVIVCFRRCKYS   30 (75)
T ss_dssp             HHHHHHHHHHHHHHHCCCTT----
T ss_pred             HHHHHHHHHhheeEEEEEeeEcCC
Confidence            444555566666677777766543


No 12 
>TIGR00822 EII-Sor PTS system, mannose/fructose/sorbose family, IIC component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Man (PTS splinter group) family is unique in several respects among PTS permease families. It is the only PTS family in which members possess a IID protein. It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue. Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars. The mannose permease of E. coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine,N-acetylglucosamine, and other sugars. Other members of this family can transport sorbose, fructose and N-acetylglucosamine. This family is specific for the sorbose-specific IIC subunits of this family of PTS transporters.
Probab=61.42  E-value=17  Score=30.05  Aligned_cols=27  Identities=11%  Similarity=0.155  Sum_probs=18.5

Q ss_pred             ChhHHHHHHHHHHHH----HHHHHHHHHhhh
Q 035876           27 PLPYLFGGLGLMMGL----ITVALMILACSY   53 (117)
Q Consensus        27 PvPYLFgGLA~MLgL----IAvALLILaCSy   53 (117)
                      =.||+|.|+.++--|    +++|++-+++.+
T Consensus       205 ~~~ff~lGF~laayl~l~~l~iAiig~~~A~  235 (265)
T TIGR00822       205 LMPFFYLGFLFAAYTDFSLLAFGAVGGAGAL  235 (265)
T ss_pred             hHHHHHHHHHHHHHhCCcHHHHHHHHHHHHH
Confidence            479999999876444    666665555544


No 13 
>PF11174 DUF2970:  Protein of unknown function (DUF2970);  InterPro: IPR021344  This short family is conserved in Proteobacteria. The function is not known. 
Probab=60.74  E-value=15  Score=23.96  Aligned_cols=19  Identities=21%  Similarity=0.445  Sum_probs=14.4

Q ss_pred             CCChhHHHHHHHHHHHHHH
Q 035876           25 NSPLPYLFGGLGLMMGLIT   43 (117)
Q Consensus        25 ~SPvPYLFgGLA~MLgLIA   43 (117)
                      .+|.||++.|+.+.+.+|+
T Consensus        28 ~~p~~~Ii~gii~~~~fV~   46 (56)
T PF11174_consen   28 GSPVHFIIVGIILAALFVA   46 (56)
T ss_pred             CCCchHHHHHHHHHHHHHH
Confidence            4799999999876665554


No 14 
>PF03597 CcoS:  Cytochrome oxidase maturation protein cbb3-type;  InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation []. Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase. 
Probab=60.11  E-value=17  Score=22.77  Aligned_cols=22  Identities=32%  Similarity=0.606  Sum_probs=16.9

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHH
Q 035876           29 PYLFGGLGLMMGLITVALMILA   50 (117)
Q Consensus        29 PYLFgGLA~MLgLIAvALLILa   50 (117)
                      -|+..++++++++++++.++.+
T Consensus         3 l~~lip~sl~l~~~~l~~f~Wa   24 (45)
T PF03597_consen    3 LYILIPVSLILGLIALAAFLWA   24 (45)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHH
Confidence            4788888888888877776665


No 15 
>PF05151 PsbM:  Photosystem II reaction centre M protein (PsbM);  InterPro: IPR007826 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbM found in PSII. PsbM is one of the most hydrophobic proteins in the thylakoid membrane. The function of this protein is unknown.; GO: 0015979 photosynthesis, 0019684 photosynthesis, light reaction, 0009523 photosystem II, 0016021 integral to membrane; PDB: 3A0H_m 3ARC_m 3A0B_M 3PRR_M 3PRQ_M 1S5L_M 4FBY_e 3BZ2_M 3BZ1_M 2AXT_M ....
Probab=59.43  E-value=7.8  Score=23.05  Aligned_cols=14  Identities=36%  Similarity=0.560  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHhh
Q 035876           39 MGLITVALMILACS   52 (117)
Q Consensus        39 LgLIAvALLILaCS   52 (117)
                      +|+||.||.|+.++
T Consensus         6 l~fiAtaLfi~iPt   19 (31)
T PF05151_consen    6 LAFIATALFILIPT   19 (31)
T ss_dssp             THHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHH
Confidence            57788888877754


No 16 
>PRK13592 ubiA prenyltransferase; Provisional
Probab=58.52  E-value=12  Score=31.60  Aligned_cols=29  Identities=10%  Similarity=0.145  Sum_probs=22.9

Q ss_pred             CCChhHH-HHHHHHHHHHHHHHHHHHHhhh
Q 035876           25 NSPLPYL-FGGLGLMMGLITVALMILACSY   53 (117)
Q Consensus        25 ~SPvPYL-FgGLA~MLgLIAvALLILaCSy   53 (117)
                      -||.||+ ++.++..+.+++.++++++|..
T Consensus       232 ~s~lp~~~~g~~g~~~l~~~~~~~l~~~~~  261 (299)
T PRK13592        232 TNFALLWNISHVGVVVLVLNVIWMTVQFEQ  261 (299)
T ss_pred             HhhHHHHHhhhhHHHHHHHHHHHHHHHHHH
Confidence            3789999 7777777777888888888863


No 17 
>PF15048 OSTbeta:  Organic solute transporter subunit beta protein
Probab=57.56  E-value=13  Score=28.24  Aligned_cols=26  Identities=19%  Similarity=0.267  Sum_probs=21.9

Q ss_pred             CChhHHHHHHHHHHHHHHHHHHHHHh
Q 035876           26 SPLPYLFGGLGLMMGLITVALMILAC   51 (117)
Q Consensus        26 SPvPYLFgGLA~MLgLIAvALLILaC   51 (117)
                      ||--|-..+|+++..+|.|.||...-
T Consensus        33 tpWNysiL~Ls~vvlvi~~~LLgrsi   58 (125)
T PF15048_consen   33 TPWNYSILALSFVVLVISFFLLGRSI   58 (125)
T ss_pred             CCcchHHHHHHHHHHHHHHHHHHHHh
Confidence            56679999999999999999987653


No 18 
>PF06667 PspB:  Phage shock protein B;  InterPro: IPR009554 This family consists of several bacterial phage shock protein B (PspB) sequences. The phage shock protein (psp) operon is induced in response to heat, ethanol, osmotic shock and infection by filamentous bacteriophages []. Expression of the operon requires the alternative sigma factor sigma54 and the transcriptional activator PspF. In addition, PspA plays a negative regulatory role, and the integral-membrane proteins PspB and PspC play a positive one [].; GO: 0006355 regulation of transcription, DNA-dependent, 0009271 phage shock
Probab=56.20  E-value=17  Score=25.09  Aligned_cols=28  Identities=29%  Similarity=0.269  Sum_probs=19.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcccC
Q 035876           30 YLFGGLGLMMGLITVALMILACSYRKSS   57 (117)
Q Consensus        30 YLFgGLA~MLgLIAvALLILaCSy~K~s   57 (117)
                      +.|...-+++++|-||.+-|..-|++..
T Consensus         3 ~~fl~~plivf~ifVap~WL~lHY~sk~   30 (75)
T PF06667_consen    3 FEFLFVPLIVFMIFVAPIWLILHYRSKW   30 (75)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            4566666777778888887777776544


No 19 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=54.56  E-value=4.1  Score=35.67  Aligned_cols=35  Identities=20%  Similarity=0.251  Sum_probs=0.0

Q ss_pred             cCCCCChhHHHHHH----HHHHHHHHHHHHHHHhhhccc
Q 035876           22 GHWNSPLPYLFGGL----GLMMGLITVALMILACSYRKS   56 (117)
Q Consensus        22 ~~W~SPvPYLFgGL----A~MLgLIAvALLILaCSy~K~   56 (117)
                      ..|.++.-.+.+++    ++++.++.++++++.|.+||.
T Consensus       345 ~~~~~~~~~~l~vVlgvavlivVv~viv~vc~~~rrrR~  383 (439)
T PF02480_consen  345 SPRTSRGAALLGVVLGVAVLIVVVGVIVWVCLRCRRRRR  383 (439)
T ss_dssp             ---------------------------------------
T ss_pred             CCCCCcccchHHHHHHHHHHHHHHHHHhheeeeehhccc
Confidence            44555544444444    344444444444444555443


No 20 
>TIGR02976 phageshock_pspB phage shock protein B. This model describes the PspB protein of the psp (phage shock protein) operon, as found in Escherichia coli and many related species. Expression of a phage protein called secretin protein IV, and a number of other stresses including ethanol, heat shock, and defects in protein secretion trigger sigma-54-dependent expression of the phage shock regulon. PspB is both a regulator and an effector protein of the phage shock response.
Probab=53.46  E-value=19  Score=24.68  Aligned_cols=29  Identities=28%  Similarity=0.364  Sum_probs=21.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcccCC
Q 035876           30 YLFGGLGLMMGLITVALMILACSYRKSSS   58 (117)
Q Consensus        30 YLFgGLA~MLgLIAvALLILaCSy~K~ss   58 (117)
                      +.|..+-+++++|-||.+-|..-|++...
T Consensus         3 ~~fl~~Pliif~ifVap~wl~lHY~~k~~   31 (75)
T TIGR02976         3 IFFLAIPLIIFVIFVAPLWLILHYRSKRK   31 (75)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhhhc
Confidence            45777777888888888888888875443


No 21 
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=52.89  E-value=12  Score=30.45  Aligned_cols=27  Identities=26%  Similarity=0.427  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcccCC
Q 035876           31 LFGGLGLMMGLITVALMILACSYRKSSS   58 (117)
Q Consensus        31 LFgGLA~MLgLIAvALLILaCSy~K~ss   58 (117)
                      +..|+++ .|||.+.|+.-.|.|||.++
T Consensus       275 IaVG~~L-a~lvlivLiaYli~Rrr~~~  301 (306)
T PF01299_consen  275 IAVGAAL-AGLVLIVLIAYLIGRRRSRA  301 (306)
T ss_pred             HHHHHHH-HHHHHHHHHhheeEeccccc
Confidence            4455443 56677777777777777665


No 22 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=51.93  E-value=6  Score=28.48  Aligned_cols=24  Identities=21%  Similarity=0.258  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHHhhhcccCCCC
Q 035876           37 LMMGLITVALMILACSYRKSSSNS   60 (117)
Q Consensus        37 ~MLgLIAvALLILaCSy~K~ss~s   60 (117)
                      +.++||+++||+|+..++.+.+..
T Consensus         4 l~~iii~~i~l~~~~~~~~~rRR~   27 (130)
T PF12273_consen    4 LFAIIIVAILLFLFLFYCHNRRRR   27 (130)
T ss_pred             eHHHHHHHHHHHHHHHHHHHHHHh
Confidence            344556666666666666655543


No 23 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=51.83  E-value=4.8  Score=35.24  Aligned_cols=41  Identities=20%  Similarity=0.259  Sum_probs=0.0

Q ss_pred             cCCCCChhHHHHHHHHHHHHHHHHHHH-------HHhhhcccCCCCCC
Q 035876           22 GHWNSPLPYLFGGLGLMMGLITVALMI-------LACSYRKSSSNSAT   62 (117)
Q Consensus        22 ~~W~SPvPYLFgGLA~MLgLIAvALLI-------LaCSy~K~ss~s~~   62 (117)
                      .....|-+=-.-++.+++++|+++++|       ++|.++|..+...+
T Consensus       339 ~~~~~p~~~~~~~~~~l~vVlgvavlivVv~viv~vc~~~rrrR~~~~  386 (439)
T PF02480_consen  339 AAPAPPSPRTSRGAALLGVVLGVAVLIVVVGVIVWVCLRCRRRRRQRD  386 (439)
T ss_dssp             ------------------------------------------------
T ss_pred             CCCCCCCCCCCcccchHHHHHHHHHHHHHHHHHhheeeeehhcccccc
Confidence            344555666666677776665444333       23777777777544


No 24 
>PF14914 LRRC37AB_C:  LRRC37A/B like protein 1 C-terminal domain
Probab=50.58  E-value=22  Score=27.87  Aligned_cols=28  Identities=32%  Similarity=0.475  Sum_probs=19.9

Q ss_pred             HHHHHH---HHHHHHHHHHHHHHhhhcccCC
Q 035876           31 LFGGLG---LMMGLITVALMILACSYRKSSS   58 (117)
Q Consensus        31 LFgGLA---~MLgLIAvALLILaCSy~K~ss   58 (117)
                      |.+++.   ++|.||.+.-||-.||+|+.+.
T Consensus       121 lilaisvtvv~~iliii~CLiei~shr~a~~  151 (154)
T PF14914_consen  121 LILAISVTVVVMILIIIFCLIEICSHRRASE  151 (154)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhcccccc
Confidence            455544   4566788888888999998764


No 25 
>PF15345 TMEM51:  Transmembrane protein 51
Probab=48.96  E-value=16  Score=30.19  Aligned_cols=30  Identities=23%  Similarity=0.382  Sum_probs=25.1

Q ss_pred             ccCCCCChhHHHHHHHHHHHHHHHHHHHHH
Q 035876           21 LGHWNSPLPYLFGGLGLMMGLITVALMILA   50 (117)
Q Consensus        21 ~~~W~SPvPYLFgGLA~MLgLIAvALLILa   50 (117)
                      ...=.+-|-|+..|-++||.|+++.|-|--
T Consensus        53 ~ksKt~SVAyVLVG~Gv~LLLLSICL~IR~   82 (233)
T PF15345_consen   53 LKSKTFSVAYVLVGSGVALLLLSICLSIRD   82 (233)
T ss_pred             ccceeEEEEEehhhHHHHHHHHHHHHHHHH
Confidence            466667899999999999999998887754


No 26 
>PF09928 DUF2160:  Predicted small integral membrane protein (DUF2160);  InterPro: IPR018678  The members of this family of hypothetical prokaryotic proteins have no known function. It is thought that they are transmembrane proteins, but their function has not been inferred yet. 
Probab=48.07  E-value=20  Score=25.74  Aligned_cols=22  Identities=32%  Similarity=0.575  Sum_probs=18.4

Q ss_pred             CCCCChhHHHHHHHHHHHHHHH
Q 035876           23 HWNSPLPYLFGGLGLMMGLITV   44 (117)
Q Consensus        23 ~W~SPvPYLFgGLA~MLgLIAv   44 (117)
                      .|..|+--+|+++++||+..++
T Consensus         3 aWT~ptA~FF~~I~~~L~~mtv   24 (88)
T PF09928_consen    3 AWTWPTAIFFICIALMLAGMTV   24 (88)
T ss_pred             CcchHHHHHHHHHHHHHHHHHH
Confidence            4899999999999998877654


No 27 
>PF05399 EVI2A:  Ectropic viral integration site 2A protein (EVI2A);  InterPro: IPR008608 This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [, ].; GO: 0016021 integral to membrane
Probab=47.85  E-value=18  Score=29.94  Aligned_cols=19  Identities=26%  Similarity=0.773  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHhhh
Q 035876           35 LGLMMGLITVALMILACSY   53 (117)
Q Consensus        35 LA~MLgLIAvALLILaCSy   53 (117)
                      .|..+.||-+|.|+|.|..
T Consensus       128 ~amLIClIIIAVLfLICT~  146 (227)
T PF05399_consen  128 MAMLICLIIIAVLFLICTL  146 (227)
T ss_pred             hhHHHHHHHHHHHHHHHHH
Confidence            4566778889999999953


No 28 
>PF12911 OppC_N:  N-terminal TM domain of oligopeptide transport permease C
Probab=47.74  E-value=22  Score=21.54  Aligned_cols=13  Identities=31%  Similarity=0.774  Sum_probs=5.3

Q ss_pred             HHHHHHHHHHHHH
Q 035876           38 MMGLITVALMILA   50 (117)
Q Consensus        38 MLgLIAvALLILa   50 (117)
                      |+|+|-+.++++.
T Consensus        19 ~~gl~il~~~vl~   31 (56)
T PF12911_consen   19 VIGLIILLILVLL   31 (56)
T ss_pred             HHHHHHHHHHHHH
Confidence            4444444444433


No 29 
>PF10215 Ost4:  Oligosaccaryltransferase  ;  InterPro: IPR018943  Ost4 is a very short, approximately 30 residues, enzyme found from fungi to vertebrates. It is a member of the ER oligosaccaryltansferase complex, 2.4.1.119 from EC, that catalyses the asparagine-linked glycosylation of proteins. It appears to be an integral membrane protein that mediates the en bloc transfer of a pre-assembled high-mannose oligosaccharide onto asparagine residues of nascent polypeptides as they enter the lumen of the rough endoplasmic reticulum. ; PDB: 1RKL_A 2LAT_A.
Probab=46.97  E-value=33  Score=20.66  Aligned_cols=17  Identities=24%  Similarity=0.477  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 035876           33 GGLGLMMGLITVALMIL   49 (117)
Q Consensus        33 gGLA~MLgLIAvALLIL   49 (117)
                      ..||..||+.++.|+++
T Consensus         8 ~~lan~lG~~~~~LIVl   24 (35)
T PF10215_consen    8 YTLANFLGVAAMVLIVL   24 (35)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            46788888888888876


No 30 
>COG4594 FecB ABC-type Fe3+-citrate transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=46.39  E-value=40  Score=29.00  Aligned_cols=23  Identities=22%  Similarity=0.541  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHHhhhcccC
Q 035876           35 LGLMMGLITVALMILACSYRKSS   57 (117)
Q Consensus        35 LA~MLgLIAvALLILaCSy~K~s   57 (117)
                      .++|++|+..-||+-+||-....
T Consensus         6 ~~~i~~lll~lllva~C~~s~~~   28 (310)
T COG4594           6 TAIILTLLLLLLLVAACSSSDNN   28 (310)
T ss_pred             hHHHHHHHHHHHHHHHhcCcCcc
Confidence            47788999999999999866433


No 31 
>PRK09458 pspB phage shock protein B; Provisional
Probab=45.90  E-value=30  Score=24.13  Aligned_cols=30  Identities=27%  Similarity=0.281  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcccCCC
Q 035876           30 YLFGGLGLMMGLITVALMILACSYRKSSSN   59 (117)
Q Consensus        30 YLFgGLA~MLgLIAvALLILaCSy~K~ss~   59 (117)
                      ++|...-+++++|-||.+=|..-|+.....
T Consensus         3 ~~fl~~PliiF~ifVaPiWL~LHY~sk~~~   32 (75)
T PRK09458          3 ALFLAIPLTIFVLFVAPIWLWLHYRSKRQG   32 (75)
T ss_pred             chHHHHhHHHHHHHHHHHHHHHhhcccccC
Confidence            678888899999999999999888664433


No 32 
>COG5416 Uncharacterized integral membrane protein [Function unknown]
Probab=45.84  E-value=29  Score=25.42  Aligned_cols=29  Identities=28%  Similarity=0.489  Sum_probs=23.8

Q ss_pred             ccCCCCChhHHHHHHHHHHHHHHHHHHHH
Q 035876           21 LGHWNSPLPYLFGGLGLMMGLITVALMIL   49 (117)
Q Consensus        21 ~~~W~SPvPYLFgGLA~MLgLIAvALLIL   49 (117)
                      ++.|+=|.=-.+.|-++|-+||++.+.+-
T Consensus        54 fg~~~~PLilvil~s~v~G~Li~~~~~~~   82 (98)
T COG5416          54 FGQWELPLILVILGAAVVGALIAMFAGIA   82 (98)
T ss_pred             cchhhhhHHHHHHHHHHHHHHHHHHHhHH
Confidence            36688888888999999999999887664


No 33 
>PHA02909 hypothetical protein; Provisional
Probab=45.75  E-value=24  Score=24.18  Aligned_cols=9  Identities=67%  Similarity=1.158  Sum_probs=6.8

Q ss_pred             HHHHHhhhc
Q 035876           46 LMILACSYR   54 (117)
Q Consensus        46 LLILaCSy~   54 (117)
                      ..||||||-
T Consensus        49 ftilacsyv   57 (72)
T PHA02909         49 FTILACSYV   57 (72)
T ss_pred             HHHHHHHHH
Confidence            358899984


No 34 
>PF11980 DUF3481:  Domain of unknown function (DUF3481);  InterPro: IPR022579  This domain of unknown function is located in the C terminus of the eukaryotic neuropilin receptor family of proteins. It is found in association with PF00754 from PFAM, PF00431 from PFAM and PF00629 from PFAM. There are two completely conserved residues (Y and E) that may be functionally important.
Probab=45.54  E-value=32  Score=24.75  Aligned_cols=26  Identities=27%  Similarity=0.446  Sum_probs=16.6

Q ss_pred             HHHHHHHHHHHHHHHHHHH-HHhhhcc
Q 035876           30 YLFGGLGLMMGLITVALMI-LACSYRK   55 (117)
Q Consensus        30 YLFgGLA~MLgLIAvALLI-LaCSy~K   55 (117)
                      |++.|=++.+.|++++|.+ |-|-|+.
T Consensus        18 yiiA~gga~llL~~v~l~vvL~C~r~~   44 (87)
T PF11980_consen   18 YIIAMGGALLLLVAVCLGVVLYCHRFH   44 (87)
T ss_pred             HHHhhccHHHHHHHHHHHHHHhhhhhc
Confidence            5677777778888888544 4444433


No 35 
>PF04277 OAD_gamma:  Oxaloacetate decarboxylase, gamma chain ;  InterPro: IPR005899  This family comprises distantly related, low complexity, hydrophobic small subunits of several related sodium ion-pumping decarboxylases. These include oxaloacetate decarboxylase gamma subunit and methylmalonyl-CoA decarboxylase delta subunit [].; GO: 0008948 oxaloacetate decarboxylase activity, 0015081 sodium ion transmembrane transporter activity, 0071436 sodium ion export, 0016020 membrane
Probab=45.50  E-value=19  Score=23.39  Aligned_cols=16  Identities=31%  Similarity=0.220  Sum_probs=7.1

Q ss_pred             HHHHHHHHHHHHhhhc
Q 035876           39 MGLITVALMILACSYR   54 (117)
Q Consensus        39 LgLIAvALLILaCSy~   54 (117)
                      ++|+-+.+++-.-++.
T Consensus        17 ~~L~lL~~~i~l~~~~   32 (79)
T PF04277_consen   17 LVLILLILVISLMSKL   32 (79)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3444444444444443


No 36 
>PRK05419 putative sulfite oxidase subunit YedZ; Reviewed
Probab=44.40  E-value=30  Score=27.22  Aligned_cols=30  Identities=27%  Similarity=0.397  Sum_probs=26.4

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 035876           27 PLPYLFGGLGLMMGLITVALMILACSYRKS   56 (117)
Q Consensus        27 PvPYLFgGLA~MLgLIAvALLILaCSy~K~   56 (117)
                      ..||+..|+.+++.|+.+|+.-.-+.+||.
T Consensus       113 ~~~~i~~G~ia~~lLl~LaiTS~~~~~rrL  142 (205)
T PRK05419        113 KRPYITVGMAAFLILLPLALTSTRASQRRL  142 (205)
T ss_pred             hchHHHHHHHHHHHHHHHHHHhhHHHHHHH
Confidence            468999999999999999999988888765


No 37 
>CHL00080 psbM photosystem II protein M
Probab=44.16  E-value=24  Score=21.45  Aligned_cols=13  Identities=38%  Similarity=0.731  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHHHH
Q 035876           38 MMGLITVALMILA   50 (117)
Q Consensus        38 MLgLIAvALLILa   50 (117)
                      .+|+||.+|.|+.
T Consensus         5 ~lgfiAt~LFi~i   17 (34)
T CHL00080          5 ILAFIATALFILV   17 (34)
T ss_pred             HHHHHHHHHHHHH
Confidence            3667777777665


No 38 
>PF06800 Sugar_transport:  Sugar transport protein;  InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long. Members include glucose uptake proteins [], ribose transport proteins, and several putative and hypothetical membrane proteins probably involved in sugar transport across bacterial membranes.; GO: 0015144 carbohydrate transmembrane transporter activity, 0034219 carbohydrate transmembrane transport, 0016021 integral to membrane
Probab=43.84  E-value=38  Score=28.17  Aligned_cols=34  Identities=32%  Similarity=0.603  Sum_probs=24.9

Q ss_pred             ccCCCCChhHHHHHHHHHHHHHHHHHHHHHhhhcccCC
Q 035876           21 LGHWNSPLPYLFGGLGLMMGLITVALMILACSYRKSSS   58 (117)
Q Consensus        21 ~~~W~SPvPYLFgGLA~MLgLIAvALLILaCSy~K~ss   58 (117)
                      |..|++..-+++|-+|+.+-++.+.|    ||+++..+
T Consensus        94 fgEW~~~~~~~~G~~Al~liiiGv~l----ts~~~~~~  127 (269)
T PF06800_consen   94 FGEWTTTTQKIIGFLALVLIIIGVIL----TSYQDKKS  127 (269)
T ss_pred             cCCCCCcchHHHHHHHHHHHHHHHHH----hccccccc
Confidence            57899999999888888777776654    55554443


No 39 
>COG3715 ManY Phosphotransferase system, mannose/fructose/N-acetylgalactosamine-specific component IIC [Carbohydrate transport and metabolism]
Probab=42.24  E-value=60  Score=27.26  Aligned_cols=14  Identities=29%  Similarity=0.653  Sum_probs=10.9

Q ss_pred             CCChhHHHHHHHHH
Q 035876           25 NSPLPYLFGGLGLM   38 (117)
Q Consensus        25 ~SPvPYLFgGLA~M   38 (117)
                      +.=.||+|.|+.+.
T Consensus       203 k~~~pff~lGFv~a  216 (265)
T COG3715         203 KELIPFFFLGFVLA  216 (265)
T ss_pred             cchhHHHHHHHHHH
Confidence            34579999998765


No 40 
>TIGR03038 PS_II_psbM photosystem II reaction center protein PsbM. Members of this protein family are the photosystem II reaction center M protein, product of the psbM gene, in Cyanobacteria and their derived organelles in plants. This model resembles Pfam model pfam05151 but has cutoffs set to avoid false-positive matches to similar (not necessarily homologous) sequences in species that are not photosynthetic.
Probab=41.97  E-value=27  Score=21.06  Aligned_cols=13  Identities=38%  Similarity=0.795  Sum_probs=8.5

Q ss_pred             HHHHHHHHHHHHH
Q 035876           38 MMGLITVALMILA   50 (117)
Q Consensus        38 MLgLIAvALLILa   50 (117)
                      .+|+||.||.|+.
T Consensus         5 ~l~fiAt~Lfi~i   17 (33)
T TIGR03038         5 ILGFIATLLFILV   17 (33)
T ss_pred             HHHHHHHHHHHHH
Confidence            3567777776665


No 41 
>PRK14094 psbM photosystem II reaction center protein M; Provisional
Probab=41.90  E-value=25  Score=22.97  Aligned_cols=13  Identities=15%  Similarity=0.358  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHHH
Q 035876           38 MMGLITVALMILA   50 (117)
Q Consensus        38 MLgLIAvALLILa   50 (117)
                      .||+||.||.|+.
T Consensus         5 ~lgfiAtaLFi~i   17 (50)
T PRK14094          5 NFGFVASLLFVGV   17 (50)
T ss_pred             HHHHHHHHHHHHH
Confidence            4667777776665


No 42 
>PHA03283 envelope glycoprotein E; Provisional
Probab=41.69  E-value=51  Score=30.42  Aligned_cols=30  Identities=23%  Similarity=0.499  Sum_probs=24.4

Q ss_pred             cCCCCChhH--HHHHHHHHHHHHHHHHHHHHhhh
Q 035876           22 GHWNSPLPY--LFGGLGLMMGLITVALMILACSY   53 (117)
Q Consensus        22 ~~W~SPvPY--LFgGLA~MLgLIAvALLILaCSy   53 (117)
                      ..|  +-+|  +++|+.+..||+.++|.+.+|-+
T Consensus       393 ~~~--~~~~l~~~~~~~~~~~~~~~~l~vw~c~~  424 (542)
T PHA03283        393 GAW--TRHYLAFLLAIICTCAALLVALVVWGCIL  424 (542)
T ss_pred             Ccc--ccccchhHHHHHHHHHHHHHHHhhhheee
Confidence            356  3556  58888899999999999999987


No 43 
>PF06305 DUF1049:  Protein of unknown function (DUF1049);  InterPro: IPR010445 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=41.42  E-value=45  Score=20.82  Aligned_cols=29  Identities=24%  Similarity=0.318  Sum_probs=16.4

Q ss_pred             ccCCCCChhH-HHHHHHHHHHHHHHHHHHH
Q 035876           21 LGHWNSPLPY-LFGGLGLMMGLITVALMIL   49 (117)
Q Consensus        21 ~~~W~SPvPY-LFgGLA~MLgLIAvALLIL   49 (117)
                      +..|+.+.|. +...+++.+|.+...|+.+
T Consensus        11 ~~~~~~~~pl~l~il~~f~~G~llg~l~~~   40 (68)
T PF06305_consen   11 FLFGQFPLPLGLLILIAFLLGALLGWLLSL   40 (68)
T ss_pred             EEeeeccchHHHHHHHHHHHHHHHHHHHHH
Confidence            5567777775 4445555566655554443


No 44 
>PF15339 Afaf:  Acrosome formation-associated factor
Probab=40.83  E-value=37  Score=27.55  Aligned_cols=23  Identities=26%  Similarity=0.397  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhh
Q 035876           31 LFGGLGLMMGLITVALMILACSY   53 (117)
Q Consensus        31 LFgGLA~MLgLIAvALLILaCSy   53 (117)
                      |..|+.+|-.+|-+.||++.|.-
T Consensus       132 LmLGIsLmTl~lfv~Ll~~c~at  154 (200)
T PF15339_consen  132 LMLGISLMTLFLFVILLAFCSAT  154 (200)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            88999999999999998888753


No 45 
>PF12259 DUF3609:  Protein of unknown function (DUF3609);  InterPro: IPR022048  This domain family is found in eukaryotes and viruses, and is typically between 348 and 360 amino acids in length. 
Probab=40.52  E-value=30  Score=29.71  Aligned_cols=23  Identities=35%  Similarity=0.332  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHHHHHHhhhcccC
Q 035876           34 GLGLMMGLITVALMILACSYRKSS   57 (117)
Q Consensus        34 GLA~MLgLIAvALLILaCSy~K~s   57 (117)
                      ..+..++||++ |+.|+|-||+.+
T Consensus       302 ~v~~~~vli~v-l~~~~~~~~~~~  324 (361)
T PF12259_consen  302 AVCGAIVLIIV-LISLAWLYRTFR  324 (361)
T ss_pred             ehhHHHHHHHH-HHHHHhheeehH
Confidence            34455566655 667777776643


No 46 
>PF13295 DUF4077:  Domain of unknown function (DUF4077)
Probab=40.18  E-value=11  Score=29.33  Aligned_cols=27  Identities=33%  Similarity=0.616  Sum_probs=22.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhccc
Q 035876           30 YLFGGLGLMMGLITVALMILACSYRKS   56 (117)
Q Consensus        30 YLFgGLA~MLgLIAvALLILaCSy~K~   56 (117)
                      ||---|.++||=+|+.|....||||..
T Consensus       114 ylserlvvilggvavvltfilcsywpe  140 (175)
T PF13295_consen  114 YLSERLVVILGGVAVVLTFILCSYWPE  140 (175)
T ss_pred             HHHhHHHHhcccchheeehhhhhcChH
Confidence            555567788888999999999999974


No 47 
>PRK11486 flagellar biosynthesis protein FliO; Provisional
Probab=39.72  E-value=77  Score=23.73  Aligned_cols=17  Identities=12%  Similarity=0.251  Sum_probs=11.0

Q ss_pred             ccccCCCeeEEEecCCC
Q 035876           79 MQTEMEPKIVVIMAGDD   95 (117)
Q Consensus        79 ~~~~~~~~v~ViMaGd~   95 (117)
                      .++-..|+|+|+=.||+
T Consensus        60 ~slG~RErvvvVeV~~~   76 (124)
T PRK11486         60 ASLGARERVVIVDVEDA   76 (124)
T ss_pred             eccCCccEEEEEEECCE
Confidence            34556677777766664


No 48 
>COG4961 TadG Flp pilus assembly protein TadG [Intracellular trafficking and secretion]
Probab=39.03  E-value=31  Score=26.12  Aligned_cols=20  Identities=20%  Similarity=0.464  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHHHHHHHHhh
Q 035876           33 GGLGLMMGLITVALMILACS   52 (117)
Q Consensus        33 gGLA~MLgLIAvALLILaCS   52 (117)
                      |..|+|++||+.-|++|.+-
T Consensus        21 Ga~AVeFAlvap~ll~l~~g   40 (185)
T COG4961          21 GAAAVEFALVAPPLLLLVFG   40 (185)
T ss_pred             chHHHHHHHHHHHHHHHHHH
Confidence            56789999999999988864


No 49 
>PRK04989 psbM photosystem II reaction center protein M; Provisional
Probab=38.30  E-value=33  Score=20.95  Aligned_cols=12  Identities=25%  Similarity=0.714  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHH
Q 035876           39 MGLITVALMILA   50 (117)
Q Consensus        39 LgLIAvALLILa   50 (117)
                      +|+||.+|.|+.
T Consensus         6 lgfiAt~Lfi~i   17 (35)
T PRK04989          6 LGFVASLLFVLV   17 (35)
T ss_pred             HHHHHHHHHHHH
Confidence            566666666654


No 50 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=38.17  E-value=47  Score=24.01  Aligned_cols=26  Identities=19%  Similarity=0.315  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhcccC
Q 035876           32 FGGLGLMMGLITVALMILACSYRKSS   57 (117)
Q Consensus        32 FgGLA~MLgLIAvALLILaCSy~K~s   57 (117)
                      ..++.++|-||.++.-|++|-.+|+.
T Consensus         3 Ll~il~llLll~l~asl~~wr~~~rq   28 (107)
T PF15330_consen    3 LLGILALLLLLSLAASLLAWRMKQRQ   28 (107)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            44555666678888888888776654


No 51 
>PF14991 MLANA:  Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P.
Probab=37.79  E-value=11  Score=28.44  Aligned_cols=19  Identities=26%  Similarity=0.495  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHhhhcccC
Q 035876           39 MGLITVALMILACSYRKSS   57 (117)
Q Consensus        39 LgLIAvALLILaCSy~K~s   57 (117)
                      |.+|-..||++-|-|.|.+
T Consensus        32 L~VILgiLLliGCWYckRR   50 (118)
T PF14991_consen   32 LIVILGILLLIGCWYCKRR   50 (118)
T ss_dssp             -------------------
T ss_pred             HHHHHHHHHHHhheeeeec
Confidence            3344445667777776543


No 52 
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=37.09  E-value=48  Score=26.48  Aligned_cols=21  Identities=29%  Similarity=0.600  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHHHhhhccc
Q 035876           36 GLMMGLITVALMILACSYRKS   56 (117)
Q Consensus        36 A~MLgLIAvALLILaCSy~K~   56 (117)
                      +..+-+|-+-+||..||+||.
T Consensus        37 aIvVliiiiivli~lcssRKk   57 (189)
T PF05568_consen   37 AIVVLIIIIIVLIYLCSSRKK   57 (189)
T ss_pred             HHHHHHHHHHHHHHHHhhhhH
Confidence            333334556677778999885


No 53 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=37.03  E-value=44  Score=23.63  Aligned_cols=7  Identities=14%  Similarity=0.131  Sum_probs=3.1

Q ss_pred             Hhhhccc
Q 035876           50 ACSYRKS   56 (117)
Q Consensus        50 aCSy~K~   56 (117)
                      .++-+.+
T Consensus        22 evaa~~~   28 (95)
T PF07172_consen   22 EVAAREL   28 (95)
T ss_pred             hhhhHHh
Confidence            3444444


No 54 
>PF03229 Alpha_GJ:  Alphavirus glycoprotein J;  InterPro: IPR004913 The exact function of the herpesvirus glycoprotein J is unknown, but it appears to play a role in the inhibition of apotosis of the host cell [].; GO: 0019050 suppression by virus of host apoptosis
Probab=36.33  E-value=1.4e+02  Score=22.82  Aligned_cols=36  Identities=31%  Similarity=0.426  Sum_probs=20.0

Q ss_pred             ccCCCCC-----hhHHHHHHHHHHHHHH---HHHHHHHhhhcccC
Q 035876           21 LGHWNSP-----LPYLFGGLGLMMGLIT---VALMILACSYRKSS   57 (117)
Q Consensus        21 ~~~W~SP-----vPYLFgGLA~MLgLIA---vALLILaCSy~K~s   57 (117)
                      ..+|.+|     +|-++|||++. .|++   ++||==.|-+|-+.
T Consensus        74 ~sp~ps~p~d~aLp~VIGGLcaL-~LaamGA~~LLrR~cRr~arr  117 (126)
T PF03229_consen   74 SSPGPSPPVDFALPLVIGGLCAL-TLAAMGAGALLRRCCRRAARR  117 (126)
T ss_pred             CCCCCCCCcccchhhhhhHHHHH-HHHHHHHHHHHHHHHHHHHHh
Confidence            3566665     57788888764 3333   33333346555443


No 55 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=36.17  E-value=56  Score=24.29  Aligned_cols=31  Identities=26%  Similarity=0.382  Sum_probs=16.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcccCCCCC
Q 035876           31 LFGGLGLMMGLITVALMILACSYRKSSSNSA   61 (117)
Q Consensus        31 LFgGLA~MLgLIAvALLILaCSy~K~ss~s~   61 (117)
                      +||-+|.++|+|++.+..+-=-++|...+..
T Consensus        70 i~gv~aGvIg~Illi~y~irR~~Kk~~~~~~  100 (122)
T PF01102_consen   70 IFGVMAGVIGIILLISYCIRRLRKKSSSDVQ  100 (122)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHS--------
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHhccCCCCCC
Confidence            4666777777777777777777777766543


No 56 
>PF14241 DUF4341:  Domain of unknown function (DUF4341)
Probab=35.67  E-value=59  Score=21.08  Aligned_cols=22  Identities=41%  Similarity=0.847  Sum_probs=14.8

Q ss_pred             CChhHHHHHHHHHHHHHHHHHHHH
Q 035876           26 SPLPYLFGGLGLMMGLITVALMIL   49 (117)
Q Consensus        26 SPvPYLFgGLA~MLgLIAvALLIL   49 (117)
                      ||.+.++||+  ++|+-++.|+.+
T Consensus         1 Tp~~~l~GG~--lIGla~~~ll~~   22 (62)
T PF14241_consen    1 TPWSALIGGL--LIGLAASLLLLL   22 (62)
T ss_pred             CccHHHHHHH--HHHHHHHHHHHH
Confidence            5788888885  556655555554


No 57 
>PF09049 SNN_transmemb:  Stannin transmembrane;  InterPro: IPR015135 This region consists of a single highly hydrophobic transmembrane helix that transverses the lipid bilayer at a 20 degree angle with respect to the membrane normal. It contains a conserved cysteine residue (Cys32) that, together with Cys34 found in the stannin unstructured linker domain, constitutes the putative trimethyltin-binding site that resides at the end of the transmembrane domain close to the lipid/solvent interface []. ; PDB: 1ZZA_A.
Probab=35.13  E-value=1e+02  Score=18.47  Aligned_cols=27  Identities=37%  Similarity=0.535  Sum_probs=14.5

Q ss_pred             CCChhHHHHHHHHHHHHHHHH-HHHHHhhhc
Q 035876           25 NSPLPYLFGGLGLMMGLITVA-LMILACSYR   54 (117)
Q Consensus        25 ~SPvPYLFgGLA~MLgLIAvA-LLILaCSy~   54 (117)
                      |||+-   |-.-...-|||+| |-+|.|-.|
T Consensus         6 hsptt---gvvti~viliavaalg~licgcw   33 (33)
T PF09049_consen    6 HSPTT---GVVTIIVILIAVAALGALICGCW   33 (33)
T ss_dssp             TTTHH---HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCc---cEEEehhHHHHHHHHhhhheecC
Confidence            45653   3334455567775 446666544


No 58 
>PF01998 DUF131:  Protein of unknown function DUF131;  InterPro: IPR002849 This archaebacterial protein family has no known function. The proteins are predicted to contain two transmembrane helices.
Probab=34.27  E-value=23  Score=23.75  Aligned_cols=25  Identities=36%  Similarity=0.802  Sum_probs=15.2

Q ss_pred             CChhHHHHH---HHHHHHHHHHHHHHHH
Q 035876           26 SPLPYLFGG---LGLMMGLITVALMILA   50 (117)
Q Consensus        26 SPvPYLFgG---LA~MLgLIAvALLILa   50 (117)
                      =|+|-.||.   ++..+.++|+.|+++.
T Consensus        32 GPIPIvFGs~~~~~~~~~ilaiil~i~~   59 (64)
T PF01998_consen   32 GPIPIVFGSSPRIAKIAMILAIILMILA   59 (64)
T ss_pred             ecccEEEcCCHHHHHHHHHHHHHHHHHH
Confidence            378888874   4555555555555544


No 59 
>PF06596 PsbX:  Photosystem II reaction centre X protein (PsbX);  InterPro: IPR009518 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  The low molecular weight transmembrane protein PsbX found in PSII is associated with the oxygen-evolving complex. Its expression is light-regulated. PsbX appears to be involved in the regulation of the amount of PSII [], and may be involved in the binding or turnover of quinone molecules at the Qb (PsbA) site [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0016020 membrane; PDB: 3ARC_x 3A0H_X 3A0B_X 3PRR_X 1S5L_x 4FBY_j 3PRQ_X 3KZI_X 3BZ2_X 3BZ1_X.
Probab=34.10  E-value=67  Score=19.90  Aligned_cols=20  Identities=25%  Similarity=0.335  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 035876           31 LFGGLGLMMGLITVALMILA   50 (117)
Q Consensus        31 LFgGLA~MLgLIAvALLILa   50 (117)
                      |+.|-++.++.|+.||+...
T Consensus        12 l~aG~~iVv~~i~~ali~VS   31 (39)
T PF06596_consen   12 LVAGAVIVVIPIAGALIFVS   31 (39)
T ss_dssp             HHHHH-HHHHHHHHHHHHHH
T ss_pred             HHhhhhhhhhhhhhheEEEe
Confidence            56677778888888887654


No 60 
>PF11143 DUF2919:  Protein of unknown function (DUF2919);  InterPro: IPR021318  This bacterial family of proteins has no known function. Some members are annotated as YfeZ however this cannot be confirmed. 
Probab=34.05  E-value=51  Score=25.02  Aligned_cols=23  Identities=43%  Similarity=0.515  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHHHhhhcccC
Q 035876           34 GLGLMMGLITVALMILACSYRKSS   57 (117)
Q Consensus        34 GLA~MLgLIAvALLILaCSy~K~s   57 (117)
                      .++..+|+.|+.++ +.|++|+..
T Consensus        57 ~lgL~~g~Pall~~-~l~~~R~~~   79 (149)
T PF11143_consen   57 YLGLAAGLPALLLM-LLSGRRHRS   79 (149)
T ss_pred             HHHHHHhHHHHHHH-HHHccCCCC
Confidence            46677899999888 888888754


No 61 
>PF06103 DUF948:  Bacterial protein of unknown function (DUF948);  InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins.
Probab=33.46  E-value=39  Score=22.53  Aligned_cols=13  Identities=15%  Similarity=0.327  Sum_probs=7.2

Q ss_pred             HHHHHHHHHHhhh
Q 035876           41 LITVALMILACSY   53 (117)
Q Consensus        41 LIAvALLILaCSy   53 (117)
                      ++|+|+++|+|.-
T Consensus         5 I~Aiaf~vLvi~l   17 (90)
T PF06103_consen    5 IAAIAFAVLVIFL   17 (90)
T ss_pred             HHHHHHHHHHHHH
Confidence            4556666665543


No 62 
>PF10873 DUF2668:  Protein of unknown function (DUF2668);  InterPro: IPR022640  Members in this family of proteins are annotated as cysteine and tyrosine-rich protein 1, however currently no function is known []. 
Probab=33.29  E-value=44  Score=26.25  Aligned_cols=28  Identities=29%  Similarity=0.476  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhcccCCCC
Q 035876           32 FGGLGLMMGLITVALMILACSYRKSSSNS   60 (117)
Q Consensus        32 FgGLA~MLgLIAvALLILaCSy~K~ss~s   60 (117)
                      .+|..++||+||. ..|..|-+-|+++.+
T Consensus        67 VfgiVfimgvva~-i~icvCmc~kn~rgs   94 (155)
T PF10873_consen   67 VFGIVFIMGVVAG-IAICVCMCMKNSRGS   94 (155)
T ss_pred             ehhhHHHHHHHHH-HHHHHhhhhhcCCCc
Confidence            4677788888774 456667777766543


No 63 
>PRK13726 conjugal transfer pilus assembly protein TraE; Provisional
Probab=33.03  E-value=83  Score=24.66  Aligned_cols=34  Identities=15%  Similarity=0.045  Sum_probs=26.0

Q ss_pred             CCChhHH---HHHHHHHHHHHHHHHHHHHhhhcccCC
Q 035876           25 NSPLPYL---FGGLGLMMGLITVALMILACSYRKSSS   58 (117)
Q Consensus        25 ~SPvPYL---FgGLA~MLgLIAvALLILaCSy~K~ss   58 (117)
                      +|-.=++   |.+|+..+.|..++.++|+|.-|+...
T Consensus         7 ~~~~~~~~~~~~~l~~l~~~~~~~~v~l~~~~~~~~~   43 (188)
T PRK13726          7 LSTSRVMAIAFIFLSVLIVLSLSVNVIQGVNNYRLQN   43 (188)
T ss_pred             ccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            3444455   888888888888999999999887653


No 64 
>PF01794 Ferric_reduct:  Ferric reductase like transmembrane component;  InterPro: IPR013130 This family includes a common region in the transmembrane proteins mammalian cytochrome b-245 heavy chain (gp91-phox), ferric reductase transmembrane component in yeast and respiratory burst oxidase from Arabidopsis thaliana. This may be a family of flavocytochromes capable of moving electrons across the plasma membrane [] that include a potential FAD binding domain. Mutations in the sequence of cytochrome b-245 heavy chain (gp91-phox) lead to the X-linked chronic granulomatous disease. The bacteriocidal ability of phagocytic cells is reduced and is characterised by the absence of a functional plasma membrane associated NADPH oxidase [].; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0016491 oxidoreductase activity, 0050660 flavin adenine dinucleotide binding, 0016021 integral to membrane
Probab=32.41  E-value=93  Score=20.64  Aligned_cols=27  Identities=19%  Similarity=0.266  Sum_probs=19.1

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHhhh
Q 035876           27 PLPYLFGGLGLMMGLITVALMILACSY   53 (117)
Q Consensus        27 PvPYLFgGLA~MLgLIAvALLILaCSy   53 (117)
                      .-||...|+.+++.++.+++.-+.+-|
T Consensus        76 ~~~~~~~G~~a~~~l~~l~~tS~~~~R  102 (125)
T PF01794_consen   76 TGPYNLTGIIALLLLLILAVTSFPWIR  102 (125)
T ss_pred             HhhHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            346667788877777777776666666


No 65 
>PRK13415 flagella biosynthesis protein FliZ; Provisional
Probab=31.46  E-value=1.6e+02  Score=24.18  Aligned_cols=19  Identities=16%  Similarity=0.408  Sum_probs=10.1

Q ss_pred             cCCCeeEEEecCCCCCceee
Q 035876           82 EMEPKIVVIMAGDDNPSYLA  101 (117)
Q Consensus        82 ~~~~~v~ViMaGd~~PtflA  101 (117)
                      .-+++++||=.|| .=++|.
T Consensus       120 eVG~k~LVvGV~d-sI~lL~  138 (219)
T PRK13415        120 KVGNRVLVVGVGE-SIQLLK  138 (219)
T ss_pred             EECCEEEEEEecC-ceeEee
Confidence            3456666666665 334443


No 66 
>PF05255 UPF0220:  Uncharacterised protein family (UPF0220);  InterPro: IPR007919 This family of proteins is functionally uncharacterised.
Probab=31.19  E-value=62  Score=25.01  Aligned_cols=27  Identities=26%  Similarity=0.464  Sum_probs=22.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhccc
Q 035876           30 YLFGGLGLMMGLITVALMILACSYRKS   56 (117)
Q Consensus        30 YLFgGLA~MLgLIAvALLILaCSy~K~   56 (117)
                      .||.|+++|.|=++-|+-||.=-|-..
T Consensus       102 ~LFigf~l~fggl~~s~~vli~~yv~~  128 (166)
T PF05255_consen  102 WLFIGFALSFGGLAGSVWVLILKYVVP  128 (166)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhcccccC
Confidence            699999999999999999998655433


No 67 
>PRK05696 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=29.88  E-value=1.8e+02  Score=21.87  Aligned_cols=23  Identities=17%  Similarity=0.234  Sum_probs=16.7

Q ss_pred             cCCCeeEEEecCCCCCceeeccc
Q 035876           82 EMEPKIVVIMAGDDNPSYLAKPV  104 (117)
Q Consensus        82 ~~~~~v~ViMaGd~~PtflA~P~  104 (117)
                      +.++.++|=++++..-+||-.=+
T Consensus        71 ~l~~~fvvNl~~~~~~ryLkv~i   93 (170)
T PRK05696         71 PMPRPFVFNVPGNGRDRLVQIKV   93 (170)
T ss_pred             ecCCCEEEEecCCCCceEEEEEE
Confidence            44567888888888888986433


No 68 
>TIGR03054 photo_alph_chp1 putative photosynthetic complex assembly protein. In twenty or so anoxygenic photosynthetic alpha-Proteobacteria known so far, a gene for a member of this protein family is present and is found in the vicinity of puhA, which encodes a component of the photosynthetic reaction center, and other genes associated with photosynthesis. This protein family is suggested, consequently, as a probable assembly factor for the photosynthetic reaction center, but its seems its actual function has not yet been demonstrated.
Probab=29.31  E-value=1.8e+02  Score=22.08  Aligned_cols=26  Identities=19%  Similarity=0.286  Sum_probs=21.8

Q ss_pred             HHHHHHHHHHHHHHHHHhhhcccCCC
Q 035876           34 GLGLMMGLITVALMILACSYRKSSSN   59 (117)
Q Consensus        34 GLA~MLgLIAvALLILaCSy~K~ss~   59 (117)
                      -|-+|++|+.++|.+.+.+++.....
T Consensus         3 ~l~a~~~Lvl~~~~lva~a~~Tg~~~   28 (135)
T TIGR03054         3 LLIAMLGLVLLTFALVAFAVLTGVGH   28 (135)
T ss_pred             HHHHHHHHHHHHHHHhheeeecCCCc
Confidence            46789999999999999999885443


No 69 
>PF01034 Syndecan:  Syndecan domain;  InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ]. Structurally, these proteins consist of four separate domains:   A signal sequence; An extracellular domain (ectodomain) of variable length whose sequence is not evolutionary conserved in the various forms of syndecans. The ectodomain contains the sites of attachment of the heparan sulphate glycosaminoglycan side chains;  A transmembrane region;  A highly conserved cytoplasmic domain of about 30 to 35 residues, which could interact with cytoskeletal proteins.    The proteins known to belong to this family are:    Syndecan 1.  Syndecan 2 or fibroglycan.  Syndecan 3 or neuroglycan or N-syndecan.  Syndecan 4 or amphiglycan or ryudocan.  Drosophila syndecan.   Caenorhabditis elegans probable syndecan (F57C7.3).    Syndecan-4, a transmembrane heparan sulphate proteoglycan, is a coreceptor with integrins in cell adhesion. It has been suggested to form a ternary signalling complex with protein kinase Calpha and phosphatidylinositol 4,5-bisphosphate (PIP2). Structural studies have demonstrated that the cytoplasmic domain undergoes a conformational transition and forms a symmetric dimer in the presence of phospholipid activator PIP2, and whose overall structure in solution exhibits a twisted clamp shape having a cavity in the centre of dimeric interface. In addition, it has been observed that the syndecan-4 variable domain interacts, strongly, not only with fatty acyl groups but also the anionic head group of PIP2. These findings indicate that PIP2 promotes oligomerisation of the syndecan-4 cytoplasmic domain for transmembrane signalling and cell-matrix adhesion [, ].; GO: 0008092 cytoskeletal protein binding, 0016020 membrane; PDB: 1EJQ_B 1EJP_B 1YBO_C 1OBY_Q.
Probab=28.94  E-value=22  Score=24.14  Aligned_cols=12  Identities=8%  Similarity=0.246  Sum_probs=0.0

Q ss_pred             HHHHHHHHHhhh
Q 035876           42 ITVALMILACSY   53 (117)
Q Consensus        42 IAvALLILaCSy   53 (117)
                      .|+.|++|.+.|
T Consensus        24 ~ailLIlf~iyR   35 (64)
T PF01034_consen   24 FAILLILFLIYR   35 (64)
T ss_dssp             ------------
T ss_pred             HHHHHHHHHHHH
Confidence            344444444444


No 70 
>PF13903 Claudin_2:  PMP-22/EMP/MP20/Claudin tight junction
Probab=28.86  E-value=91  Score=21.67  Aligned_cols=25  Identities=24%  Similarity=0.373  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcc
Q 035876           31 LFGGLGLMMGLITVALMILACSYRK   55 (117)
Q Consensus        31 LFgGLA~MLgLIAvALLILaCSy~K   55 (117)
                      .|..+++++.++|+-+.++.|-+++
T Consensus        73 ~~~~l~~~~~~~a~~~~~~~~~~~~   97 (172)
T PF13903_consen   73 AFLILGLLLLLFAFVFALIGFCKRS   97 (172)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhccc
Confidence            3555555555666555555554433


No 71 
>cd02435 CCC1 CCC1. CCC1: This domain is present in the CCC1, an iron and manganese transporter of Saccharomyces cerevisiae. CCC1 is a transmembrane protein that is located in the vacuole and transfers the iron and manganese ions from the cytosol to the vacuole. This domain may be unique to certain fungi and plants.
Probab=28.33  E-value=93  Score=25.11  Aligned_cols=30  Identities=30%  Similarity=0.370  Sum_probs=17.0

Q ss_pred             hhHHHH-----HHHHHHHHHHHHHHHHHhhhcccC
Q 035876           28 LPYLFG-----GLGLMMGLITVALMILACSYRKSS   57 (117)
Q Consensus        28 vPYLFg-----GLA~MLgLIAvALLILaCSy~K~s   57 (117)
                      +||+|.     ++...+++-.++|.++-+.+-+.+
T Consensus       173 lPy~~~~~~~~a~~~si~l~~~aL~ilG~~~s~~s  207 (241)
T cd02435         173 LPYFFVSTVGEALLLSVIVTLVALFVFGYVKTWFT  207 (241)
T ss_pred             HHHHHccchhHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            478773     344555555566666655554444


No 72 
>PF13807 GNVR:  G-rich domain on putative tyrosine kinase
Probab=28.31  E-value=1.2e+02  Score=19.99  Aligned_cols=20  Identities=45%  Similarity=0.542  Sum_probs=14.9

Q ss_pred             CCChhHHHHHHHHHHHHHHH
Q 035876           25 NSPLPYLFGGLGLMMGLITV   44 (117)
Q Consensus        25 ~SPvPYLFgGLA~MLgLIAv   44 (117)
                      -+|-.-++..+++++||+.=
T Consensus        54 ~~P~~~lil~l~~~~Gl~lg   73 (82)
T PF13807_consen   54 VSPKRALILALGLFLGLILG   73 (82)
T ss_pred             CCCcHHHHHHHHHHHHHHHH
Confidence            35677788888888888543


No 73 
>PF15470 DUF4637:  Domain of unknown function (DUF4637)
Probab=28.17  E-value=15  Score=29.05  Aligned_cols=17  Identities=47%  Similarity=0.991  Sum_probs=12.5

Q ss_pred             CCccCCCCChhHHHHHHH
Q 035876           19 GGLGHWNSPLPYLFGGLG   36 (117)
Q Consensus        19 ~~~~~W~SPvPYLFgGLA   36 (117)
                      +|||-|-||.- |++||+
T Consensus        90 sgFWgwlsPfa-Ll~gl~  106 (173)
T PF15470_consen   90 SGFWGWLSPFA-LLGGLA  106 (173)
T ss_pred             CCchhhhcHHH-Hhcccc
Confidence            79999999853 455554


No 74 
>PF13798 PCYCGC:  Protein of unknown function with PCYCGC motif
Probab=28.11  E-value=40  Score=26.45  Aligned_cols=22  Identities=23%  Similarity=0.593  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHhhhcccCCC
Q 035876           38 MMGLITVALMILACSYRKSSSN   59 (117)
Q Consensus        38 MLgLIAvALLILaCSy~K~ss~   59 (117)
                      |+.++.++||+-+||-.+...+
T Consensus         1 ~~~~l~~~~llagCss~~~~~~   22 (158)
T PF13798_consen    1 VIPLLSLSLLLAGCSSDEDSES   22 (158)
T ss_pred             ChHHHHHHHHHHHcCCCCcccc
Confidence            4566777788888998766544


No 75 
>PF15240 Pro-rich:  Proline-rich
Probab=27.98  E-value=41  Score=26.83  Aligned_cols=13  Identities=38%  Similarity=0.705  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHH
Q 035876           38 MMGLITVALMILA   50 (117)
Q Consensus        38 MLgLIAvALLILa   50 (117)
                      +|.|..+|||.|.
T Consensus         2 LlVLLSvALLALS   14 (179)
T PF15240_consen    2 LLVLLSVALLALS   14 (179)
T ss_pred             hhHHHHHHHHHhh
Confidence            3567889999885


No 76 
>PTZ00260 dolichyl-phosphate beta-glucosyltransferase; Provisional
Probab=27.97  E-value=1.4e+02  Score=24.52  Aligned_cols=19  Identities=5%  Similarity=0.291  Sum_probs=13.2

Q ss_pred             cCCCeeEEEecCCCCCcee
Q 035876           82 EMEPKIVVIMAGDDNPSYL  100 (117)
Q Consensus        82 ~~~~~v~ViMaGd~~Ptfl  100 (117)
                      +..++|-||||--+.-..|
T Consensus        67 ~~~~~isVVIP~yNe~~~i   85 (333)
T PTZ00260         67 DSDVDLSIVIPAYNEEDRL   85 (333)
T ss_pred             CCCeEEEEEEeeCCCHHHH
Confidence            4577899999866654444


No 77 
>COG4736 CcoQ Cbb3-type cytochrome oxidase, subunit 3 [Posttranslational modification, protein turnover, chaperones]
Probab=27.68  E-value=1.1e+02  Score=20.39  Aligned_cols=27  Identities=22%  Similarity=0.365  Sum_probs=21.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcccC
Q 035876           31 LFGGLGLMMGLITVALMILACSYRKSS   57 (117)
Q Consensus        31 LFgGLA~MLgLIAvALLILaCSy~K~s   57 (117)
                      .+-|.+--.|+|++.|..++|-|+-.+
T Consensus         5 ~~~~~a~a~~t~~~~l~fiavi~~ayr   31 (60)
T COG4736           5 MMRGFADAWGTIAFTLFFIAVIYFAYR   31 (60)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            466778888999999998888776544


No 78 
>PF04906 Tweety:  Tweety;  InterPro: IPR006990 None of the members of the tweety (tty) family have been functionally characterised. However, they are considered to be transmembrane proteins with five potential membrane-spanning regions. A number of potential functions have been suggested on the basis of homology to the yeast FTR1 and FTH1 iron transporter proteins and the mammalian neurotensin receptors 1 and 2 in that they have a similar hydrophobicity profiles although there is no detectable sequence homology to the tweety-related proteins. It has been proposed that the tweety-related proteins could be involved in transport of iron or other divalent cations or alternatively that they may be membrane-bound receptors [].
Probab=27.32  E-value=1.1e+02  Score=26.39  Aligned_cols=12  Identities=33%  Similarity=0.656  Sum_probs=6.3

Q ss_pred             HHHHHHHHHHhh
Q 035876           41 LITVALMILACS   52 (117)
Q Consensus        41 LIAvALLILaCS   52 (117)
                      |.|++|.++.|+
T Consensus       371 l~al~f~~~v~~  382 (406)
T PF04906_consen  371 LAALLFSILVCV  382 (406)
T ss_pred             HHHHHHHHHHHH
Confidence            344555555555


No 79 
>PF10883 DUF2681:  Protein of unknown function (DUF2681);  InterPro: IPR020274 This entry contains membrane proteins with no known function.
Probab=27.14  E-value=70  Score=22.68  Aligned_cols=20  Identities=30%  Similarity=0.340  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHhhhcccC
Q 035876           38 MMGLITVALMILACSYRKSS   57 (117)
Q Consensus        38 MLgLIAvALLILaCSy~K~s   57 (117)
                      .++++++.++|++.-+||..
T Consensus         7 v~~~~~v~~~i~~y~~~k~~   26 (87)
T PF10883_consen    7 VGGVGAVVALILAYLWWKVK   26 (87)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            44677777778787778764


No 80 
>PRK10081 entericidin B membrane lipoprotein; Provisional
Probab=26.67  E-value=80  Score=20.35  Aligned_cols=21  Identities=10%  Similarity=0.498  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHHhhhcc
Q 035876           35 LGLMMGLITVALMILACSYRK   55 (117)
Q Consensus        35 LA~MLgLIAvALLILaCSy~K   55 (117)
                      +++|+.+++.++.+-+|---+
T Consensus         6 i~~i~~~l~~~~~l~~CnTv~   26 (48)
T PRK10081          6 IAAIFSVLVLSTVLTACNTTR   26 (48)
T ss_pred             HHHHHHHHHHHHHHhhhhhhh
Confidence            567777888888888895443


No 81 
>PF04976 DmsC:  DMSO reductase anchor subunit (DmsC);  InterPro: IPR007059 The terminal electron transfer enzyme dimethyl sulphoxide reductase of Escherichia coli is a heterotrimeric enzyme composed of a membrane extrinsic catalytic dimer (DmsAB) and a membrane intrinsic polytopic anchor subunit (DmsC) []. This family represents DmsC.; GO: 0019645 anaerobic electron transport chain, 0016021 integral to membrane
Probab=26.60  E-value=93  Score=25.11  Aligned_cols=28  Identities=36%  Similarity=0.560  Sum_probs=20.5

Q ss_pred             CCccCCCCChhH-HHHHHHHHHHHHHHHH
Q 035876           19 GGLGHWNSPLPY-LFGGLGLMMGLITVAL   46 (117)
Q Consensus        19 ~~~~~W~SPvPY-LFgGLA~MLgLIAvAL   46 (117)
                      -.+..||+|..+ .|.+-++++|....++
T Consensus       140 ~~vp~W~~~~T~~~f~~tal~~G~~l~~~  168 (276)
T PF04976_consen  140 TTVPAWNSPWTPISFLGTALLLGAALAAL  168 (276)
T ss_pred             cchhcccCchHHHHHHHHHHHHHHHHHHH
Confidence            356789998655 7888888888865543


No 82 
>PHA00736 hypothetical protein
Probab=26.50  E-value=59  Score=22.76  Aligned_cols=14  Identities=43%  Similarity=0.788  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHH
Q 035876           31 LFGGLGLMMGLITV   44 (117)
Q Consensus        31 LFgGLA~MLgLIAv   44 (117)
                      ||-|+++++||||=
T Consensus        57 lfwgi~vifgliag   70 (79)
T PHA00736         57 LFWGITVIFGLIAG   70 (79)
T ss_pred             HHHHHHHHHHHHHH
Confidence            78899999999974


No 83 
>PRK15065 PTS system mannose-specific transporter subunit IIC; Provisional
Probab=26.26  E-value=1e+02  Score=25.48  Aligned_cols=27  Identities=15%  Similarity=0.316  Sum_probs=19.7

Q ss_pred             ChhHHHHHHHHHHHH----HHHHHHHHHhhh
Q 035876           27 PLPYLFGGLGLMMGL----ITVALMILACSY   53 (117)
Q Consensus        27 PvPYLFgGLA~MLgL----IAvALLILaCSy   53 (117)
                      =.||+|.|+.+.--|    +++|++-.++.+
T Consensus       206 ~~~ff~lGFvl~ayl~l~~l~iAiig~~iA~  236 (262)
T PRK15065        206 LMPFFYLGFVLAAFTNLNLIALGVIGVVLAL  236 (262)
T ss_pred             hHHHHHHHHHHHHHhCCcHHHHHHHHHHHHH
Confidence            469999999877544    777776666655


No 84 
>PF06697 DUF1191:  Protein of unknown function (DUF1191);  InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function.
Probab=25.59  E-value=26  Score=29.54  Aligned_cols=59  Identities=15%  Similarity=0.207  Sum_probs=30.3

Q ss_pred             CCccCCCCChhHHHHH-HHHHHHHHHHHHHHHHhhhcccCCCCCCCCccccccCCCCccccccccCCCeeEEEecCCCC
Q 035876           19 GGLGHWNSPLPYLFGG-LGLMMGLITVALMILACSYRKSSSNSATDHADEDKSAGHDKQVEMQTEMEPKIVVIMAGDDN   96 (117)
Q Consensus        19 ~~~~~W~SPvPYLFgG-LA~MLgLIAvALLILaCSy~K~ss~s~~~~~d~ek~~~~~~~~~~~~~~~~~v~ViMaGd~~   96 (117)
                      +..|.|.     +.+| ..-.++|+-++++++.|.++|....-              .+-|...+.+|.+=+.|-|+.+
T Consensus       208 ~~~~~W~-----iv~g~~~G~~~L~ll~~lv~~~vr~krk~k~--------------~eMEr~A~~gE~L~~~~VG~sr  267 (278)
T PF06697_consen  208 KRSWWWK-----IVVGVVGGVVLLGLLSLLVAMLVRYKRKKKI--------------EEMERRAEEGEALQMSWVGGSR  267 (278)
T ss_pred             CcceeEE-----EEEEehHHHHHHHHHHHHHHhhhhhhHHHHH--------------HHHHHhhccCceeeeEEEcccc
Confidence            5667777     3333 22222345555667777776653210              0112233455666677777764


No 85 
>PF04133 Vps55:  Vacuolar protein sorting 55 ;  InterPro: IPR007262 Vps55 is involved in the secretion of the Golgi form of the soluble vacuolar carboxypeptidase Y, but not the trafficking of the membrane-bound vacuolar alkaline phosphatase. Both Vps55 and obesity receptor gene-related protein are important for functioning membrane trafficking to the vacuole/lysosome of eukaryotic cells [].
Probab=25.55  E-value=75  Score=23.39  Aligned_cols=18  Identities=33%  Similarity=0.508  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHhhhccc
Q 035876           39 MGLITVALMILACSYRKS   56 (117)
Q Consensus        39 LgLIAvALLILaCSy~K~   56 (117)
                      ++-|++-|+||+|.-+|+
T Consensus         7 ~~aiG~lL~IL~CAL~~n   24 (120)
T PF04133_consen    7 FLAIGFLLVILSCALYKN   24 (120)
T ss_pred             HHHHHHHHHHHHHHHhcc
Confidence            455788899999988775


No 86 
>PF15144 DUF4576:  Domain of unknown function (DUF4576)
Probab=25.34  E-value=89  Score=22.45  Aligned_cols=11  Identities=27%  Similarity=0.812  Sum_probs=6.1

Q ss_pred             HHHHHHHHHhh
Q 035876           42 ITVALMILACS   52 (117)
Q Consensus        42 IAvALLILaCS   52 (117)
                      +++-.|||-|-
T Consensus        12 lGLlvLIltC~   22 (88)
T PF15144_consen   12 LGLLVLILTCH   22 (88)
T ss_pred             HHHHHHHhhhc
Confidence            34445666674


No 87 
>PF14851 FAM176:  FAM176 family
Probab=25.28  E-value=2.1e+02  Score=22.13  Aligned_cols=23  Identities=22%  Similarity=0.446  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhh
Q 035876           30 YLFGGLGLMMGLITVALMILACSY   53 (117)
Q Consensus        30 YLFgGLA~MLgLIAvALLILaCSy   53 (117)
                      |+..|.++=|. +++.||+.-||.
T Consensus        25 YFv~gVC~GLl-LtLcllV~risc   47 (153)
T PF14851_consen   25 YFVSGVCAGLL-LTLCLLVIRISC   47 (153)
T ss_pred             HHHHHHHHHHH-HHHHHHHhhhee
Confidence            44444443332 566666777776


No 88 
>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain. PolD2 (DNA polymerase delta, subunit 2) is an auxiliary subunit of the eukaryotic DNA polymerase delta (PolD) complex thought to play a regulatory role and to serve as a scaffold for PolD assembly by interacting simultaneously with all of the other three subunits.  PolD2 is catalytically inactive and lacks the active site residues required for phosphoesterase activity in other members of this superfamily.  PolD2 is also involved in the recruitment of several proteins regulating DNA metabolism, including p21, PDIP1, PDIP38, PDIP46, and WRN. Human PolD consists of four subunits: p125 (PolD1), p50 (PolD2), p66(PolD3), and p12(PolD4).  PolD is one of three major replicases in eukaryotes. PolD also plays an essential role in translesion DNA synthesis, homologous recombination, and DNA repair.  Within the PolD complex, PolD2 tightly associates with PolD3.  PolD2 belongs to the metallophosphatase (MPP) superfamily
Probab=25.16  E-value=44  Score=27.33  Aligned_cols=18  Identities=28%  Similarity=0.475  Sum_probs=15.2

Q ss_pred             EEEecCCCCCceeecccc
Q 035876           88 VVIMAGDDNPSYLAKPVS  105 (117)
Q Consensus        88 ~ViMaGd~~PtflA~P~~  105 (117)
                      ++||||+.-|+=.+-|-+
T Consensus        97 V~imPG~~Dp~~~~lPQq  114 (257)
T cd07387          97 VDLMPGEFDPANHSLPQQ  114 (257)
T ss_pred             EEECCCCCCcccccCCCC
Confidence            579999999999997743


No 89 
>cd01059 CCC1_like CCC1-related family of proteins. CCC1_like: This protein family includes the proteins related to CCC1, a yeast vacuole transmembrane protein responsible for the iron and manganese transport from the cytosol into vacuole. It also includes the proteins similar to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation.
Probab=25.14  E-value=1.4e+02  Score=21.82  Aligned_cols=30  Identities=33%  Similarity=0.548  Sum_probs=15.7

Q ss_pred             hhHHHHH---HHHHHHH---HHHHHHHHHhhhcccC
Q 035876           28 LPYLFGG---LGLMMGL---ITVALMILACSYRKSS   57 (117)
Q Consensus        28 vPYLFgG---LA~MLgL---IAvALLILaCSy~K~s   57 (117)
                      .||+|..   +++.+.+   ..++|.++.+...|.+
T Consensus        79 lp~~~~~~~~~a~~~si~~~~~~~l~~~g~~~~~~~  114 (143)
T cd01059          79 LPYLLLPAGSLALAVSVALVVALALFLLGAFVAKLG  114 (143)
T ss_pred             HHHHHhcchhHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            4787763   3444433   3455555555555544


No 90 
>PF10717 ODV-E18:  Occlusion-derived virus envelope protein ODV-E18;  InterPro: IPR019655  Baculovirus occlusion-derived virus (ODV) derives its envelope from an intranuclear membrane source. Occlusion-derived viral envelope proteins that are detected in viral-induced intranuclear microvesicles, but not detected in the plasma membrane, cytoplasmic membranes, or the nuclear envelope. This entry represents ODV-E18 protein which is encoded by baculovirus late genes with transcription initiating from a TAAG motif. ODV-E18 exists as a dimer in the ODV envelope, which contains a hydrophobic domain that putatively acts as a target or retention signal for intranuclear microvesicles []. ; GO: 0019031 viral envelope
Probab=24.98  E-value=1.2e+02  Score=21.77  Aligned_cols=23  Identities=39%  Similarity=0.404  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHHHhhhcccCCCC
Q 035876           38 MMGLITVALMILACSYRKSSSNS   60 (117)
Q Consensus        38 MLgLIAvALLILaCSy~K~ss~s   60 (117)
                      |-.||++-.+||.--...+||++
T Consensus        28 MtILivLVIIiLlImlfqsSS~~   50 (85)
T PF10717_consen   28 MTILIVLVIIILLIMLFQSSSNG   50 (85)
T ss_pred             HHHHHHHHHHHHHHHHHhccCCC
Confidence            33444444333333334555443


No 91 
>COG0813 DeoD Purine-nucleoside phosphorylase [Nucleotide transport and metabolism]
Probab=24.94  E-value=24  Score=29.36  Aligned_cols=16  Identities=44%  Similarity=0.829  Sum_probs=12.9

Q ss_pred             EEEecCCC-CCceeecc
Q 035876           88 VVIMAGDD-NPSYLAKP  103 (117)
Q Consensus        88 ~ViMaGd~-~PtflA~P  103 (117)
                      +|+||||- +++|+|.-
T Consensus        16 ~VLmPGDPlRAK~iAet   32 (236)
T COG0813          16 VVLMPGDPLRAKYIAET   32 (236)
T ss_pred             eeecCCCCchHHHHHHH
Confidence            58999998 58888843


No 92 
>PF06365 CD34_antigen:  CD34/Podocalyxin family;  InterPro: IPR013836 This family consists of several mammalian CD34 antigen proteins. The CD34 antigen is a human leukocyte membrane protein expressed specifically by lymphohematopoietic progenitor cells. CD34 is a phosphoprotein. Activation of protein kinase C (PKC) has been found to enhance CD34 phosphorylation [, ]. This family contains several eukaryotic podocalyxin proteins. Podocalyxin is a major membrane protein of the glomerular epithelium and is thought to be involved in maintenance of the architecture of the foot processes and filtration slits characteristic of this unique epithelium by virtue of its high negative charge. Podocalyxin functions as an anti-adhesin that maintains an open filtration pathway between neighbouring foot processes in the glomerular epithelium by charge repulsion [].
Probab=24.79  E-value=67  Score=25.88  Aligned_cols=18  Identities=17%  Similarity=-0.075  Sum_probs=11.9

Q ss_pred             HHHHHHHHH--HHHHHHHHH
Q 035876           31 LFGGLGLMM--GLITVALMI   48 (117)
Q Consensus        31 LFgGLA~ML--gLIAvALLI   48 (117)
                      +|.+|..+-  -|||++++.
T Consensus       101 ~lI~lv~~g~~lLla~~~~~  120 (202)
T PF06365_consen  101 TLIALVTSGSFLLLAILLGA  120 (202)
T ss_pred             EEEehHHhhHHHHHHHHHHH
Confidence            899999888  444444433


No 93 
>PF07589 VPEP:  PEP-CTERM motif;  InterPro: IPR013424  This entry describes a 25-residue region including an invariant Pro-Glu-Pro (PEP) motif, a thirteen residue strongly hydrophobic sequence likely to span the membrane, and a five-residue strongly basic motif that often contains four Arg residues. In most cases, this motif is found within nine residues of the C-terminal end of the protein. Proteins containing this motif typically have signal sequences at the N terminus [].
Probab=24.75  E-value=96  Score=17.00  Aligned_cols=11  Identities=36%  Similarity=0.483  Sum_probs=4.6

Q ss_pred             HHHHHHHHHHh
Q 035876           41 LITVALMILAC   51 (117)
Q Consensus        41 LIAvALLILaC   51 (117)
                      |+.+.|+.++.
T Consensus        10 l~~~gl~~l~~   20 (25)
T PF07589_consen   10 LLGLGLLGLAF   20 (25)
T ss_pred             HHHHHHHHHHH
Confidence            33344444444


No 94 
>PF03381 CDC50:  LEM3 (ligand-effect modulator 3) family / CDC50 family;  InterPro: IPR005045 Members of this family have no known function. They have predicted transmembrane helices.; GO: 0016020 membrane
Probab=24.65  E-value=1.5e+02  Score=24.19  Aligned_cols=33  Identities=12%  Similarity=0.088  Sum_probs=24.6

Q ss_pred             CCCChhHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 035876           24 WNSPLPYLFGGLGLMMGLITVALMILACSYRKS   56 (117)
Q Consensus        24 W~SPvPYLFgGLA~MLgLIAvALLILaCSy~K~   56 (117)
                      .+--..++|..+++...++++.|+++-+.+-|.
T Consensus       241 kn~~Lgi~ylvvg~i~~v~~i~~~~~~~~~~r~  273 (278)
T PF03381_consen  241 KNYFLGIAYLVVGGICLVLAIIFLIIHYFKPRK  273 (278)
T ss_pred             cccHHHHHHHHHHHHHHHHHHHHHHHHHhCCCC
Confidence            455677888888888888888888887765443


No 95 
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism]
Probab=24.06  E-value=1.3e+02  Score=28.61  Aligned_cols=27  Identities=22%  Similarity=0.481  Sum_probs=22.4

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHhhhcc
Q 035876           29 PYLFGGLGLMMGLITVALMILACSYRK   55 (117)
Q Consensus        29 PYLFgGLA~MLgLIAvALLILaCSy~K   55 (117)
                      =|.|.||.+++.++++.++|+..--||
T Consensus       673 r~~y~gl~~~~~~~~~i~~i~~~~v~r  699 (735)
T KOG3626|consen  673 RYRYLGLHIILKVIALILLIIDLYVWR  699 (735)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            478999999999999988888755555


No 96 
>PRK12785 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=24.05  E-value=97  Score=23.43  Aligned_cols=21  Identities=29%  Similarity=0.517  Sum_probs=13.6

Q ss_pred             cCCCeeEEEecCCCC--Cceeecc
Q 035876           82 EMEPKIVVIMAGDDN--PSYLAKP  103 (117)
Q Consensus        82 ~~~~~v~ViMaGd~~--PtflA~P  103 (117)
                      +.+ .++|=+++++.  ..||-.=
T Consensus        70 ~l~-~fvVNL~~~~~~~~ryLkv~   92 (166)
T PRK12785         70 DVP-DMLVNLAGDPGERVQYLKLK   92 (166)
T ss_pred             EcC-CEEEECCCCCCCcceEEEEE
Confidence            444 48898987653  5887533


No 97 
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily. Members of this protein family belong to the family of polysaccharide chain length determinant proteins (pfam02706). All are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria, and are found near the epsH homolog that is the putative exosortase gene.
Probab=23.96  E-value=1.3e+02  Score=25.53  Aligned_cols=31  Identities=23%  Similarity=0.107  Sum_probs=24.2

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHhhhcccC
Q 035876           27 PLPYLFGGLGLMMGLITVALMILACSYRKSS   57 (117)
Q Consensus        27 PvPYLFgGLA~MLgLIAvALLILaCSy~K~s   57 (117)
                      |-+-++.++++++|++.-..+++.+.++..+
T Consensus       411 P~~~~~l~~g~~~Gl~lg~~~~~l~e~ld~~  441 (498)
T TIGR03007       411 PNRPLLMLAGLLGGLGAGIGLAFLLSQLRPT  441 (498)
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHHHHHHhcCc
Confidence            6667888889999998777778888776543


No 98 
>PF10826 DUF2551:  Protein of unknown function (DUF2551) ;  InterPro: IPR020501 This entry contains proteins with no known function.
Probab=23.92  E-value=60  Score=23.06  Aligned_cols=18  Identities=44%  Similarity=0.630  Sum_probs=15.6

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 035876           33 GGLGLMMGLITVALMILA   50 (117)
Q Consensus        33 gGLA~MLgLIAvALLILa   50 (117)
                      =|.|+|+|+|+-=|=||-
T Consensus        44 ~~VasMVG~i~SrlGIL~   61 (83)
T PF10826_consen   44 RGVASMVGLIHSRLGILS   61 (83)
T ss_pred             HHHHHHHHHHHHhhhhee
Confidence            488999999998888885


No 99 
>PF10577 UPF0560:  Uncharacterised protein family UPF0560;  InterPro: IPR018890  This family of proteins has no known function. 
Probab=23.57  E-value=1e+02  Score=29.80  Aligned_cols=24  Identities=25%  Similarity=0.430  Sum_probs=13.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHhh
Q 035876           29 PYLFGGLGLMMGLITVALMILACS   52 (117)
Q Consensus        29 PYLFgGLA~MLgLIAvALLILaCS   52 (117)
                      =||.+-|+.|+.|+-+-|-+|.|.
T Consensus       273 ~fLl~ILG~~~livl~lL~vLl~y  296 (807)
T PF10577_consen  273 VFLLAILGGTALIVLILLCVLLCY  296 (807)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHh
Confidence            356666666666555555555553


No 100
>PRK13792 lysozyme inhibitor; Provisional
Probab=23.12  E-value=44  Score=25.05  Aligned_cols=22  Identities=23%  Similarity=0.440  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHHHHHhhhcccC
Q 035876           36 GLMMGLITVALMILACSYRKSS   57 (117)
Q Consensus        36 A~MLgLIAvALLILaCSy~K~s   57 (117)
                      ++++.|+++++|+-+||.-...
T Consensus         4 ~l~~ll~~~~~lLsaCs~~~~~   25 (127)
T PRK13792          4 ALWLLLAAVPVVLVACGGSDDD   25 (127)
T ss_pred             HHHHHHHHHHhheecccCCCCC
Confidence            3667788899999999986554


No 101
>CHL00066 psbH photosystem II protein H
Probab=22.72  E-value=1.2e+02  Score=21.20  Aligned_cols=21  Identities=33%  Similarity=0.534  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHHHHHHhhhcc
Q 035876           35 LGLMMGLITVALMILACSYRK   55 (117)
Q Consensus        35 LA~MLgLIAvALLILaCSy~K   55 (117)
                      .++.|+|+|+.|+|+.=-|..
T Consensus        43 Mgv~m~lf~vfl~iiLeiyNs   63 (73)
T CHL00066         43 MGVAMALFAVFLSIILEIYNS   63 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHhCc
Confidence            567788899999888765543


No 102
>PF11353 DUF3153:  Protein of unknown function (DUF3153);  InterPro: IPR021499  This family of proteins with unknown function appear to be restricted to Cyanobacteria. Some members are annotated as membrane proteins however this cannot be confirmed. 
Probab=22.70  E-value=1e+02  Score=23.80  Aligned_cols=7  Identities=14%  Similarity=-0.202  Sum_probs=4.4

Q ss_pred             CCccCCC
Q 035876           19 GGLGHWN   25 (117)
Q Consensus        19 ~~~~~W~   25 (117)
                      ..+|.|+
T Consensus       177 ~~~w~pn  183 (209)
T PF11353_consen  177 ASFWVPN  183 (209)
T ss_pred             EEEEecc
Confidence            3457777


No 103
>PF06814 Lung_7-TM_R:  Lung seven transmembrane receptor;  InterPro: IPR009637 This family represents a conserved region with eukaryotic lung seven transmembrane receptors and related proteins.; GO: 0016021 integral to membrane
Probab=22.45  E-value=1.4e+02  Score=23.82  Aligned_cols=38  Identities=26%  Similarity=0.481  Sum_probs=31.9

Q ss_pred             CCccCCCCChhHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 035876           19 GGLGHWNSPLPYLFGGLGLMMGLITVALMILACSYRKS   56 (117)
Q Consensus        19 ~~~~~W~SPvPYLFgGLA~MLgLIAvALLILaCSy~K~   56 (117)
                      |-++.=+-|.|.+++.++++-++.++.-+.+.+.|||.
T Consensus        38 gyL~a~~~pl~~~y~~~~i~y~~~~~~W~~~~~~~~~~   75 (295)
T PF06814_consen   38 GYLPAGEYPLPPFYGVMSIVYAVLLIIWLFLCFKNRKS   75 (295)
T ss_pred             CCCChhhcccHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            45577778999999999999999888888888888875


No 104
>PF11153 DUF2931:  Protein of unknown function (DUF2931);  InterPro: IPR021326  Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function. 
Probab=22.38  E-value=72  Score=24.57  Aligned_cols=19  Identities=21%  Similarity=0.413  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHhhhcccCC
Q 035876           40 GLITVALMILACSYRKSSS   58 (117)
Q Consensus        40 gLIAvALLILaCSy~K~ss   58 (117)
                      .+|++.|++.+|+..+...
T Consensus         5 ~~l~l~lll~~C~~~~~~~   23 (216)
T PF11153_consen    5 LLLLLLLLLTGCSTNPNEP   23 (216)
T ss_pred             HHHHHHHHHHhhcCCCccC
Confidence            3455889999999887653


No 105
>TIGR01167 LPXTG_anchor LPXTG-motif cell wall anchor domain. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region.
Probab=21.96  E-value=1.4e+02  Score=16.29  Aligned_cols=6  Identities=50%  Similarity=0.678  Sum_probs=2.9

Q ss_pred             HHHHHH
Q 035876           30 YLFGGL   35 (117)
Q Consensus        30 YLFgGL   35 (117)
                      +.+.|+
T Consensus        13 ~~~~G~   18 (34)
T TIGR01167        13 LLLLGL   18 (34)
T ss_pred             HHHHHH
Confidence            444454


No 106
>PLN00085 photosystem II reaction center protein M (PsbM); Provisional
Probab=21.73  E-value=77  Score=24.54  Aligned_cols=13  Identities=38%  Similarity=0.828  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHHH
Q 035876           38 MMGLITVALMILA   50 (117)
Q Consensus        38 MLgLIAvALLILa   50 (117)
                      .||+||.+|.||.
T Consensus        82 iLgfIAtaLFIlI   94 (149)
T PLN00085         82 ILGVIATALFIII   94 (149)
T ss_pred             HHHHHHHHHHHHH
Confidence            5889999988877


No 107
>COG4885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=21.64  E-value=78  Score=27.29  Aligned_cols=23  Identities=35%  Similarity=0.504  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHHHhhhccc
Q 035876           34 GLGLMMGLITVALMILACSYRKS   56 (117)
Q Consensus        34 GLA~MLgLIAvALLILaCSy~K~   56 (117)
                      |+...++|||+++..||--||++
T Consensus       289 GF~~~~aL~Av~~~~~a~~rRrs  311 (312)
T COG4885         289 GFEVVFALMAVAGVALARKRRRS  311 (312)
T ss_pred             CcHHHHHHHHHHHHHHHHHHhhc
Confidence            67788899999888887766654


No 108
>TIGR03363 VI_chp_8 type VI secretion-associated protein, ImpA family. This protein family is one of two related families in type VI secretion systems that contain an ImpA-related N-terminal domain (pfam06812).
Probab=21.63  E-value=45  Score=27.96  Aligned_cols=9  Identities=56%  Similarity=1.198  Sum_probs=7.4

Q ss_pred             CCChhHHHH
Q 035876           25 NSPLPYLFG   33 (117)
Q Consensus        25 ~SPvPYLFg   33 (117)
                      |||+|||.=
T Consensus       313 hSPvp~Ll~  321 (353)
T TIGR03363       313 HSPVPYLIE  321 (353)
T ss_pred             CCcHHHHHH
Confidence            799999863


No 109
>PF01940 DUF92:  Integral membrane protein DUF92;  InterPro: IPR002794 Many members of this family have no known function and are predicted to be integral membrane proteins.; GO: 0016021 integral to membrane
Probab=21.43  E-value=92  Score=25.18  Aligned_cols=31  Identities=19%  Similarity=0.235  Sum_probs=24.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHhhhcccCCC
Q 035876           29 PYLFGGLGLMMGLITVALMILACSYRKSSSN   59 (117)
Q Consensus        29 PYLFgGLA~MLgLIAvALLILaCSy~K~ss~   59 (117)
                      -|.++|....+.|+++.++--..|++|....
T Consensus        33 ~~~~~g~~~~~~L~~FF~~ss~~Tk~~~~~K   63 (226)
T PF01940_consen   33 IYGFGGWPWFLLLLAFFISSSLATKYKKERK   63 (226)
T ss_pred             HHHhhhHHHHHHHHHHHHHHHHHHhCChHHH
Confidence            5677888888888888888888898876543


No 110
>PF00974 Rhabdo_glycop:  Rhabdovirus spike glycoprotein;  InterPro: IPR001903 Different families of ssRNA negative-strand viruses contain glycoproteins responsible for forming spikes on the surface of the virion. The glycoprotein spike is made up of a trimer of glycoproteins. These proteins are frequently abbreviated to G protein. Channel formed by glycoprotein spike is thought to function in a similar manner to Influenza virus M2 protein channel, thus allowing a signal to pass across the viral membrane to signal for viral uncoating [, ].; GO: 0019031 viral envelope; PDB: 2CMZ_C 2J6J_A 3EGD_D.
Probab=21.38  E-value=31  Score=30.65  Aligned_cols=8  Identities=13%  Similarity=0.418  Sum_probs=0.0

Q ss_pred             CCccCCCC
Q 035876           19 GGLGHWNS   26 (117)
Q Consensus        19 ~~~~~W~S   26 (117)
                      .+++.|..
T Consensus       446 ~~~~~W~~  453 (501)
T PF00974_consen  446 LWFSNWGE  453 (501)
T ss_dssp             --------
T ss_pred             cccccHHH
Confidence            57788865


No 111
>TIGR03501 gamma_C_targ gammaproteobacterial enzyme C-terminal transmembrane domain. This homology domain, largely restricted to a subset of the gamma proteobacteria that excludes the enterobacteria, is found at the extreme carboxyl-terminus of a diverse set of proteins, most of which are enzymes with conventional signal sequences and with hydrolytic activities: nucleases, proteases, agarases, etc. Species that have this domain at all typically have from two to fifteen proteins tagged with this domain at the C-terminus. The agarase AgaA from Vibro sp. strain JT0107 is secreted into the medium, while the same protein heterologously expressed in E. coli is retained in the cell fraction. This suggests cleavage and release in species with this domain. Both this suggestion, and the chemical structure of the domain (motif, hydrophobic predicted transmembrane helix, cluster of basic residues) closely parallels that of the LPXTG/sortase system and the PEP-CTERM/exosortase(EpsH) system.
Probab=21.33  E-value=1e+02  Score=17.33  Aligned_cols=17  Identities=24%  Similarity=0.540  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHhhhcc
Q 035876           39 MGLITVALMILACSYRK   55 (117)
Q Consensus        39 LgLIAvALLILaCSy~K   55 (117)
                      ||..++.+|.+..-+||
T Consensus         5 lGwl~LllL~~~~~rRr   21 (26)
T TIGR03501         5 LGWLSLLLLLLLGLRRR   21 (26)
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            45566666655554444


No 112
>PRK10884 SH3 domain-containing protein; Provisional
Probab=21.07  E-value=85  Score=24.93  Aligned_cols=17  Identities=29%  Similarity=0.761  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 035876           30 YLFGGLGLMMGLITVALM   47 (117)
Q Consensus        30 YLFgGLA~MLgLIAvALL   47 (117)
                      |+.||+.+.+||| +.|+
T Consensus       174 f~~Gg~v~~~Gll-lGli  190 (206)
T PRK10884        174 FMYGGGVAGIGLL-LGLL  190 (206)
T ss_pred             HHHchHHHHHHHH-HHHH
Confidence            6788999999988 4443


No 113
>PF01594 UPF0118:  Domain of unknown function DUF20;  InterPro: IPR002549  This is a family of hypothetical proteins. A number of the sequence records state they are transmembrane proteins or putative permeases. It is not clear what source suggested that these proteins might be permeases and this information should be treated with caution.
Probab=20.97  E-value=1.5e+02  Score=23.32  Aligned_cols=26  Identities=27%  Similarity=0.461  Sum_probs=21.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcc
Q 035876           30 YLFGGLGLMMGLITVALMILACSYRK   55 (117)
Q Consensus        30 YLFgGLA~MLgLIAvALLILaCSy~K   55 (117)
                      ++||-+++++|...++++...|-.||
T Consensus       302 ~~fG~~G~il~~pi~~~~~~~~~~~~  327 (327)
T PF01594_consen  302 YLFGFIGLILAPPILAVIKAIFEEYR  327 (327)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHHHHhC
Confidence            57888888899888888888877664


No 114
>PF06387 Calcyon:  D1 dopamine receptor-interacting protein (calcyon);  InterPro: IPR009431 This family consists of several D1 dopamine receptor-interacting (calcyon) proteins. D1/D5 dopamine receptors in the basal ganglia, hippocampus, and cerebral cortex modulate motor, reward, and cognitive behaviour. D1-like dopamine receptors likely modulate neocortical and hippocampal neuronal excitability and synaptic function via Ca2+ as well as cAMP-dependent signalling []. Defective calcyon proteins have been implicated in both attention-deficit/hyperactivity disorder (ADHD) [] and schizophrenia.; GO: 0050780 dopamine receptor binding, 0007212 dopamine receptor signaling pathway, 0016021 integral to membrane
Probab=20.93  E-value=72  Score=25.76  Aligned_cols=14  Identities=43%  Similarity=0.686  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHhh
Q 035876           39 MGLITVALMILACS   52 (117)
Q Consensus        39 LgLIAvALLILaCS   52 (117)
                      -+||++||..|+|=
T Consensus        85 t~lI~~alAfl~Cv   98 (186)
T PF06387_consen   85 TRLIAFALAFLGCV   98 (186)
T ss_pred             hHHHHHHHHHHHHH
Confidence            35788888888887


No 115
>PF13623 SurA_N_2:  SurA N-terminal domain
Probab=20.89  E-value=90  Score=23.34  Aligned_cols=17  Identities=24%  Similarity=0.340  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHHHHhhh
Q 035876           37 LMMGLITVALMILACSY   53 (117)
Q Consensus        37 ~MLgLIAvALLILaCSy   53 (117)
                      +++++|++||+...-+-
T Consensus        10 lLi~vIglAL~aFIv~d   26 (145)
T PF13623_consen   10 LLIIVIGLALFAFIVGD   26 (145)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45677888887766554


No 116
>KOG4671 consensus Brain cell membrane protein 1 (BCMP1) [General function prediction only]
Probab=20.34  E-value=96  Score=25.33  Aligned_cols=27  Identities=37%  Similarity=0.560  Sum_probs=21.0

Q ss_pred             CCCCChhHHHHHHHHHHHHHHHHHHHHH-hhh
Q 035876           23 HWNSPLPYLFGGLGLMMGLITVALMILA-CSY   53 (117)
Q Consensus        23 ~W~SPvPYLFgGLA~MLgLIAvALLILa-CSy   53 (117)
                      +|--|.+-..    ++..|||+||.|.| ||+
T Consensus        12 r~~~plk~i~----licl~~aial~IvAl~s~   39 (201)
T KOG4671|consen   12 RWILPLKLIL----LICLLSAIALDIVALASR   39 (201)
T ss_pred             EEEEechHHH----HHHHHHHHHHHHHHhccc
Confidence            3666776543    78899999999988 777


No 117
>PF12606 RELT:  Tumour necrosis factor receptor superfamily member 19;  InterPro: IPR022248 The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis).  RELT (receptor expressed in lymphoid tissues) is a member of the TNFR superfamily. The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1 []. RELT like proteins 1 and 2 (RELL1 and RELL2) are two RELT homologues that bind to RELT. The expression of RELL1 at the mRNA level is ubiquitous, whereas expression of RELL2 mRNA is more restricted to particular tissues [].
Probab=20.21  E-value=2.5e+02  Score=17.98  Aligned_cols=18  Identities=17%  Similarity=0.163  Sum_probs=10.6

Q ss_pred             HHHHHHHHHhhhcccCCC
Q 035876           42 ITVALMILACSYRKSSSN   59 (117)
Q Consensus        42 IAvALLILaCSy~K~ss~   59 (117)
                      |.+-|.++.|.--|-.+.
T Consensus        12 v~~lLg~~I~~~~K~ygY   29 (50)
T PF12606_consen   12 VMGLLGLSICTTLKAYGY   29 (50)
T ss_pred             HHHHHHHHHHHHhhcccc
Confidence            444456677877665444


Done!