BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035926
         (247 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|P14895|ELI5_HORVU High molecular mass early light-inducible protein HV58,
           chloroplastic OS=Hordeum vulgare PE=2 SV=1
          Length = 231

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 157 PQAELLNGRAAMVGFFMGYIVDALTGLDVVGQTGN-------FICKAGVFVTVAGIILFR 209
           P  E +NGR AMVGF     V+A  G  ++ Q G        F+  AGVF +VA ++   
Sbjct: 127 PAPERINGRLAMVGFVAALSVEAARGGGLLDQVGMWSSGLAWFLATAGVF-SVASLLPLL 185

Query: 210 KNEDFQN 216
           + +  ++
Sbjct: 186 QGQSVES 192


>sp|Q01931|DS22_CRAPL Desiccation stress protein DSP-22, chloroplastic OS=Craterostigma
           plantagineum GN=DSP-22 PE=2 SV=1
          Length = 199

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 11/68 (16%)

Query: 160 ELLNGRAAMVGFFMGYIVDALTGLDVVGQTGN-----FICKAGVFVTVAGIILFR----- 209
           E +NGR+AM+GF     V+  TG DV  Q  N     F+  + V V    I ++R     
Sbjct: 100 ERINGRSAMIGFVAAVGVELATGRDVFSQVFNGGVMWFLLTSAVLVLATLIPIYRGLSPE 159

Query: 210 -KNEDFQN 216
            KN  F N
Sbjct: 160 AKNNGFWN 167


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.315    0.129    0.389 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 90,600,169
Number of Sequences: 539616
Number of extensions: 3562766
Number of successful extensions: 10600
Number of sequences better than 100.0: 26
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 20
Number of HSP's that attempted gapping in prelim test: 10584
Number of HSP's gapped (non-prelim): 31
length of query: 247
length of database: 191,569,459
effective HSP length: 114
effective length of query: 133
effective length of database: 130,053,235
effective search space: 17297080255
effective search space used: 17297080255
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)