BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 035960
         (256 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q6UXH8|CCBE1_HUMAN Collagen and calcium-binding EGF domain-containing protein 1
           OS=Homo sapiens GN=CCBE1 PE=1 SV=1
          Length = 406

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 22/44 (50%)

Query: 199 ILSTGDLSLAETPECQKGMRLILALCLSEGFDTFPTLLCADGCS 242
           + S+G+L+     +C KG + +L  C+ E +D      C   C+
Sbjct: 60  LKSSGELTTCYRKKCCKGYKFVLGQCIPEDYDVCAEAPCEQQCT 103


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.321    0.138    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 96,519,823
Number of Sequences: 539616
Number of extensions: 3947314
Number of successful extensions: 7443
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 7442
Number of HSP's gapped (non-prelim): 3
length of query: 256
length of database: 191,569,459
effective HSP length: 115
effective length of query: 141
effective length of database: 129,513,619
effective search space: 18261420279
effective search space used: 18261420279
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)