BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 035960
(256 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q6UXH8|CCBE1_HUMAN Collagen and calcium-binding EGF domain-containing protein 1
OS=Homo sapiens GN=CCBE1 PE=1 SV=1
Length = 406
Score = 30.8 bits (68), Expect = 9.3, Method: Compositional matrix adjust.
Identities = 12/44 (27%), Positives = 22/44 (50%)
Query: 199 ILSTGDLSLAETPECQKGMRLILALCLSEGFDTFPTLLCADGCS 242
+ S+G+L+ +C KG + +L C+ E +D C C+
Sbjct: 60 LKSSGELTTCYRKKCCKGYKFVLGQCIPEDYDVCAEAPCEQQCT 103
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.321 0.138 0.405
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 96,519,823
Number of Sequences: 539616
Number of extensions: 3947314
Number of successful extensions: 7443
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 7442
Number of HSP's gapped (non-prelim): 3
length of query: 256
length of database: 191,569,459
effective HSP length: 115
effective length of query: 141
effective length of database: 129,513,619
effective search space: 18261420279
effective search space used: 18261420279
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)