Query         035991
Match_columns 140
No_of_seqs    190 out of 708
Neff          5.2 
Searched_HMMs 46136
Date          Fri Mar 29 08:20:56 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/035991.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/035991hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4742 Predicted chitinase [G  99.9 3.8E-25 8.1E-30  184.2   6.5   89   49-137    36-151 (286)
  2 PF00182 Glyco_hydro_19:  Chiti  99.9   4E-25 8.7E-30  179.9   0.2   70   68-137     1-74  (232)
  3 cd00325 chitinase_glyco_hydro_  99.9 2.4E-24 5.2E-29  175.3   3.9   69   69-137     1-73  (230)
  4 PF00187 Chitin_bind_1:  Chitin  99.6 6.6E-16 1.4E-20   95.3   1.1   40   23-62      1-40  (40)
  5 smart00270 ChtBD1 Chitin bindi  99.5 3.1E-14 6.8E-19   86.9   2.9   38   25-62      1-38  (38)
  6 cd00035 ChtBD1 Chitin binding   99.2 5.5E-12 1.2E-16   77.6   2.4   38   25-62      1-38  (40)
  7 cd06918 ChtBD1_like Domain obs  97.4 0.00014 3.1E-09   47.0   2.4   38   22-59      3-49  (51)
  8 PF06607 Prokineticin:  Prokine  74.3     1.3 2.9E-05   32.0   0.6   25   20-47     20-44  (97)
  9 PRK15291 fimbrial protein StgD  70.8     3.3 7.2E-05   36.1   2.4   30    1-30      1-31  (355)
 10 COG3179 Predicted chitinase [G  67.2     2.8 6.1E-05   34.1   1.1   55   68-136     3-62  (206)
 11 PF02950 Conotoxin:  Conotoxin;  56.1     6.1 0.00013   26.0   1.0    8    1-8       1-8   (75)
 12 PF07172 GRP:  Glycine rich pro  53.0      14  0.0003   26.4   2.5    7    5-11      5-11  (95)
 13 PRK15321 putative type III sec  42.3      15 0.00033   27.1   1.4   31   93-123    18-49  (120)
 14 PF15240 Pro-rich:  Proline-ric  35.5      27 0.00058   28.0   1.9    7    6-12      3-9   (179)
 15 cd08778 Death_TNFRSF21 Death d  35.1      11 0.00023   26.3  -0.4    8  116-123    28-35  (84)
 16 PF10873 DUF2668:  Protein of u  34.0      22 0.00047   27.8   1.1   19   94-112   100-118 (155)
 17 PF08194 DIM:  DIM protein;  In  30.5      55  0.0012   19.7   2.2    6    1-6       1-6   (36)
 18 PF01616 Orbi_NS3:  Orbivirus N  22.2      35 0.00077   27.6   0.5   15  109-123    37-51  (195)
 19 PF05353 Atracotoxin:  Delta At  20.4      49  0.0011   20.5   0.7   16   40-55      1-16  (42)

No 1  
>KOG4742 consensus Predicted chitinase [General function prediction only]
Probab=99.91  E-value=3.8e-25  Score=184.22  Aligned_cols=89  Identities=31%  Similarity=0.624  Sum_probs=81.7

Q ss_pred             Cchhhhhccccc-CC---------ccCCcccchhhhhccCCCCCCCCCCCCCcccHHHHHHHHhcCCCCCCCCCCcchhh
Q 035991           49 ITATYCGEGCQR-QC---------HHLSSFLDQSTFDEVFPNQNSSNCPSQGFYTYDALINAAKSFSGFASVGDDGTRKS  118 (140)
Q Consensus        49 ~t~~yCg~gCq~-~c---------gsvssiiT~alFn~mf~~rn~~~C~g~gFYTy~aFi~Aa~~fp~Fg~tG~~~~~kR  118 (140)
                      ++..||+.+|++ +|         ++++++||+++||+||+++|++.|++++||||++||.|+++||+||++|+..++||
T Consensus        36 ~~~~~~~~~c~~g~c~~~~~~~p~~~i~~~~T~~~F~~i~~~~~~g~c~~~gfyty~aFi~Aa~sfp~fg~t~~~~~~kr  115 (286)
T KOG4742|consen   36 TTPPYCKFGCGPGPCSGPGPPNPASKIESSVTPELFEDIFSKVGSGWCPAKGFYTYDAFIIAARSFPEFGGTGNKNTAKR  115 (286)
T ss_pred             cccccccCCCCCCCCCCCCCCCCcccccccccHHHHHHHhccccCCCCCCCCCccccHHHHHHHhcccccccCcccccch
Confidence            566788888776 45         46999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcc----cccC---------C----ceEEEEEcC
Q 035991          119 TTRKM----GFTD---------A----KLVSVITFP  137 (140)
Q Consensus       119 ElAAf----~het---------~----~~~~~~~~~  137 (140)
                      |||||    +|||         +    +|+|++|+-
T Consensus       116 eiAaf~ah~~~ETs~g~~~~~~G~~~~~fc~~~e~s  151 (286)
T KOG4742|consen  116 EIAAFFAHVTHETSGGSNCAPRGPFYWGFCYKEEIS  151 (286)
T ss_pred             hhhhhhhhheecccCcccccCCCccccCcccccccC
Confidence            99999    9999         6    899999863


No 2  
>PF00182 Glyco_hydro_19:  Chitinase class I;  InterPro: IPR000726 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 19 GH19 from CAZY comprises enzymes with only one known activity; chitinase (3.2.1.14 from EC). Chitinases [] are enzymes that catalyse the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Chitinases belong to glycoside hydrolase families 18 or 19 []. Chitinases of family 19 (also known as classes IA or I and IB or II) are enzymes from plants that function in the defence against fungal and insect pathogens by destroying their chitin-containing cell wall. Class IA/I and IB/II enzymes differ in the presence (IA/I) or absence (IB/II) of a N-terminal chitin-binding domain. The catalytic domain of these enzymes consist of about 220 to 230 amino acid residues.; GO: 0004568 chitinase activity, 0006032 chitin catabolic process, 0016998 cell wall macromolecule catabolic process; PDB: 3IWR_A 2DKV_A 3CQL_A 2Z38_A 2Z37_D 2Z39_B 1DXJ_A 1WVU_B 1WVV_B 2DBT_C ....
Probab=99.90  E-value=4e-25  Score=179.88  Aligned_cols=70  Identities=37%  Similarity=0.718  Sum_probs=65.2

Q ss_pred             ccchhhhhccCCCCCCCCCCCCCcccHHHHHHHHhcCCCCCCCCCCcchhhhhhcc----cccCCceEEEEEcC
Q 035991           68 FLDQSTFDEVFPNQNSSNCPSQGFYTYDALINAAKSFSGFASVGDDGTRKSTTRKM----GFTDAKLVSVITFP  137 (140)
Q Consensus        68 iiT~alFn~mf~~rn~~~C~g~gFYTy~aFi~Aa~~fp~Fg~tG~~~~~kRElAAf----~het~~~~~~~~~~  137 (140)
                      |||+++||+||||||+..|++++||||++||+|+++||+|+++|+++++|||||||    +|||+++.+++|..
T Consensus         1 ivt~~~F~~~~~~~n~~~c~~~~FYTY~~Fi~Aa~~fp~F~~tG~~~~~krElAAFLA~~~hET~g~~~~~e~~   74 (232)
T PF00182_consen    1 IVTESFFNQMFPHRNDNGCPGKGFYTYDAFIAAAKSFPAFGNTGDDEDRKRELAAFLAQVSHETGGFWYIEEIG   74 (232)
T ss_dssp             TS-HHHHHHHTTTTTSTTSTTTTTS-HHHHHHHHTTSTTTTTSSSHHHHHHHHHHHHHHHHHHTTTTTTTBTTS
T ss_pred             CCCHHHHHHHHhcCCccCCCCCCcccHHHHHHHhhcCchhccCccHHHHHHHHHhhhcccchhccccccccccc
Confidence            68999999999999999999999999999999999999999999999999999999    99999999887754


No 3  
>cd00325 chitinase_glyco_hydro_19 Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different en
Probab=99.89  E-value=2.4e-24  Score=175.30  Aligned_cols=69  Identities=39%  Similarity=0.710  Sum_probs=66.5

Q ss_pred             cchhhhhccCCCCCCCCCCCCCcccHHHHHHHHhcCCCCCCCCCCcchhhhhhcc----cccCCceEEEEEcC
Q 035991           69 LDQSTFDEVFPNQNSSNCPSQGFYTYDALINAAKSFSGFASVGDDGTRKSTTRKM----GFTDAKLVSVITFP  137 (140)
Q Consensus        69 iT~alFn~mf~~rn~~~C~g~gFYTy~aFi~Aa~~fp~Fg~tG~~~~~kRElAAf----~het~~~~~~~~~~  137 (140)
                      ||+++||+||+|||+..||+++||||++||+|+++||+|+++|+++++|||||||    +|||+|+++++|.+
T Consensus         1 ~t~~~f~~~~~~~~~~~c~~~~fYTy~~fi~Aa~~fp~f~~~g~~~~~krElAaFlAq~~hETgg~~~~~e~~   73 (230)
T cd00325           1 VTESLFEGIFSHRNDSGCPAKGFYTYDAFITAANSFPGFGTTGDDDTRKREIAAFFAHTSHETGGGCYIAPDG   73 (230)
T ss_pred             CCHHHHHHHhhcCCCCCCCCCCCCcHHHHHHHHHhccccccCCCchhhHHHHHHHHhhhcccCCCCccccccc
Confidence            6899999999999999999999999999999999999999999999999999999    99999999998864


No 4  
>PF00187 Chitin_bind_1:  Chitin recognition protein;  InterPro: IPR001002 A number of plant and fungal proteins that bind N-acetylglucosamine (e.g. solanaceous lectins of tomato and potato, plant endochitinases, the wound-induced proteins: hevein, win1 and win2, and the Kluyveromyces lactis killer toxin alpha subunit) contain this domain []. The domain may occur in one or more copies and is thought to be involved in recognition or binding of chitin subunits [, ]. In chitinases, as well as in the potato wound-induced proteins, the 43-residue domain directly follows the signal sequence and is therefore at the N terminus of the mature protein; in the killer toxin alpha subunit it is located in the central section of the protein. ; GO: 0008061 chitin binding; PDB: 9WGA_B 2WGC_B 1ULK_B 2UVO_B 1WGC_B 2CWG_A 2X3T_C 4AML_B 7WGA_B 1ZWU_A ....
Probab=99.56  E-value=6.6e-16  Score=95.25  Aligned_cols=40  Identities=63%  Similarity=1.493  Sum_probs=36.4

Q ss_pred             cCcccCCcCCCCCCCCcccCcCcccCCchhhhhcccccCC
Q 035991           23 NEQCGKQAGGALCPNDDCCSKDGFCGITATYCGEGCQRQC   62 (140)
Q Consensus        23 ~~~CG~~~~~~~C~~~~CCS~~G~CG~t~~yCg~gCq~~c   62 (140)
                      +++||++.++.+||.+.|||+|||||++.+||+.+||++|
T Consensus         1 a~~CG~~~~~~~Cp~~~CCS~~G~CG~t~~yCg~gCQ~~C   40 (40)
T PF00187_consen    1 AQRCGRQAGGATCPNGLCCSQYGYCGTTSDYCGAGCQSQC   40 (40)
T ss_dssp             -CBSSGGGTTBBSGGG-EEETTSBEESSHHHHSTTEESST
T ss_pred             CcccccCcCCCcCCCCCccCCCCcccCChhhhhcccccCC
Confidence            4789999899999999999999999999999999999987


No 5  
>smart00270 ChtBD1 Chitin binding domain.
Probab=99.47  E-value=3.1e-14  Score=86.92  Aligned_cols=38  Identities=61%  Similarity=1.498  Sum_probs=36.4

Q ss_pred             cccCCcCCCCCCCCcccCcCcccCCchhhhhcccccCC
Q 035991           25 QCGKQAGGALCPNDDCCSKDGFCGITATYCGEGCQRQC   62 (140)
Q Consensus        25 ~CG~~~~~~~C~~~~CCS~~G~CG~t~~yCg~gCq~~c   62 (140)
                      +||+++++.+|+.+.|||+|||||++.+||+.|||++|
T Consensus         1 ~CG~~~g~~~C~~~~CCS~~G~CG~t~~yCg~gCqs~c   38 (38)
T smart00270        1 RCGSQAGGKVCPNNLCCSQFGYCGSGDEYCGKGCQSQC   38 (38)
T ss_pred             CCcCCCCCCcCCCCCccCCCcCccCCHHHHhccccCCC
Confidence            69999999999999999999999999999999999987


No 6  
>cd00035 ChtBD1 Chitin binding domain, involved in recognition or binding of chitin subunits; fold analogous to hevein; occurs in plant and fungal proteins that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins, and K.lactis killer toxin alpha subunit, occurs singly or multiply
Probab=99.22  E-value=5.5e-12  Score=77.59  Aligned_cols=38  Identities=58%  Similarity=1.412  Sum_probs=36.3

Q ss_pred             cccCCcCCCCCCCCcccCcCcccCCchhhhhcccccCC
Q 035991           25 QCGKQAGGALCPNDDCCSKDGFCGITATYCGEGCQRQC   62 (140)
Q Consensus        25 ~CG~~~~~~~C~~~~CCS~~G~CG~t~~yCg~gCq~~c   62 (140)
                      +||+++++..|+.+.|||++||||++.+||+.+||+.|
T Consensus         1 ~Cg~~~~~~~C~~~~CCS~~G~CG~t~~~Cg~gcq~~c   38 (40)
T cd00035           1 NCGRQAGGGGCPPGLCCSQFGYCGTTDDYCGRGCQSGC   38 (40)
T ss_pred             CCCccCCCCcCCCCccccccccccCCcccccccccccc
Confidence            69999999999999999999999999999999999987


No 7  
>cd06918 ChtBD1_like Domain observed in several metazoan proteins. The pattern of conserved cysteine residues resembles that of chitin binding domains found in plants and fungi.
Probab=97.35  E-value=0.00014  Score=46.97  Aligned_cols=38  Identities=32%  Similarity=0.919  Sum_probs=28.1

Q ss_pred             ccCcccCCc-----CCCCCCC---CcccCcCcccCCchhhhh-cccc
Q 035991           22 ENEQCGKQA-----GGALCPN---DDCCSKDGFCGITATYCG-EGCQ   59 (140)
Q Consensus        22 ~~~~CG~~~-----~~~~C~~---~~CCS~~G~CG~t~~yCg-~gCq   59 (140)
                      .+.+||...     +-..|..   ..|||.+||||.+.+||. .+|.
T Consensus         3 ~dgrCG~~~p~~~g~~~~CdPdg~~pCCS~~gwCG~t~~hC~C~~Cv   49 (51)
T cd06918           3 KDGRCGPKFPLPGGKPPECDPDSPKPCCSNGGYCGSGSEHCDCPGCV   49 (51)
T ss_pred             cCCccCCCccCCCCCccccCCCCCCcccCCCceeCCCcccccCCCCc
Confidence            367788765     1234754   599999999999999997 6663


No 8  
>PF06607 Prokineticin:  Prokineticin;  InterPro: IPR023569 The prokineticin family includes prokinectin itself and related proteins such as BM8 and the AVIToxins. The suprachiasmatic nucleus (SCN) controls the circadian rhythm of physiological and behavioural processes in mammals. It has been shown that prokineticin 2 (PK2), a cysteine-rich secreted protein, functions as an output molecule from the SCN circadian clock. PK2 messenger RNA is rhythmically expressed in the SCN, and the phase of PK2 rhythm is responsive to light entrainment. Molecular and genetic studies have revealed that PK2 is a gene that is controlled by a circadian clock []. The prokinectin domain is found in the prokinectin family and the hainantoxins, where it comprises the whole length of the protein. This domain is also found at the C terminus of some members of the Dickkopf family.; PDB: 1IMT_A 2KRA_A.
Probab=74.31  E-value=1.3  Score=32.00  Aligned_cols=25  Identities=20%  Similarity=0.549  Sum_probs=12.8

Q ss_pred             hcccCcccCCcCCCCCCCCcccCcCccc
Q 035991           20 SAENEQCGKQAGGALCPNDDCCSKDGFC   47 (140)
Q Consensus        20 ~~~~~~CG~~~~~~~C~~~~CCS~~G~C   47 (140)
                      .+-.+.|-.   ...|..+.||+.+-|=
T Consensus        20 ~vitg~C~~---d~dCg~G~CCA~~~~~   44 (97)
T PF06607_consen   20 AVITGACES---DADCGPGTCCAVSNWR   44 (97)
T ss_dssp             ---SSC-SS---GGGT-TTEEECE-SS-
T ss_pred             eEEeccccC---cCCCCCCceeCccccc
Confidence            334566654   4568889999987554


No 9  
>PRK15291 fimbrial protein StgD; Provisional
Probab=70.83  E-value=3.3  Score=36.08  Aligned_cols=30  Identities=23%  Similarity=0.423  Sum_probs=19.3

Q ss_pred             CchHHHHHHHHHHHHHH-hhhcccCcccCCc
Q 035991            1 MKFQAFLLFSLVLSFLL-VISAENEQCGKQA   30 (140)
Q Consensus         1 ~~~~~~~~~~~~~~~~~-~~~~~~~~CG~~~   30 (140)
                      ||||++++|.|++..|- .+.+..+.|.+..
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~a~~G~c~~~g   31 (355)
T PRK15291          1 MRLWTIILFSCFMVLISPVCRAGDGICHAVK   31 (355)
T ss_pred             CcchhHHHHHHHHHhhccccccccCceecCC
Confidence            99999988876553332 3344478886553


No 10 
>COG3179 Predicted chitinase [General function prediction only]
Probab=67.18  E-value=2.8  Score=34.08  Aligned_cols=55  Identities=11%  Similarity=0.162  Sum_probs=38.4

Q ss_pred             ccchhhhhccCCCCCCCCCCCCCcccHHHHHHHHh-cCCCCCCCCCCcchhhhhhcc----cccCCceEEEEEc
Q 035991           68 FLDQSTFDEVFPNQNSSNCPSQGFYTYDALINAAK-SFSGFASVGDDGTRKSTTRKM----GFTDAKLVSVITF  136 (140)
Q Consensus        68 iiT~alFn~mf~~rn~~~C~g~gFYTy~aFi~Aa~-~fp~Fg~tG~~~~~kRElAAf----~het~~~~~~~~~  136 (140)
                      .+++..|.+|+|+.-      +.|  - .++.|+. ....||-     +++-.+|.|    .||++||.-++|.
T Consensus         3 ~i~e~~~~ki~p~a~------k~~--~-~v~~al~~~l~~~gi-----~~p~r~AmFlAQ~~HESggf~rl~En   62 (206)
T COG3179           3 TITEVDLRKIFPKAR------KEF--V-DVIVALQPALDEAGI-----TTPLRQAMFLAQVMHESGGFTRLDEN   62 (206)
T ss_pred             chhHHHHHHhcchhh------hhh--H-HHHHHHHHHHHHhcC-----CCHHHHHHHHHHHhhhcCCceeehhh
Confidence            477888999999842      344  2 3333444 4556763     347778999    9999999988874


No 11 
>PF02950 Conotoxin:  Conotoxin;  InterPro: IPR004214 Cone snail toxins, conotoxins, are small neurotoxic peptides with disulphide connectivity that target ion-channels or G-protein coupled receptors. Based on the number and pattern of disulphide bonds and biological activities, conotoxins can be classified into several families []. Omega, delta and kappa families of conotoxins have a knottin or inhibitor cysteine knot scaffold. The knottin scaffold is a very special disulphide-through-disulphide knot, in which the III-VI disulphide bond crosses the macrocycle formed by two other disulphide bonds (I-IV and II-V) and the interconnecting backbone segments, where I-VI indicates the six cysteine residues starting from the N terminus.  The disulphide bonding network, as well as specific amino acids in inter-cysteine loops, provide the specificity of conotoxins []. The cysteine arrangements are the same for omega, delta and kappa families, even though omega conotoxins are calcium channel blockers, whereas delta conotoxins delay the inactivation of sodium channels, and kappa conotoxins are potassium channel blockers []. Mu conotoxins have two types of cysteine arrangements, but the knottin scaffold is not observed. Mu conotoxins target the voltage-gated sodium channels [], and are useful probes for investigating voltage-dependent sodium channels of excitable tissues []. Alpha conotoxins have two types of cysteine arrangements [], and are competitive nicotinic acetylcholine receptor antagonists. ; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 2EFZ_A 1FYG_A 1RMK_A 1DG0_A 1DFY_A 1DFZ_A 2JQC_A 2YYF_A 2JQB_A 1F3K_A ....
Probab=56.09  E-value=6.1  Score=25.97  Aligned_cols=8  Identities=38%  Similarity=0.704  Sum_probs=0.0

Q ss_pred             CchHHHHH
Q 035991            1 MKFQAFLL    8 (140)
Q Consensus         1 ~~~~~~~~    8 (140)
                      |||..++|
T Consensus         1 mKLt~vli    8 (75)
T PF02950_consen    1 MKLTCVLI    8 (75)
T ss_dssp             --------
T ss_pred             CCcchHHH
Confidence            78874444


No 12 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=53.02  E-value=14  Score=26.42  Aligned_cols=7  Identities=71%  Similarity=1.132  Sum_probs=2.7

Q ss_pred             HHHHHHH
Q 035991            5 AFLLFSL   11 (140)
Q Consensus         5 ~~~~~~~   11 (140)
                      ++||+.|
T Consensus         5 ~~llL~l   11 (95)
T PF07172_consen    5 AFLLLGL   11 (95)
T ss_pred             HHHHHHH
Confidence            3444333


No 13 
>PRK15321 putative type III secretion system effector protein OrgC; Provisional
Probab=42.30  E-value=15  Score=27.14  Aligned_cols=31  Identities=16%  Similarity=0.099  Sum_probs=24.1

Q ss_pred             cHHHHHHHHhcCCCCCCCC-CCcchhhhhhcc
Q 035991           93 TYDALINAAKSFSGFASVG-DDGTRKSTTRKM  123 (140)
Q Consensus        93 Ty~aFi~Aa~~fp~Fg~tG-~~~~~kRElAAf  123 (140)
                      -|++|..+..+.|....+- -.|+--||+-||
T Consensus        18 lydAF~Q~l~~LP~la~S~~~KD~I~q~m~~F   49 (120)
T PRK15321         18 LYDAFYQRLLALPESASSETLKDSIYQEMNAF   49 (120)
T ss_pred             HHHHHHHHHHhCCcccCcHHHHHHHHHHHHHh
Confidence            3999999999999966432 234567899999


No 14 
>PF15240 Pro-rich:  Proline-rich
Probab=35.52  E-value=27  Score=27.98  Aligned_cols=7  Identities=29%  Similarity=0.662  Sum_probs=3.0

Q ss_pred             HHHHHHH
Q 035991            6 FLLFSLV   12 (140)
Q Consensus         6 ~~~~~~~   12 (140)
                      ||||+.|
T Consensus         3 lVLLSvA    9 (179)
T PF15240_consen    3 LVLLSVA    9 (179)
T ss_pred             hHHHHHH
Confidence            3444443


No 15 
>cd08778 Death_TNFRSF21 Death domain of tumor necrosis factor receptor superfamily member 21. Death domain (DD) found in tumor necrosis factor receptor superfamily member 21 (TNFRSF21), also called death receptor-6, DR6. DR6 is an orphan receptor that is expressed ubiquitously, but shows high expression in lymphoid organs, heart, brain and pancreas. Results from DR6(-/-) mice indicate that DR6 plays an important regulatory role for the generation of adaptive immunity. It may also be involved in tumor cell survival and immune evasion. In neuronal cells, it binds beta-amyloid precursor protein (APP) and activates caspase-dependent cell death. It may contribute to the pathogenesis of Alzheimer's disease. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitme
Probab=35.08  E-value=11  Score=26.29  Aligned_cols=8  Identities=0%  Similarity=0.057  Sum_probs=6.0

Q ss_pred             hhhhhhcc
Q 035991          116 RKSTTRKM  123 (140)
Q Consensus       116 ~kRElAAf  123 (140)
                      ..||+|||
T Consensus        28 terevaaf   35 (84)
T cd08778          28 SEREVAAF   35 (84)
T ss_pred             hHHHHHHH
Confidence            35888888


No 16 
>PF10873 DUF2668:  Protein of unknown function (DUF2668);  InterPro: IPR022640  Members in this family of proteins are annotated as cysteine and tyrosine-rich protein 1, however currently no function is known []. 
Probab=34.04  E-value=22  Score=27.85  Aligned_cols=19  Identities=21%  Similarity=0.153  Sum_probs=10.5

Q ss_pred             HHHHHHHHhcCCCCCCCCC
Q 035991           94 YDALINAAKSFSGFASVGD  112 (140)
Q Consensus        94 y~aFi~Aa~~fp~Fg~tG~  112 (140)
                      ..+-|++..+||+--.+.+
T Consensus       100 ~tt~in~v~SyP~apPpys  118 (155)
T PF10873_consen  100 RTTHINAVSSYPAAPPPYS  118 (155)
T ss_pred             eccccccccccCCCCCCcc
Confidence            4455666667776443443


No 17 
>PF08194 DIM:  DIM protein;  InterPro: IPR013172 Drosophila immune-induced molecules (DIMs) are short proteins induced during the immune response of Drosophila []. This entry includes DIMs 1 to 4 and DIM23.
Probab=30.54  E-value=55  Score=19.72  Aligned_cols=6  Identities=33%  Similarity=0.456  Sum_probs=3.8

Q ss_pred             CchHHH
Q 035991            1 MKFQAF    6 (140)
Q Consensus         1 ~~~~~~    6 (140)
                      ||...+
T Consensus         1 Mk~l~~    6 (36)
T PF08194_consen    1 MKCLSL    6 (36)
T ss_pred             CceeHH
Confidence            676655


No 18 
>PF01616 Orbi_NS3:  Orbivirus NS3;  InterPro: IPR002565 This is a family of Orbivirus non structural protein of unknown function, but which may play a role in release of the virus from infected cells [].
Probab=22.16  E-value=35  Score=27.61  Aligned_cols=15  Identities=13%  Similarity=0.268  Sum_probs=13.9

Q ss_pred             CCCCCcchhhhhhcc
Q 035991          109 SVGDDGTRKSTTRKM  123 (140)
Q Consensus       109 ~tG~~~~~kRElAAf  123 (140)
                      +||.++.+|+|=|||
T Consensus        37 tTGA~~~~K~EKaAy   51 (195)
T PF01616_consen   37 TTGATEAQKNEKAAY   51 (195)
T ss_pred             CccCchhhhHHHHHH
Confidence            579999999999999


No 19 
>PF05353 Atracotoxin:  Delta Atracotoxin;  InterPro: IPR008017 Delta atracotoxin produces potentially fatal neurotoxic symptoms in primates by slowing the inactivation of voltage-gated sodium channels []. The structure of atracotoxin comprises a core beta region containing a triple-stranded a thumb-like extension protruding from the beta region and a C-terminal helix. The beta region contains a cystine knot motif, a feature seen in other neurotoxic polypeptides [].; GO: 0019871 sodium channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 2ROO_A 1VTX_A 1QDP_A.
Probab=20.42  E-value=49  Score=20.51  Aligned_cols=16  Identities=38%  Similarity=0.970  Sum_probs=10.4

Q ss_pred             ccCcCcccCCchhhhh
Q 035991           40 CCSKDGFCGITATYCG   55 (140)
Q Consensus        40 CCS~~G~CG~t~~yCg   55 (140)
                      |-+..+|||.+.|-|-
T Consensus         1 Ca~kr~WC~ktedCCC   16 (42)
T PF05353_consen    1 CAKKRAWCGKTEDCCC   16 (42)
T ss_dssp             -B-TTSB-SSCCCBST
T ss_pred             CccchhhhccccccCc
Confidence            4467889999998774


Done!