BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 036026
         (442 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3IP3|A Chain A, Structure Of Putative Oxidoreductase (Tm_0425) From
           Thermotoga Maritima
 pdb|3IP3|B Chain B, Structure Of Putative Oxidoreductase (Tm_0425) From
           Thermotoga Maritima
 pdb|3IP3|C Chain C, Structure Of Putative Oxidoreductase (Tm_0425) From
           Thermotoga Maritima
 pdb|3IP3|D Chain D, Structure Of Putative Oxidoreductase (Tm_0425) From
           Thermotoga Maritima
 pdb|3IP3|E Chain E, Structure Of Putative Oxidoreductase (Tm_0425) From
           Thermotoga Maritima
 pdb|3IP3|F Chain F, Structure Of Putative Oxidoreductase (Tm_0425) From
           Thermotoga Maritima
 pdb|3IP3|G Chain G, Structure Of Putative Oxidoreductase (Tm_0425) From
           Thermotoga Maritima
 pdb|3IP3|H Chain H, Structure Of Putative Oxidoreductase (Tm_0425) From
           Thermotoga Maritima
          Length = 337

 Score = 31.6 bits (70), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 297 LEKQVSSFVDDPGLPCESALKKMYKLLEKVEQSVYALLRTRDMAISRYREFGIPVDWLLD 356
           LE+++ +FV+ P       L+K+  + +KV   V+    T    I RYR   +    L+ 
Sbjct: 88  LERKIHAFVEKPIATTFEDLEKIRSVYQKVRNEVFF---TAXFGI-RYRPHFLTAKKLVS 143

Query: 357 TGVVGKIKLSSVQLARKYMKR 377
            G VG+I+L + Q + K  +R
Sbjct: 144 EGAVGEIRLVNTQKSYKLGQR 164


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.130    0.356 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,140,398
Number of Sequences: 62578
Number of extensions: 303103
Number of successful extensions: 775
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 773
Number of HSP's gapped (non-prelim): 4
length of query: 442
length of database: 14,973,337
effective HSP length: 102
effective length of query: 340
effective length of database: 8,590,381
effective search space: 2920729540
effective search space used: 2920729540
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)