BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 036055
         (105 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2Y5C|A Chain A, Structure Of Human Ferredoxin 2 (Fdx2)in Complex With
          2fe2s Cluster
 pdb|2Y5C|B Chain B, Structure Of Human Ferredoxin 2 (Fdx2)in Complex With
          2fe2s Cluster
          Length = 109

 Score = 30.0 bits (66), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 3/79 (3%)

Query: 18 VAYRIVHLFAIDPDGQKRPIIGLAVQTLLKALTNSGLIDPASHRLEEIDACSVECEVNIA 77
          +A  +V++  +D  GQ+ P+ G     +L      G+        E   ACS  C V ++
Sbjct: 1  MASDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGV--DLEGACEASLACST-CHVYVS 57

Query: 78 QEWLDRLPPRSYEEEYVLK 96
          ++ LD LPP    E+ +L 
Sbjct: 58 EDHLDLLPPPEEREDDMLD 76


>pdb|1L1Y|A Chain A, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|B Chain B, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|C Chain C, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|D Chain D, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|E Chain E, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L1Y|F Chain F, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|A Chain A, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|B Chain B, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|C Chain C, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|D Chain D, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|E Chain E, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
 pdb|1L2A|F Chain F, The Crystal Structure And Catalytic Mechanism Of
           Cellobiohydrolase Cels, The Major Enzymatic Component Of
           The Clostridium Thermocellum Cellulosome
          Length = 678

 Score = 27.3 bits (59), Expect = 2.3,   Method: Composition-based stats.
 Identities = 9/14 (64%), Positives = 12/14 (85%)

Query: 4   FSKQWRYTAAPSAK 17
           ++KQWRYT AP A+
Sbjct: 244 YAKQWRYTNAPDAE 257


>pdb|4FUS|A Chain A, The X-Ray Structure Of Hahella Chejuensis Family 48
           Glycosyl Hydrolase
          Length = 695

 Score = 26.9 bits (58), Expect = 2.9,   Method: Composition-based stats.
 Identities = 9/13 (69%), Positives = 11/13 (84%)

Query: 4   FSKQWRYTAAPSA 16
           +S+QWRYT AP A
Sbjct: 235 YSRQWRYTNAPDA 247


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.134    0.402 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,097,134
Number of Sequences: 62578
Number of extensions: 108450
Number of successful extensions: 241
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 238
Number of HSP's gapped (non-prelim): 4
length of query: 105
length of database: 14,973,337
effective HSP length: 70
effective length of query: 35
effective length of database: 10,592,877
effective search space: 370750695
effective search space used: 370750695
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)