Citrus Sinensis ID: 036063

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
IDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDLTADFHTYSILWNPQRIVFSVDGTPIREFKNSESIGVPFLKNQPMRIGGLIKTQWTHAPFAASYRNFNADA
ccCEECccccccccEEEEEEEEccccccCEEEEEccccccccCEEEEEEcccEEEEEEccCEEEEECccccccccccccccCEEccEEEcccccccEEEEEEEEECcc
IDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDLTADFHTYSILWNPQRIVFSVDGTPIREFKNSESIGVPFLKNQPMRIGGLIKTQWTHAPFAASYRNFNAD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDLTADFHTYSILWNPQRIVFSVDGTPIREFKNSESIGVPFLKNQPMRIGGLIKTQWTHAPFAASYRNFNADA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable xyloglucan endotransglucosylase/hydrolase protein 23 Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.probableQ38910

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UMZ, chain A
Confidence level:very confident
Coverage over the Query: 1-107
View the alignment between query and template
View the model in PyMOL