BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 036071
         (208 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1WLE|A Chain A, Crystal Structure Of Mammalian Mitochondrial Seryl-Trna
           Synthetase Complexed With Seryl-Adenylate
 pdb|1WLE|B Chain B, Crystal Structure Of Mammalian Mitochondrial Seryl-Trna
           Synthetase Complexed With Seryl-Adenylate
          Length = 501

 Score = 29.3 bits (64), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 48  NFEFLNLLFQDLGNEGLIKKGDKALLVGSGNIGPVIASSKF--FNDNEIHLVVKSDLGQL 105
           +F  L++  Q+LG     K   +A + G G  G V ++S    F    +H++ +++ G+L
Sbjct: 368 HFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGEL 427


>pdb|3GQ2|A Chain A, Crystal Structure Of The Dimer Of The P115 Tether Globular
           Head Domain
 pdb|3GQ2|B Chain B, Crystal Structure Of The Dimer Of The P115 Tether Globular
           Head Domain
 pdb|3GRL|A Chain A, Crystal Structure Of The Monomer Of The P115 Tether
           Globular Head Domain
          Length = 651

 Score = 26.9 bits (58), Expect = 7.3,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 10/61 (16%)

Query: 46  SKNFEFLN-LLFQDLGNEGLIKKGDKALLVGSGNIGPVIASSKFFNDNEIHLVVKSDLGQ 104
           S N  FL   + ++LG E  + +G  ALL+G          S +FNDN +   +K  L Q
Sbjct: 516 SANVPFLTGQIAENLGEEEQLVQGLCALLLGI---------SIYFNDNSLETYMKEKLKQ 566

Query: 105 L 105
           L
Sbjct: 567 L 567


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.136    0.375 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,974,032
Number of Sequences: 62578
Number of extensions: 177921
Number of successful extensions: 408
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 408
Number of HSP's gapped (non-prelim): 5
length of query: 208
length of database: 14,973,337
effective HSP length: 94
effective length of query: 114
effective length of database: 9,091,005
effective search space: 1036374570
effective search space used: 1036374570
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)