BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 036071
(208 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1WLE|A Chain A, Crystal Structure Of Mammalian Mitochondrial Seryl-Trna
Synthetase Complexed With Seryl-Adenylate
pdb|1WLE|B Chain B, Crystal Structure Of Mammalian Mitochondrial Seryl-Trna
Synthetase Complexed With Seryl-Adenylate
Length = 501
Score = 29.3 bits (64), Expect = 1.5, Method: Compositional matrix adjust.
Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
Query: 48 NFEFLNLLFQDLGNEGLIKKGDKALLVGSGNIGPVIASSKF--FNDNEIHLVVKSDLGQL 105
+F L++ Q+LG K +A + G G G V ++S F +H++ +++ G+L
Sbjct: 368 HFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGEL 427
>pdb|3GQ2|A Chain A, Crystal Structure Of The Dimer Of The P115 Tether Globular
Head Domain
pdb|3GQ2|B Chain B, Crystal Structure Of The Dimer Of The P115 Tether Globular
Head Domain
pdb|3GRL|A Chain A, Crystal Structure Of The Monomer Of The P115 Tether
Globular Head Domain
Length = 651
Score = 26.9 bits (58), Expect = 7.3, Method: Composition-based stats.
Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 10/61 (16%)
Query: 46 SKNFEFLN-LLFQDLGNEGLIKKGDKALLVGSGNIGPVIASSKFFNDNEIHLVVKSDLGQ 104
S N FL + ++LG E + +G ALL+G S +FNDN + +K L Q
Sbjct: 516 SANVPFLTGQIAENLGEEEQLVQGLCALLLGI---------SIYFNDNSLETYMKEKLKQ 566
Query: 105 L 105
L
Sbjct: 567 L 567
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.136 0.375
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,974,032
Number of Sequences: 62578
Number of extensions: 177921
Number of successful extensions: 408
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 408
Number of HSP's gapped (non-prelim): 5
length of query: 208
length of database: 14,973,337
effective HSP length: 94
effective length of query: 114
effective length of database: 9,091,005
effective search space: 1036374570
effective search space used: 1036374570
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)